BLASTP 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Candidatus_Liberibacter_asiaticus_gxpsy_proteins.fasta 1,141 sequences; 332,037 total letters Query= Untitled_sequence Length=102 Score E Sequences producing significant alignments: (Bits) Value gi|470205416|ref|YP_007599514.1| phage-related lysozyme [Candida... 209 2e-73 gi|470205414|ref|YP_007599512.1| phage-related lysozyme [Candida... 154 6e-51 >gi|470205416|ref|YP_007599514.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. gxpsy] Length=122 Score = 209 bits (531), Expect = 2e-73, Method: Compositional matrix adjust. Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%) Query 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ Sbjct 21 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 80 Query 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG 102 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG Sbjct 81 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG 122 >gi|470205414|ref|YP_007599512.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. gxpsy] Length=171 Score = 154 bits (388), Expect = 6e-51, Method: Compositional matrix adjust. Identities = 76/100 (76%), Positives = 82/100 (82%), Gaps = 0/100 (0%) Query 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 MTIT KEAED LL D L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ Sbjct 70 MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129 Query 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100 RVDAQDWEKAAEECKKWTKAGG+ L G+ RR +LL Sbjct 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169 Lambda K H a alpha 0.314 0.129 0.363 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 10451800 Database: Candidatus_Liberibacter_asiaticus_gxpsy_proteins.fasta Posted date: Jul 20, 2015 1:34 PM Number of letters in database: 332,037 Number of sequences in database: 1,141 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40