BLASTP 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Candidatus_Liberibacter_asiaticus_gxpsy_proteins.fasta 1,141 sequences; 332,037 total letters Query= Untitled_sequence Length=162 Score E Sequences producing significant alignments: (Bits) Value gi|470204930|ref|YP_007599028.1| hypothetical protein WSI_02190 ... 333 7e-121 >gi|470204930|ref|YP_007599028.1| hypothetical protein WSI_02190 [Candidatus Liberibacter asiaticus str. gxpsy] Length=162 Score = 333 bits (853), Expect = 7e-121, Method: Compositional matrix adjust. Identities = 162/162 (100%), Positives = 162/162 (100%), Gaps = 0/162 (0%) Query 1 MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGSKHTMNAEFSVP 60 MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGSKHTMNAEFSVP Sbjct 1 MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGSKHTMNAEFSVP 60 Query 61 KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISAC 120 KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISAC Sbjct 61 KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISAC 120 Query 121 ASDDKGNKSTLCVECPSPSTPGQYDLNHCAECENTTSKGLCP 162 ASDDKGNKSTLCVECPSPSTPGQYDLNHCAECENTTSKGLCP Sbjct 121 ASDDKGNKSTLCVECPSPSTPGQYDLNHCAECENTTSKGLCP 162 Lambda K H a alpha 0.310 0.124 0.354 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 23918206 Database: Candidatus_Liberibacter_asiaticus_gxpsy_proteins.fasta Posted date: Jul 20, 2015 1:34 PM Number of letters in database: 332,037 Number of sequences in database: 1,141 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40