BLASTP 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Candidatus_Liberibacter_asiaticus_psy62_proteins.fasta 1,109 sequences; 318,343 total letters Query= Untitled_sequence Length=131 Score E Sequences producing significant alignments: (Bits) Value gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_0... 271 2e-97 >gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62] Length=131 Score = 271 bits (693), Expect = 2e-97, Method: Compositional matrix adjust. Identities = 131/131 (100%), Positives = 131/131 (100%), Gaps = 0/131 (0%) Query 1 MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60 MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK Sbjct 1 MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60 Query 61 HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120 HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP Sbjct 61 HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120 Query 121 EGDLLCPFINN 131 EGDLLCPFINN Sbjct 121 EGDLLCPFINN 131 Lambda K H a alpha 0.320 0.131 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 16253028 Database: Candidatus_Liberibacter_asiaticus_psy62_proteins.fasta Posted date: Jul 20, 2015 1:37 PM Number of letters in database: 318,343 Number of sequences in database: 1,109 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40