BLASTP 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Csinensis_154_v1.1.protein_primaryTranscriptOnly_annot.fasta 25,379 sequences; 9,695,389 total letters Query= Untitled_sequence Length=86 Score E Sequences producing significant alignments: (Bits) Value orange1.1g039013mCLAVATA3/ESR-RELATED 6, similar to AT2G31085.1 52.0 1e-10 >orange1.1g039013m CLAVATA3/ESR-RELATED 6, similar to AT2G31085.1 Length=77 Score = 52.0 bits (123), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 6/77 (8%) Query 6 LLLFVMLTFLLVIEMEGRIL----RVNSKTKDGESNDLLKRLGYNVSELKRIGR-ELSVQ 60 L+LF ++ LL + + RIL + N+ + +S LL+ LG+++++LK R ++ Sbjct 2 LMLFFIVFSLLFMSFQARILHDEQQANAMQSNIDSQLLLRELGFDLTKLKHYERLSSTIH 61 Query 61 NEVDRFSPPGGPDPQHH 77 E DR SP GGPDPQHH Sbjct 62 RESDRVSP-GGPDPQHH 77 Lambda K H a alpha 0.317 0.137 0.384 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 239214794 Database: Csinensis_154_v1.1.protein_primaryTranscriptOnly_annot.fasta Posted date: Jul 15, 2015 5:35 PM Number of letters in database: 9,695,389 Number of sequences in database: 25,379 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40