BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g01000.1.1 cAMP-specific

Length=131
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NH11_DROME  unnamed protein product                                 30.8    0.19 
Q9VSE6_DROME  unnamed protein product                                 30.8    0.19 
B9VMQ3_APIME  unnamed protein product                                 26.9    3.7  


>Q9NH11_DROME unnamed protein product
Length=1530

 Score = 30.8 bits (68),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 12/62 (19%)

Query  63    ILRKNL----LLGKMSAATLPELSEILPASGEGDGD-----DLPLPVNPIIRRRSSSKTH  113
             +LRKNL    +LG  + ATLP    I+   G  DG+     D+PLP N ++   S SK  
Sbjct  972   VLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVL---SVSKDE  1028

Query  114   TR  115
              R
Sbjct  1029  NR  1030


>Q9VSE6_DROME unnamed protein product
Length=1579

 Score = 30.8 bits (68),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 12/62 (19%)

Query  63    ILRKNL----LLGKMSAATLPELSEILPASGEGDGD-----DLPLPVNPIIRRRSSSKTH  113
             +LRKNL    +LG  + ATLP    I+   G  DG+     D+PLP N ++   S SK  
Sbjct  1021  VLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVL---SVSKDE  1077

Query  114   TR  115
              R
Sbjct  1078  NR  1079


>B9VMQ3_APIME unnamed protein product
Length=1210

 Score = 26.9 bits (58),  Expect = 3.7, Method: Composition-based stats.
 Identities = 17/63 (27%), Positives = 29/63 (46%), Gaps = 3/63 (5%)

Query  25    PVRNEDQ---EVAPPNYVSSKSFPPSQRTERGKQLFHKSFSILRKNLLLGKMSAATLPEL  81
             P  NE+    E  P   + + +FPP+QR E  K      F     + +L ++ +A+  + 
Sbjct  1121  PTCNEEAAAYEFGPGKGIITYTFPPNQRPEMKKDTVALGFVTSVNDAVLVRIESASSDDY  1180

Query  82    SEI  84
              EI
Sbjct  1181  LEI  1183



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01010.1.1 Phosphodiesterase

Length=186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDE4B_DROME  unnamed protein product                                  102     1e-25
PDE4A_DROME  unnamed protein product                                  102     2e-25
PDE4C_DROME  unnamed protein product                                  98.6    2e-24


>PDE4B_DROME unnamed protein product
Length=1070

 Score = 102 bits (255),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 57/69 (83%), Gaps = 2/69 (3%)

Query  63   LQNFDVENGASPGRSPLDGAASPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI  122
            L  FDVENG    RSPL+G  SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI
Sbjct  383  LFGFDVENGQG-ARSPLEGG-SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI  440

Query  123  VSERIIKAE  131
             SER  + E
Sbjct  441  ASERFKEQE  449


>PDE4A_DROME unnamed protein product
Length=1209

 Score = 102 bits (253),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 56/66 (85%), Gaps = 2/66 (3%)

Query  66   FDVENGASPGRSPLDGAASPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIVSE  125
            FDVENG    RSPL+G  SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI SE
Sbjct  525  FDVENGQG-ARSPLEGG-SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIASE  582

Query  126  RIIKAE  131
            R  + E
Sbjct  583  RFKEQE  588


>PDE4C_DROME unnamed protein product
Length=983

 Score = 98.6 bits (244),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 53/60 (88%), Gaps = 2/60 (3%)

Query  66   FDVENGASPGRSPLDGAASPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIVSE  125
            FDVENG    RSPL+G  SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI SE
Sbjct  312  FDVENGQG-ARSPLEGG-SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIASE  369



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01020.1.1 cAMP-specific

Length=107
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BCL9_DROME  unnamed protein product                                   26.9    1.8  
M9PGJ2_DROME  unnamed protein product                                 26.9    2.1  
Q29R48_DROME  unnamed protein product                                 26.6    2.6  


>BCL9_DROME unnamed protein product
Length=1469

 Score = 26.9 bits (58),  Expect = 1.8, Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 0/43 (0%)

Query  19   PHPFGVLSITSSASVSGMSENVPSVDSPSSGAGKLPRTLSTSV  61
            P+   + S  ++A+V G+  N PS+D   S +G +P+  +++V
Sbjct  788  PNNLSLPSPRTTAAVMGLPTNSPSMDGTGSLSGSVPQANTSTV  830


>M9PGJ2_DROME unnamed protein product
Length=1403

 Score = 26.9 bits (58),  Expect = 2.1, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 25/56 (45%), Gaps = 0/56 (0%)

Query  14  GGKFKPHPFGVLSITSSASVSGMSENVPSVDSPSSGAGKLPRTLSTSVLRIKPRSS  69
           G  F   PFG  S+ +   +S +    P   S S G+G    T   + LR  PR++
Sbjct  41  GVHFMSSPFGNASLIALQDLSNVHGKSPQRRSFSEGSGPRQATPQLAALRCLPRTT  96


>Q29R48_DROME unnamed protein product
Length=786

 Score = 26.6 bits (57),  Expect = 2.6, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 25/56 (45%), Gaps = 0/56 (0%)

Query  14  GGKFKPHPFGVLSITSSASVSGMSENVPSVDSPSSGAGKLPRTLSTSVLRIKPRSS  69
           G  F   PFG  S+ +   +S +    P   S S G+G    T   + LR  PR++
Sbjct  41  GVHFMSSPFGNASLIALQDLSNVHGKSPQRRSFSEGSGPRQATPQLAALRCLPRTT  96



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01030.1.1 Phosphodiesterase

Length=147
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDE4B_DROME  unnamed protein product                                  140     2e-39
PDE4E_DROME  unnamed protein product                                  139     2e-39
PDE4A_DROME  unnamed protein product                                  139     3e-39


>PDE4B_DROME unnamed protein product
Length=1070

 Score = 140 bits (353),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 4/97 (4%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  458  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  517

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLK  99
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLK
Sbjct  518  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLK  554


>PDE4E_DROME unnamed protein product
Length=662

 Score = 139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 4/97 (4%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  50   HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  109

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLK  99
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLK
Sbjct  110  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLK  146


>PDE4A_DROME unnamed protein product
Length=1209

 Score = 139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 4/97 (4%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  597  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  656

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLK  99
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLK
Sbjct  657  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLK  693



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01040.1.1 Phosphodiesterase

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDE4E_DROME  unnamed protein product                                  328     3e-109
PDE4B_DROME  unnamed protein product                                  330     2e-106
PDE4C_DROME  unnamed protein product                                  328     3e-106


>PDE4E_DROME unnamed protein product
Length=662

 Score = 328 bits (840),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 191/243 (79%), Gaps = 8/243 (3%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  50   HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  109

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSKSGNQIS  122
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESS+SGNQIS
Sbjct  110  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQIS  169

Query  123  EYICSTFLDKQQELDLPALRIEDSQ---GSDPRSGGASSKKKDRGGPPGRTVPMSHISGV  179
            EYICSTFLDKQQE DLP+LR+ED+     ++  +G  S+ +  R   P R  PMS ISGV
Sbjct  170  EYICSTFLDKQQEFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSP-RGPPMSQISGV  228

Query  180  KRPLTHTNSFTGEKLPKHGVETASEEELGNTLSEIDSWGIDIFRIAELSNNRPLTAVAYA  239
            KRPL+HTNSFTGE+LP  GVET  E ELG  L E+D+WGI IF I E S NRPLT VAY 
Sbjct  229  KRPLSHTNSFTGERLPTFGVETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYT  288

Query  240  AFQ  242
             FQ
Sbjct  289  IFQ  291


>PDE4B_DROME unnamed protein product
Length=1070

 Score = 330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 191/243 (79%), Gaps = 8/243 (3%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  458  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  517

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSKSGNQIS  122
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESS+SGNQIS
Sbjct  518  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQIS  577

Query  123  EYICSTFLDKQQELDLPALRIEDSQ---GSDPRSGGASSKKKDRGGPPGRTVPMSHISGV  179
            EYICSTFLDKQQE DLP+LR+ED+     ++  +G  S+ +  R   P R  PMS ISGV
Sbjct  578  EYICSTFLDKQQEFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSP-RGPPMSQISGV  636

Query  180  KRPLTHTNSFTGEKLPKHGVETASEEELGNTLSEIDSWGIDIFRIAELSNNRPLTAVAYA  239
            KRPL+HTNSFTGE+LP  GVET  E ELG  L E+D+WGI IF I E S NRPLT VAY 
Sbjct  637  KRPLSHTNSFTGERLPTFGVETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYT  696

Query  240  AFQ  242
             FQ
Sbjct  697  IFQ  699


>PDE4C_DROME unnamed protein product
Length=983

 Score = 328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 191/243 (79%), Gaps = 8/243 (3%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  371  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  430

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSKSGNQIS  122
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESS+SGNQIS
Sbjct  431  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQIS  490

Query  123  EYICSTFLDKQQELDLPALRIEDSQ---GSDPRSGGASSKKKDRGGPPGRTVPMSHISGV  179
            EYICSTFLDKQQE DLP+LR+ED+     ++  +G  S+ +  R   P R  PMS ISGV
Sbjct  491  EYICSTFLDKQQEFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSP-RGPPMSQISGV  549

Query  180  KRPLTHTNSFTGEKLPKHGVETASEEELGNTLSEIDSWGIDIFRIAELSNNRPLTAVAYA  239
            KRPL+HTNSFTGE+LP  GVET  E ELG  L E+D+WGI IF I E S NRPLT VAY 
Sbjct  550  KRPLSHTNSFTGERLPTFGVETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYT  609

Query  240  AFQ  242
             FQ
Sbjct  610  IFQ  612



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01050.1.1 Transcription

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PFG6_DROME  unnamed protein product                                 48.1    2e-06
Q9VUD1_DROME  unnamed protein product                                 47.8    2e-06
DICH_DROME  unnamed protein product                                   43.5    6e-05


>M9PFG6_DROME unnamed protein product
Length=407

 Score = 48.1 bits (113),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)

Query  1    MHMKDHPDYKYRPRRKPKTLRK  22
            +HMK+HPDYKYRPRRKPKTL K
Sbjct  180  LHMKEHPDYKYRPRRKPKTLNK  201


>Q9VUD1_DROME unnamed protein product
Length=388

 Score = 47.8 bits (112),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)

Query  1    MHMKDHPDYKYRPRRKPKTLRK  22
            +HMK+HPDYKYRPRRKPKTL K
Sbjct  180  LHMKEHPDYKYRPRRKPKTLNK  201


>DICH_DROME unnamed protein product
Length=382

 Score = 43.5 bits (101),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)

Query  1    MHMKDHPDYKYRPRRKPK  18
            +HMK+HPDYKYRPRRKPK
Sbjct  201  LHMKEHPDYKYRPRRKPK  218



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01060.1.1 ATPase

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 236     7e-71
Q9Y090_DROME  unnamed protein product                                 236     8e-71
TERA_DROME  unnamed protein product                                   189     2e-54


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 186/326 (57%), Gaps = 40/326 (12%)

Query  20    LFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVWPS  72
             L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+WPS
Sbjct  681   LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMWPS  740

Query  73    MYPDLFSQCPLKPQSGILLV---------------------------QNCFSKFIGESEE  105
              YP +F+  PL+ Q+G+LL                                +K+IG+SEE
Sbjct  741   RYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQSEE  800

Query  106   GVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVYVV  165
              VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV V+
Sbjct  801   NVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVTVI  860

Query  166   GATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTEIAQCTE  225
              ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  T 
Sbjct  861   AATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGKTA  920

Query  226   RFTGADLLGLLCSAQM------LRQKYDEESSEEPEITQADLLKALEDTKPSLSAADSFK  279
              +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D  K
Sbjct  921   NYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDVAK  980

Query  280   FEQIFYNFANNRGLSSDEIQKQKVIS  305
             + + +  F N    S + + K+  ++
Sbjct  981   YHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 73/171 (43%), Gaps = 9/171 (5%)

Query  104  EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLE  160
            ++ +RNIF       P I+  +  D LA   G  S+      +R+ + +   +       
Sbjct  527  QKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNN  586

Query  161  GVYVVGATSRPDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNL  217
             + V+   +    ++  L  P GR        +P+L+  +RE IL  L   + +  D++L
Sbjct  587  AIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDL  646

Query  218  TEIAQCTERFTGADLLGLLCSAQMLRQKYDEESSEEPEITQADLLKALEDT  268
             + +  TE +   DL+  +  A     +    S  +P +T   L+++LE T
Sbjct  647  VKFSNLTEGYRKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 186/326 (57%), Gaps = 40/326 (12%)

Query  20    LFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVWPS  72
             L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+WPS
Sbjct  681   LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMWPS  740

Query  73    MYPDLFSQCPLKPQSGILLV---------------------------QNCFSKFIGESEE  105
              YP +F+  PL+ Q+G+LL                                +K+IG+SEE
Sbjct  741   RYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQSEE  800

Query  106   GVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVYVV  165
              VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV V+
Sbjct  801   NVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVTVI  860

Query  166   GATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTEIAQCTE  225
              ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  T 
Sbjct  861   AATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGKTA  920

Query  226   RFTGADLLGLLCSAQM------LRQKYDEESSEEPEITQADLLKALEDTKPSLSAADSFK  279
              +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D  K
Sbjct  921   NYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDVAK  980

Query  280   FEQIFYNFANNRGLSSDEIQKQKVIS  305
             + + +  F N    S + + K+  ++
Sbjct  981   YHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 73/171 (43%), Gaps = 9/171 (5%)

Query  104  EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLE  160
            ++ +RNIF       P I+  +  D LA   G  S+      +R+ + +   +       
Sbjct  527  QKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNN  586

Query  161  GVYVVGATSRPDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNL  217
             + V+   +    ++  L  P GR        +P+L+  +RE IL  L   + +  D++L
Sbjct  587  AIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDL  646

Query  218  TEIAQCTERFTGADLLGLLCSAQMLRQKYDEESSEEPEITQADLLKALEDT  268
             + +  TE +   DL+  +  A     +    S  +P +T   L+++LE T
Sbjct  647  VKFSNLTEGYRKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>TERA_DROME unnamed protein product
Length=801

 Score = 189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/347 (35%), Positives = 178/347 (51%), Gaps = 52/347 (15%)

Query  1    MTKVDLEDNSSTPDTLKPNLFSTEDLEEAFKSHVPLALKGISSNAVEKINFSNVGGLKSA  60
            M  +DLED+    + L     + E+   A     P AL+  +   V    ++++GGL+S 
Sbjct  424  MDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRE-TVVEVPNTTWTDIGGLESV  482

Query  61   KQLLIETLVWPSMYPDLFSQCPLKPQSGIL---------------LVQNCFSKFI-----  100
            K+ L E + +P  +PD F +  ++P  G+L               +   C + FI     
Sbjct  483  KKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGP  542

Query  101  -------GESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGN---DSTGVKDRVVNQLL  150
                   GESE  VR+IF++ARS  PC+LFFDE DS+A  RG    D+ G  DRV+NQ+L
Sbjct  543  ELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQIL  602

Query  151  TELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLK  210
            TE+DG+   + V+++GAT+RPDIIDPA+LRPGRL   ++  +PD K RE IL    +K  
Sbjct  603  TEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSP  662

Query  211  LNSDVNLTEIAQCTERFTGADLLGLLCSAQML--RQKYDEESSEE---------------  253
            L  +V+LT IA+ T+ F+GADL  +   A  L  RQ  + E   E               
Sbjct  663  LAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDE  722

Query  254  ----PEITQADLLKALEDTKPSLSAADSFKFEQIFYNFANNRGLSSD  296
                PEIT A   +A++  + S+S  D  K+E        +RG   +
Sbjct  723  DDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQN  769


 Score = 122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 113/228 (50%), Gaps = 29/228 (13%)

Query  49   INFSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKPQSGILL--------------VQN  94
            + + ++GG +     + E +  P  +P LF    +KP  GIL+              V N
Sbjct  198  VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVAN  257

Query  95   -------------CFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGV  141
                           SK  GESE  +R  F  A    P I+F DE D++A KR      V
Sbjct  258  ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEV  317

Query  142  KDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDI  201
            + R+V+QLLT +DG++    + V+ AT+RP+ IDPAL R GR    +   +PD   R ++
Sbjct  318  ERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEV  377

Query  202  LSVLTQKLKLNSDVNLTEIAQCTERFTGADLLGLLCSA--QMLRQKYD  247
            L + T+ +KL+ DV+L +IA  +    GADL  L   A  Q +R+K D
Sbjct  378  LRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMD  425



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01070.1.1 protein

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SYFA_DROME  unnamed protein product                                   30.4    1.6  
Q0E8P6_DROME  unnamed protein product                                 30.0    2.3  
M9PI57_DROME  unnamed protein product                                 28.5    6.3  


>SYFA_DROME unnamed protein product
Length=498

 Score = 30.4 bits (67),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  58   KIKIFFYQAFLPQGFPDTVSNDYIEYQLWD  87
            K++  F Q FL  GF +  +N+Y+E   W+
Sbjct  228  KVRTEFRQIFLEMGFSEMPTNNYVESSFWN  257


>Q0E8P6_DROME unnamed protein product
Length=4236

 Score = 30.0 bits (66),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 14/85 (16%)

Query  202   RASIIQHQAAHSGNIGDIAAKDGSQET-CVNLTASLLGLVVLKL-CTENIFLTWLLFIIF  259
             R  +I  QA H G  G+     G+ +T CV    ++LG +VL   C EN+  T  + +I 
Sbjct  1640  RCYLILTQAMHMGLGGNPFGPAGTGKTECVKALGAMLGRLVLVFNCDENVD-TESMSLIL  1698

Query  260   TGLHIYFNYRAVRCLE---FNTFNR  281
             TGL         RC     F+ FNR
Sbjct  1699  TGL--------ARCGAWGCFDEFNR  1715


>M9PI57_DROME unnamed protein product
Length=834

 Score = 28.5 bits (62),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (56%), Gaps = 6/45 (13%)

Query  136  RILFAWWEGTI------LDADCKRWRILADLINDVAMCVELMLPL  174
             +L AWWE         L++D  + RI+A+L+N V   + L++ L
Sbjct  490  EVLPAWWESYAQCPLMNLESDLAKLRIMAELLNFVGAILYLLVAL  534



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01080.1.1 ATPase

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 325     3e-101
Q9Y090_DROME  unnamed protein product                                 325     3e-101
TERA_DROME  unnamed protein product                                   262     4e-79 


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 51.2 bits (121),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>TERA_DROME unnamed protein product
Length=801

 Score = 262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 264/507 (52%), Gaps = 37/507 (7%)

Query  3    SKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVSL  62
            SK+    E  LR     A    P+ + +D+I+ +        D     +  ++ S  ++L
Sbjct  273  SKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAP----KRDKTHGEVERRIVSQLLTL  328

Query  63   VHEFQLNSSIVMVGVTSSRDIIKNTKAGLVFSHCYSLPSLELDNRNLLLETL-IQYKLKR  121
            +   + +S ++++  T+  + I    A   F        + + +    LE L I  K  +
Sbjct  329  MDGMKKSSHLIVMAATNRPNSID--PALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK  386

Query  122  EHYNMNDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLED--NDASTPDTLKTNL  179
             H   +D+D+ +++ +  G+   D+  +  +A    +  K+DL D  +D    + L +  
Sbjct  387  LH---DDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLA  443

Query  180  FSTEDLEEAFKSHVPLALKGISSNAVEKINFSNVGGLKSAKQLLIETLVWPSMYPDLFSQ  239
             + E+   A     P AL+      V    ++++GGL+S K+ L E + +P  +PD F +
Sbjct  444  VTMENFRYAMTKSSPSALRETVVE-VPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLK  502

Query  240  CPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGESEEGVRNIFNR  299
              ++P  G+L YG PG GKTLLA AI+ EC   FIS+KGPEL + + GESE  VR+IF++
Sbjct  503  FGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDK  562

Query  300  ARSIQPCILFFDEFDSLAAKRG---NDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
            ARS  PC+LFFDE DS+A  RG    D+ G  DRV+NQ+LTE+DG+   + V+++GAT+R
Sbjct  563  ARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR  622

Query  357  PDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQCTEMFTGA  416
            PDIIDPA+LRPGRL   ++  +PD K RE IL    +K  L  +V+LT IA+ T+ F+GA
Sbjct  623  PDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGA  682

Query  417  DLLGLLCSAQML--RQEYDEESSEE-------------------PEITQADLLKALEDTK  455
            DL  +   A  L  RQ  + E   E                   PEIT A   +A++  +
Sbjct  683  DLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFAR  742

Query  456  PSLSAADSFKFEQIFYNFANNRGLSSD  482
             S+S  D  K+E        +RG   +
Sbjct  743  RSVSDNDIRKYEMFAQTLQQSRGFGQN  769


 Score = 175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 133/228 (58%), Gaps = 2/228 (1%)

Query  208  INFSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISG  267
            + + ++GG +     + E +  P  +P LF    +KP  GIL+YG PGTGKTL+A A++ 
Sbjct  198  VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVAN  257

Query  268  ECGLKFISIKGPELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGV  327
            E G  F  I GPE+ SK  GESE  +R  F  A    P I+F DE D++A KR      V
Sbjct  258  ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEV  317

Query  328  KDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDI  387
            + R+V+QLLT +DG++    + V+ AT+RP+ IDPAL R GR    +   +PD   R ++
Sbjct  318  ERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEV  377

Query  388  LSVLTQKLKLNSDVNLTKIAQCTEMFTGADLLGLLCSA--QMLRQEYD  433
            L + T+ +KL+ DV+L +IA  +    GADL  L   A  Q +R++ D
Sbjct  378  LRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMD  425



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01080.1.2 ATPase

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 325     3e-101
Q9Y090_DROME  unnamed protein product                                 325     3e-101
TERA_DROME  unnamed protein product                                   262     4e-79 


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 51.2 bits (121),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>TERA_DROME unnamed protein product
Length=801

 Score = 262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 264/507 (52%), Gaps = 37/507 (7%)

Query  3    SKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVSL  62
            SK+    E  LR     A    P+ + +D+I+ +        D     +  ++ S  ++L
Sbjct  273  SKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAP----KRDKTHGEVERRIVSQLLTL  328

Query  63   VHEFQLNSSIVMVGVTSSRDIIKNTKAGLVFSHCYSLPSLELDNRNLLLETL-IQYKLKR  121
            +   + +S ++++  T+  + I    A   F        + + +    LE L I  K  +
Sbjct  329  MDGMKKSSHLIVMAATNRPNSID--PALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK  386

Query  122  EHYNMNDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLED--NDASTPDTLKTNL  179
             H   +D+D+ +++ +  G+   D+  +  +A    +  K+DL D  +D    + L +  
Sbjct  387  LH---DDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLA  443

Query  180  FSTEDLEEAFKSHVPLALKGISSNAVEKINFSNVGGLKSAKQLLIETLVWPSMYPDLFSQ  239
             + E+   A     P AL+      V    ++++GGL+S K+ L E + +P  +PD F +
Sbjct  444  VTMENFRYAMTKSSPSALRETVVE-VPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLK  502

Query  240  CPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGESEEGVRNIFNR  299
              ++P  G+L YG PG GKTLLA AI+ EC   FIS+KGPEL + + GESE  VR+IF++
Sbjct  503  FGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDK  562

Query  300  ARSIQPCILFFDEFDSLAAKRG---NDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
            ARS  PC+LFFDE DS+A  RG    D+ G  DRV+NQ+LTE+DG+   + V+++GAT+R
Sbjct  563  ARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR  622

Query  357  PDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQCTEMFTGA  416
            PDIIDPA+LRPGRL   ++  +PD K RE IL    +K  L  +V+LT IA+ T+ F+GA
Sbjct  623  PDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGA  682

Query  417  DLLGLLCSAQML--RQEYDEESSEE-------------------PEITQADLLKALEDTK  455
            DL  +   A  L  RQ  + E   E                   PEIT A   +A++  +
Sbjct  683  DLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFAR  742

Query  456  PSLSAADSFKFEQIFYNFANNRGLSSD  482
             S+S  D  K+E        +RG   +
Sbjct  743  RSVSDNDIRKYEMFAQTLQQSRGFGQN  769


 Score = 175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 133/228 (58%), Gaps = 2/228 (1%)

Query  208  INFSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISG  267
            + + ++GG +     + E +  P  +P LF    +KP  GIL+YG PGTGKTL+A A++ 
Sbjct  198  VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVAN  257

Query  268  ECGLKFISIKGPELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGV  327
            E G  F  I GPE+ SK  GESE  +R  F  A    P I+F DE D++A KR      V
Sbjct  258  ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEV  317

Query  328  KDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDI  387
            + R+V+QLLT +DG++    + V+ AT+RP+ IDPAL R GR    +   +PD   R ++
Sbjct  318  ERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEV  377

Query  388  LSVLTQKLKLNSDVNLTKIAQCTEMFTGADLLGLLCSA--QMLRQEYD  433
            L + T+ +KL+ DV+L +IA  +    GADL  L   A  Q +R++ D
Sbjct  378  LRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMD  425



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01090.1.1 transcription

Length=142


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01100.1.1 Transcription

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUD1_DROME  unnamed protein product                                 169     3e-49
M9PFG6_DROME  unnamed protein product                                 170     3e-49
DICH_DROME  unnamed protein product                                   165     1e-47


>Q9VUD1_DROME unnamed protein product
Length=388

 Score = 169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%), Gaps = 0/83 (0%)

Query  22   DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLR  81
            DHIKRPMNAFMVWSR QRRK+AQDNPKMHNSEISKRLGAEWKLLTE +KRP+IDEAKRLR
Sbjct  119  DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLR  178

Query  82   AMHMKDHPDYKYRPRRKPKTLRK  104
            A+HMK+HPDYKYRPRRKPKTL K
Sbjct  179  ALHMKEHPDYKYRPRRKPKTLNK  201


>M9PFG6_DROME unnamed protein product
Length=407

 Score = 170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%), Gaps = 0/83 (0%)

Query  22   DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLR  81
            DHIKRPMNAFMVWSR QRRK+AQDNPKMHNSEISKRLGAEWKLLTE +KRP+IDEAKRLR
Sbjct  119  DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLR  178

Query  82   AMHMKDHPDYKYRPRRKPKTLRK  104
            A+HMK+HPDYKYRPRRKPKTL K
Sbjct  179  ALHMKEHPDYKYRPRRKPKTLNK  201


>DICH_DROME unnamed protein product
Length=382

 Score = 165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 78/80 (98%), Gaps = 0/80 (0%)

Query  21   DDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRL  80
            + HIKRPMNAFMVWSRLQRR+IA+DNPKMHNSEISKRLGAEWKLL E+EKRP+IDEAKRL
Sbjct  139  EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRL  198

Query  81   RAMHMKDHPDYKYRPRRKPK  100
            RA+HMK+HPDYKYRPRRKPK
Sbjct  199  RALHMKEHPDYKYRPRRKPK  218



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01110.1.1 protein

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SYFA_DROME  unnamed protein product                                   30.0    1.3  
Q9VUD5_DROME  unnamed protein product                                 28.9    3.8  
M9PI57_DROME  unnamed protein product                                 28.9    3.8  


>SYFA_DROME unnamed protein product
Length=498

 Score = 30.0 bits (66),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  58   KIKIFFYQAFLPQGFPDTVSNDYIEYQLWD  87
            K++  F Q FL  GF +  +N+Y+E   W+
Sbjct  228  KVRTEFRQIFLEMGFSEMPTNNYVESSFWN  257


>Q9VUD5_DROME unnamed protein product
Length=833

 Score = 28.9 bits (63),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (56%), Gaps = 6/45 (13%)

Query  136  RILFAWWEGTI------LDADCKRWRILADLINDVAMCVELMLPL  174
             +L AWWE         L++D  + RI+A+L+N V   + L++ L
Sbjct  490  EVLPAWWESYAQCPLMNLESDLAKLRIMAELLNFVGAILYLLVAL  534


>M9PI57_DROME unnamed protein product
Length=834

 Score = 28.9 bits (63),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (56%), Gaps = 6/45 (13%)

Query  136  RILFAWWEGTI------LDADCKRWRILADLINDVAMCVELMLPL  174
             +L AWWE         L++D  + RI+A+L+N V   + L++ L
Sbjct  490  EVLPAWWESYAQCPLMNLESDLAKLRIMAELLNFVGAILYLLVAL  534



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01120.1.1 Unknown

Length=135
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MMC6_DROME  unnamed protein product                                 28.5    1.1  
Q15K24_DROME  unnamed protein product                                 26.9    3.5  
Q9VUE8_DROME  unnamed protein product                                 26.9    3.5  


>Q8MMC6_DROME unnamed protein product
Length=506

 Score = 28.5 bits (62),  Expect = 1.1, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 25/45 (56%), Gaps = 1/45 (2%)

Query  87   EFKQTYFEEFYNKLIGSQQWDLSYLNHFQIDEWRYHDASVTVEKQ  131
            +FK T+FE+ Y +L GS    +  +N   +D++ Y   S+   +Q
Sbjct  406  DFKSTHFEQIYKEL-GSTDRRIFKINTDDVDDYEYMKVSILGGRQ  449


>Q15K24_DROME unnamed protein product
Length=1842

 Score = 26.9 bits (58),  Expect = 3.5, Method: Composition-based stats.
 Identities = 20/67 (30%), Positives = 31/67 (46%), Gaps = 2/67 (3%)

Query  31   KKSKPSNAVSVLLNINADVKATLKAYCYAVFHDVKKNVSPSLSLFQKEIKYE--NDEDEF  88
            K+ K S  V V + I  +VK   +        DV K +  ++ + Q+EIK E      E 
Sbjct  348  KEVKDSQPVKVDIQIEEEVKTPNQVIGEVKVEDVNKEIKETVQVSQQEIKKEVKVSHQET  407

Query  89   KQTYFEE  95
            K+T+  E
Sbjct  408  KETFKSE  414


>Q9VUE8_DROME unnamed protein product
Length=2637

 Score = 26.9 bits (58),  Expect = 3.5, Method: Composition-based stats.
 Identities = 20/67 (30%), Positives = 31/67 (46%), Gaps = 2/67 (3%)

Query  31    KKSKPSNAVSVLLNINADVKATLKAYCYAVFHDVKKNVSPSLSLFQKEIKYE--NDEDEF  88
             K+ K S  V V + I  +VK   +        DV K +  ++ + Q+EIK E      E 
Sbjct  1143  KEVKDSQPVKVDIQIEEEVKTPNQVIGEVKVEDVNKEIKETVQVSQQEIKKEVKVSHQET  1202

Query  89    KQTYFEE  95
             K+T+  E
Sbjct  1203  KETFKSE  1209



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01130.1.1 ATP

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTEF5_DROME  unnamed protein product                                  176     7e-49
Q8SYP8_DROME  unnamed protein product                                 31.2    1.5  
SMG1_DROME  unnamed protein product                                   31.2    1.6  


>MTEF5_DROME unnamed protein product
Length=560

 Score = 176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 138/501 (28%), Positives = 243/501 (49%), Gaps = 14/501 (3%)

Query  29   NSELIKKMLGYDDTNWNN--EENSFLNKYDRNNILDSYKLLKKFGYSDADIKSELRTLCL  86
            N+  + K LG    +W    E++  L    R ++L SY  LK   YS  DI ++   +  
Sbjct  55   NASYLSKTLGSSYRSWAAALEKHPELKTLKRKDLLSSYDTLKSLDYSVDDIIAKPMIIYY  114

Query  87   KPQTITSRYRMFIDYCFQKDLISPTLLRHFVKTMSLNIYQIKHKGYID---KYKDVLGHV  143
               T+ +R+ +  +  F    ++   L  +V  ++  I  +K   YI    K  + L   
Sbjct  115  GATTLANRHSVLQECGFHN--VTVQTLAKYVTVVNKPIEVLKAHNYIPFDVKVAERLAGY  172

Query  144  NK--KLNISVQSL-SEKMPLKRIHCEFSVHHLMSVLNISHEEAKYKFKRYPNLKSRSFKC  200
             K  KL + ++ L SE + LK +       +L   L +   + +  ++ Y  ++ +SF+ 
Sbjct  173  FKDIKLPVDLRELESETLTLKSLRQSLINAYLRERLQMDDNDLQKLWRVYTRIRHKSFRA  232

Query  201  IQENVHVLTKKVGFTHERIKKNAFLLHADKENLLSLLKKYPKMGSVDMKQIIQAYPILVL  260
            +Q+ + +LTK+  F+ ER++KN+FLL+++ +N+  +L++ P + S D+++I    P +++
Sbjct  233  VQDTIELLTKEFNFSAERLRKNSFLLYSEADNVRRILREVPTIDSQDIREIGFRRPKILM  292

Query  261  SPIRNIESVIQCVQKFGYTLEHLSKAPMILILKPTTVEQRLTQIHTEEWLQPYSGLPRTL  320
            S   +++  +Q V  FG + + + +   +L L P TV +RL  +   E  Q     PR L
Sbjct  293  STCDSLKQTLQHVHAFGISEDAVLRCLEVLTLGPDTVLERLRDLQEIEEFQVLGTNPRIL  352

Query  321  MLVLTLPSLEKRRAVLQDLNMKCISINVLACTKILFNAYVKHGRDKLNSEDAYLYLSNKL  380
             LV        R   L  L ++C S+++L+C    F  + + G D+    D  +YLSN L
Sbjct  353  RLVHYQNKARLRLDYLNQLRVRCASLHILSCGSEAFAKFARDGSDRTKGRDIVVYLSNVL  412

Query  381  NVPFEKITQKLQSHPYKRYVSIQQIHNSLTFLLG-KFSEDNIYNNLQLVLYPVNVIEAAL  439
                + +   L  HP   ++ +  +   L +L   KF  + I+ N+ L+LYP+  IE  +
Sbjct  413  GKDVQVLRNLLSRHPNWCHIPLLHVKQCLEYLRSKKFKLNEIFANIHLLLYPIKRIEEKM  472

Query  440  EKLTSGSDTSLDTTPCHDANGNIKEELILPLTLYVIEKQTNFTGYGIWEEEEDGEVEHNA  499
              L S         P  + +     E IL L LY+IE + +FTG GIW E+    VE+  
Sbjct  473  LLLQSPDAQEDLQLPVANFDSLSNNE-ILTLILYLIESEFHFTGDGIWTEQHTHHVENFN  531

Query  500  NL--DSPVSMLPIRKKKRKPS  518
            NL  D P S+  + K   KP+
Sbjct  532  NLLPDFPESLNKVYKYGVKPA  552


>Q8SYP8_DROME unnamed protein product
Length=591

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 35/79 (44%), Gaps = 14/79 (18%)

Query  460  GNIKEELILPL-------TLYVIEKQTNFTGYG-------IWEEEEDGEVEHNANLDSPV  505
            G  +EEL +PL       T  V E +T+FTGY        +++ E    V    +   P 
Sbjct  464  GKQEEELPIPLAPLLADDTKGVNEDETHFTGYKTARSGSILYDTERRNRVTRRTDNKLPT  523

Query  506  SMLPIRKKKRKPSFRNLRR  524
            + L I+  K KP    LRR
Sbjct  524  NTLDIKSDKAKPHGNVLRR  542


>SMG1_DROME unnamed protein product
Length=3218

 Score = 31.2 bits (69),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 33/69 (48%), Gaps = 7/69 (10%)

Query  272  CVQK-FGYTLEHLSKAPMILILKPTTVEQRLTQIHT---EEWLQPYSGLPRTLMLV---L  324
            C+Q    Y LE L K P +LIL   T  Q+L  + T     + Q Y+ LP  L L     
Sbjct  713  CIQTVLDYGLERLEKYPKLLILYRDTALQQLQMLSTNYHAPYFQIYAQLPLHLTLTGGES  772

Query  325  TLPSLEKRR  333
            ++P +  RR
Sbjct  773  SMPGMASRR  781



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01140.1.1 Transmembrane

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NDN5_DROME  unnamed protein product                                 104     7e-23
A0A0U1QT59_DROME  unnamed protein product                             104     9e-23
DGT6_DROME  unnamed protein product                                   39.3    0.007


>M9NDN5_DROME unnamed protein product
Length=1932

 Score = 104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  101  SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  145
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  129  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  183

Query  146  --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  187
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  184  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  240

Query  188  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  247
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  241  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  279

Query  248  YENSSRWASPEIDLDTAVGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  304
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  280  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  335

Query  305  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  364
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  336  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  395

Query  365  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  422
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  396  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  451

Query  423  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  478
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  452  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  508

Query  479  VFMFSLYSRLNCPRK  493
              MFS   ++N   K
Sbjct  509  SLMFSFIYKINSKEK  523


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  504   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  554
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1130  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1189

Query  555   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  614
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1190  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1249

Query  615   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  673
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1250  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1309

Query  674   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  724
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1310  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1360


>A0A0U1QT59_DROME unnamed protein product
Length=2036

 Score = 104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  101  SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  145
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  233  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  287

Query  146  --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  187
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  288  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  344

Query  188  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  247
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  345  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  383

Query  248  YENSSRWASPEIDLDTAVGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  304
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  384  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  439

Query  305  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  364
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  440  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  499

Query  365  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  422
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  500  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  555

Query  423  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  478
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  556  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  612

Query  479  VFMFSLYSRLNCPRK  493
              MFS   ++N   K
Sbjct  613  SLMFSFIYKINSKEK  627


 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  504   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  554
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1234  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1293

Query  555   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  614
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1294  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1353

Query  615   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  673
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1354  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1413

Query  674   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  724
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1414  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1464


>DGT6_DROME unnamed protein product
Length=654

 Score = 39.3 bits (90),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 35/65 (54%), Gaps = 0/65 (0%)

Query  440  NRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLTVFMFSLYSRLNCPRKYNECAS  499
            NRI G I E++   ++YN  N    T L+ L + L+   V + +L  +LN P K ++ ++
Sbjct  306  NRISGTIAEQLDANDHYNESNAFVTTDLQALRVELSQSEVQLNNLLKKLNEPSKKDKGSA  365

Query  500  AACNT  504
             A  +
Sbjct  366  NASGS  370



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01150.1.1 Cytochrome

Length=319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4E3_DROME  unnamed protein product                                  64.7    1e-11
C4D21_DROME  unnamed protein product                                  57.8    2e-09
CP4G1_DROME  unnamed protein product                                  53.9    4e-08


>CP4E3_DROME unnamed protein product
Length=526

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 131/331 (40%), Gaps = 44/331 (13%)

Query  20   THRKLFLHAWSIPGPLALPLLGNLVNFRTWKTALFKDYLSFYLRYG-GIYRIWAGHNLLV  78
            + R+  L  ++  GP  +P+LGN          +   +  ++  YG   +  W G++  +
Sbjct  24   SQRRQLLKEFN--GPTPVPILGNANRIGKNPAEILSTFFDWWYDYGKDNFLFWIGYSSHI  81

Query  79   VITDPDMAETLFNLKAEVFPKPVFFDFFSVMFGQSIFFQGDYSAWKKHRKVLNRVFQTGP  138
            V+T+P   E + N + ++  K   +D      G  +      S W KHRK++   F    
Sbjct  82   VMTNPKQLEYILNSQ-QLIQKSTIYDLLHPWLGHGLLTSFG-SKWHKHRKMITPSFHFN-  138

Query  139  MTKLIPHLHEKVLDYSERLVTVPCIQRVDEMLYPWQ-------CDVITHTLFGLKFKPTE  191
               ++   HE + + S + +T        + +  +Q        DVI  T  G+     E
Sbjct  139  ---ILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAME  195

Query  192  ---------IDLICY-VNKQFFKLFRESIKSVLTQIKCLERFTAFQSKKTILETVT----  237
                        +CY +N + F  F+ S +           F+A+Q     L+  T    
Sbjct  196  QRDSSIVQAFRDMCYNINMRAFHPFKRSNRV----FSLTPEFSAYQKTLKTLQDFTYDII  251

Query  238  KMGMVNFFVTGHSDHRDSTLDDIKLADLQEELG----------EAHLDELGLFNIAGIET  287
            +  +      G  +  D +L   K+A L   L           +   +E+  F   G +T
Sbjct  252  EKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDT  311

Query  288  LTTAFSAVIFLLSMHPEVQAKVYDELISIIG  318
             T+  S  ++LLS HP+VQ K+Y E   ++G
Sbjct  312  TTSGVSFSVYLLSRHPDVQRKLYREQCEVMG  342


>C4D21_DROME unnamed protein product
Length=511

 Score = 57.8 bits (138),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/324 (22%), Positives = 130/324 (40%), Gaps = 45/324 (14%)

Query  33   GPLALPLLGNLVNFRTWKTALF-KDYLSFYLRYGGIYRIWAGHNLLVVITDPDMAETLFN  91
            GP  +P++GN +   T +   F + +  ++ +YG  +R+W     L+   D    E++ +
Sbjct  35   GPFTIPIVGNGLQALTLRPENFIQRFGDYFNKYGKTFRLWILGECLIYTKDLKYFESILS  94

Query  92   LKAEVFPKPVFFDFFSVMFGQSIFFQGDYSAWKKHRKVLNRVFQTGPMTKLIPHLH----  147
              + +  K   + F     G  +      + W   RKVL   F    +   +  +     
Sbjct  95   -SSTLLKKAHLYRFLRDFLGDGLLLSTG-NKWTSRRKVLAPAFHFKCLENFVEIMDRNSG  152

Query  148  ---EKVLDYSERLVTVPCIQRVD-EMLYPWQCDVITHTLFGLKFKPT-------------  190
               EK+ +Y++    V   + V  E L     DV T T  G++                 
Sbjct  153  IMVEKLKNYADGKTCVDLFKFVSLEAL-----DVTTETAMGVQVNAQNEPNFPYTKALKS  207

Query  191  ----EIDLICYVNKQFFKLFRESI----KSVLTQIKCLERFT--AFQSKKTILETVTKMG  240
                E   +  V+ ++  LF  +     + +   I  ++ FT    + ++ ILE     G
Sbjct  208  VVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIAIMQDFTDKVIRERRAILERARADG  267

Query  241  MVNFFVTGHSD---HRDSTLDDIKLADLQEELGEAHLD---ELGLFNIAGIETLTTAFSA  294
                 + G  D       TL DI L    +    + +D   E+ +F  AG +T T+  S 
Sbjct  268  TYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIREEVDVFIFAGDDTTTSGVSH  327

Query  295  VIFLLSMHPEVQAKVYDELISIIG  318
             +  +S HP+VQ  +Y+EL+S++G
Sbjct  328  ALHAISRHPKVQECIYEELVSVLG  351


>CP4G1_DROME unnamed protein product
Length=556

 Score = 53.9 bits (128),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 75/371 (20%), Positives = 152/371 (41%), Gaps = 59/371 (16%)

Query  1    MILVFLTTVLAVYICKYYWTHRKLFLHAWSIPGPLALPLLGNL-VNFRTWKTALFKDYLS  59
            M+   + T++A+ + +Y+  + + +    +IP P  LP+LG   V        +    L 
Sbjct  27   MLTTLVGTLVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLG  86

Query  60   FYLRYGGIYRIWAGHNLLVVITDPDMAETLFNLKAEVFPKPVFFDFFSVMFGQSIFFQGD  119
            +  +YG   + W G+ LLV +T+P   E + +   +   K   + +F   FG  +     
Sbjct  87   YLNKYGETMKAWLGNVLLVFLTNPSDIELILS-GHQHLTKAEEYRYFKPWFGDGLLISNG  145

Query  120  YSAWKKHRKVLNRVFQTGPMTKLIPHLHEKVLDYSERLVTVPCIQR-----VDEMLYPWQ  174
            +  W+ HRK++   F    +   +P      +D+S+ +V    ++      V + +    
Sbjct  146  HH-WRHHRKMIAPTFHQSILKSFVPTF----VDHSKAVVARMGLEAGKSFDVHDYMSQTT  200

Query  175  CDVITHTLFGLKFKPTE----------IDLICYVNKQFFKL------------FRESIKS  212
             D++  T  G+K  P            +D+   ++K+  KL             RE    
Sbjct  201  VDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDR  260

Query  213  VLTQIKCL------ERFTAFQSK-KTILETVT----------KMGMVNFFVTGH-----S  250
            ++  I  +      +R   FQ + + I+E ++          K G+ +           +
Sbjct  261  MMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGA  320

Query  251  DHRDSTLDD-IKLADLQE-ELGEAH-LDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQA  307
              R + LD  +++A   + E  E   +DE+      G +T +   S  + ++ +H ++QA
Sbjct  321  KRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQA  380

Query  308  KVYDELISIIG  318
            KV+ E  +I G
Sbjct  381  KVFAEQKAIFG  391



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01160.1.1 Dystrophin,

Length=539
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DMDD_DROME  unnamed protein product                                   149     6e-38
DMDB_DROME  unnamed protein product                                   149     7e-38
DMDE_DROME  unnamed protein product                                   148     9e-38


>DMDD_DROME unnamed protein product
Length=1854

 Score = 149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 117/407 (29%), Positives = 181/407 (44%), Gaps = 59/407 (14%)

Query  1     MCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------  54
             +C G L +K RY+F  + D +      +    L D + +P  + E  +F  ++       
Sbjct  1353  LCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRS  1412

Query  55    ------LAQEIFSGNGKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACD  106
                   ++QE   GN  +++    F+  +  EP    L+WLP+LHRL A E+  H   C+
Sbjct  1413  CLEQAGISQEAIDGNQDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCN  1470

Query  107   ACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLR  166
              C     VGFRYRC KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R
Sbjct  1471  ICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----R  1526

Query  167   KSFRCVPEKAKANNI----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSS  221
                R +  K K+       PR    P +  L    +  P+P P H      L N      
Sbjct  1527  DFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----D  1579

Query  222   MDSRSTSTARSPGRYNMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLS  277
             M SR    A    +   G   ++     DDEH+LIA+Y   L    N S  K+P +   +
Sbjct  1580  MHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAA  1639

Query  278   LDTSRAQRE----LVSQLESKNREIMREIARLRRQQE----------------LEGVCAS  317
             +D    QRE    ++  LE +N  +  E  +L  +++                + G+   
Sbjct  1640  MDAE--QREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQ  1697

Query  318   GFEDNPALMSELRALRMRKDELESHLASLQDSRRHLMVQLEGLMRLL  364
             G E    +M+E + LR  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1698  G-EQGQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1743


>DMDB_DROME unnamed protein product
Length=1669

 Score = 149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 117/407 (29%), Positives = 181/407 (44%), Gaps = 59/407 (14%)

Query  1     MCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------  54
             +C G L +K RY+F  + D +      +    L D + +P  + E  +F  ++       
Sbjct  1168  LCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRS  1227

Query  55    ------LAQEIFSGNGKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACD  106
                   ++QE   GN  +++    F+  +  EP    L+WLP+LHRL A E+  H   C+
Sbjct  1228  CLEQAGISQEAIDGNQDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCN  1285

Query  107   ACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLR  166
              C     VGFRYRC KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R
Sbjct  1286  ICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----R  1341

Query  167   KSFRCVPEKAKANNI----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSS  221
                R +  K K+       PR    P +  L    +  P+P P H      L N      
Sbjct  1342  DFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----D  1394

Query  222   MDSRSTSTARSPGRYNMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLS  277
             M SR    A    +   G   ++     DDEH+LIA+Y   L    N S  K+P +   +
Sbjct  1395  MHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAA  1454

Query  278   LDTSRAQRE----LVSQLESKNREIMREIARLRRQQE----------------LEGVCAS  317
             +D    QRE    ++  LE +N  +  E  +L  +++                + G+   
Sbjct  1455  MDAE--QREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQ  1512

Query  318   GFEDNPALMSELRALRMRKDELESHLASLQDSRRHLMVQLEGLMRLL  364
             G E    +M+E + LR  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1513  G-EQGQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1558


>DMDE_DROME unnamed protein product
Length=1051

 Score = 148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 126/436 (29%), Positives = 194/436 (44%), Gaps = 60/436 (14%)

Query  1    MCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------  54
            +C G L +K RY+F  + D +      +    L D + +P  + E  +F  ++       
Sbjct  550  LCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRS  609

Query  55   ------LAQEIFSGNGKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACD  106
                  ++QE   GN  +++    F+  +  EP    L+WLP+LHRL A E+  H   C+
Sbjct  610  CLEQAGISQEAIDGNQDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCN  667

Query  107  ACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLR  166
             C     VGFRYRC KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R
Sbjct  668  ICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----R  723

Query  167  KSFRCVPEKAKANNI----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSS  221
               R +  K K+       PR    P +  L    +  P+P P H      L N      
Sbjct  724  DFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----D  776

Query  222  MDSRSTSTARSPGRYNMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLS  277
            M SR    A    +   G   ++     DDEH+LIA+Y   L    N S  K+P +   +
Sbjct  777  MHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAA  836

Query  278  LDTSRAQRE----LVSQLESKNREIMREIARLRRQQE----------------LEGVCAS  317
            +D    QRE    ++  LE +N  +  E  +L  +++                + G+   
Sbjct  837  MDAE--QREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQ  894

Query  318  GFEDNPALMSELRALRMRKDELESHLASLQDSRRHLMVQLEGLMRLL-KTHQGTSPNSSP  376
            G E    +M+E + LR  K  LE+ +  L+D  R L  QL+ L +LL + + G S  +S 
Sbjct  895  G-EQGQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDEPNGGGSSATSS  953

Query  377  RGPKSPPPASRSAPQT  392
              P +P  A  S P T
Sbjct  954  GLPSAPGSALNSKPNT  969



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01170.1.1 Unknown

Length=95
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PK1R_DROME  unnamed protein product                                   25.4    5.1  
ATR_DROME  unnamed protein product                                    25.0    7.0  
Q9U778_DROME  unnamed protein product                                 25.0    7.8  


>PK1R_DROME unnamed protein product
Length=430

 Score = 25.4 bits (54),  Expect = 5.1, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query  5    FTVITITSACSEHRLGSKQN---NVLKRHLTNKNQMLQKSLEKFEKKFESIKNMP  56
            F  +      S+  L S+ N     L+R LTN +Q  + S+E  E+   SI   P
Sbjct  358  FKAVLFGKKVSKGSLNSRNNIESRRLRRALTNSSQTQRFSIESAEQPKPSIMQNP  412


>ATR_DROME unnamed protein product
Length=2517

 Score = 25.0 bits (53),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query  11    TSACSEHRLGSKQNNVLKRHLTNKNQMLQKSLEKFEKKFES------IKNMPWDYKYR  62
              SA  +H   +  + VLK HL ++    Q+ +EK E+  +       +KN   D++YR
Sbjct  1707  CSAVQQHSYANAYDAVLKLHLVHELHCSQELVEKLEQDRDEDNQEKLMKNYFDDWQYR  1764


>Q9U778_DROME unnamed protein product
Length=486

 Score = 25.0 bits (53),  Expect = 7.8, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 33/60 (55%), Gaps = 4/60 (7%)

Query  32   TNKNQMLQKSLEKFEKKFESI---KNMPWDYKYRRHGNKINWDVSSNMVARRNVQRNEAQ  88
            T + ++L    ++FE+K+  +   +   W     +H N+++W   +  V +R+ +++E+Q
Sbjct  407  TKRWELLLPPDKEFEQKYPELVSRQEYHWTAS-EQHYNEMDWARETKRVRKRSTRKSESQ  465



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01180.1.1 Dystrophin,

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DMDD_DROME  unnamed protein product                                   191     3e-51
DMDB_DROME  unnamed protein product                                   191     3e-51
DMDE_DROME  unnamed protein product                                   191     3e-51


>DMDD_DROME unnamed protein product
Length=1854

 Score = 191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 154/512 (30%), Positives = 230/512 (45%), Gaps = 82/512 (16%)

Query  29    NFDMIRFSSYRTACKLRFVQKKLYLHTIDIWNVIEAFRENGLNA-----IELQSDSHNFI  83
             + + IRFS+YRTA KLR VQK+L L  I +    E+F  +GL A     I++   +    
Sbjct  1248  DLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLH  1307

Query  84    QLYS-----------DLAPN-------IESLGRIRVFSIKVALATMCSGKLMDKLRYIFS  125
              LY            DLA N        +  G+IRV S KV L  +C G L +K RY+F 
Sbjct  1308  SLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFR  1367

Query  126   QLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------------LAQEIFSGN  173
              + D +      +    L D + +P  + E  +F  ++             ++QE   GN
Sbjct  1368  LVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGN  1427

Query  174   GKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCA  231
               +++    F+  +  EP    L+WLP+LHRL A E+  H   C+ C     VGFRYRC 
Sbjct  1428  QDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCL  1485

Query  232   KCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLRKSFRCVPEKAKANNI  291
             KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R   R +  K K+   
Sbjct  1486  KCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----RDFTRALKNKFKSRKY  1541

Query  292   ----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSSMDSRSTSTARSPGRY  346
                 PR    P +  L    +  P+P P H      L N      M SR    A    + 
Sbjct  1542  FKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----DMHSRLEMYASRLAQV  1594

Query  347   NMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLSLDTSRAQRE----LV  398
               G   ++     DDEH+LIA+Y   L    N S  K+P +   ++D    QRE    ++
Sbjct  1595  EYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAE--QREELEAII  1652

Query  399   SQLESKNREIMREIARLRRQQE----------------LEGVCASGFEDNPALMSELRAL  442
               LE +N  +  E  +L  +++                + G+   G E    +M+E + L
Sbjct  1653  RDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQG-EQGQDMMAEAKLL  1711

Query  443   RMRKDELESHLASLQDSRRHLMVQLEGLMRLL  474
             R  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1712  RQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1743


>DMDB_DROME unnamed protein product
Length=1669

 Score = 191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 154/512 (30%), Positives = 230/512 (45%), Gaps = 82/512 (16%)

Query  29    NFDMIRFSSYRTACKLRFVQKKLYLHTIDIWNVIEAFRENGLNA-----IELQSDSHNFI  83
             + + IRFS+YRTA KLR VQK+L L  I +    E+F  +GL A     I++   +    
Sbjct  1063  DLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLH  1122

Query  84    QLYS-----------DLAPN-------IESLGRIRVFSIKVALATMCSGKLMDKLRYIFS  125
              LY            DLA N        +  G+IRV S KV L  +C G L +K RY+F 
Sbjct  1123  SLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFR  1182

Query  126   QLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------------LAQEIFSGN  173
              + D +      +    L D + +P  + E  +F  ++             ++QE   GN
Sbjct  1183  LVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGN  1242

Query  174   GKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCA  231
               +++    F+  +  EP    L+WLP+LHRL A E+  H   C+ C     VGFRYRC 
Sbjct  1243  QDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCL  1300

Query  232   KCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLRKSFRCVPEKAKANNI  291
             KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R   R +  K K+   
Sbjct  1301  KCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----RDFTRALKNKFKSRKY  1356

Query  292   ----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSSMDSRSTSTARSPGRY  346
                 PR    P +  L    +  P+P P H      L N      M SR    A    + 
Sbjct  1357  FKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----DMHSRLEMYASRLAQV  1409

Query  347   NMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLSLDTSRAQRE----LV  398
               G   ++     DDEH+LIA+Y   L    N S  K+P +   ++D    QRE    ++
Sbjct  1410  EYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAE--QREELEAII  1467

Query  399   SQLESKNREIMREIARLRRQQE----------------LEGVCASGFEDNPALMSELRAL  442
               LE +N  +  E  +L  +++                + G+   G E    +M+E + L
Sbjct  1468  RDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQG-EQGQDMMAEAKLL  1526

Query  443   RMRKDELESHLASLQDSRRHLMVQLEGLMRLL  474
             R  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1527  RQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1558


>DMDE_DROME unnamed protein product
Length=1051

 Score = 191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 162/546 (30%), Positives = 239/546 (44%), Gaps = 93/546 (17%)

Query  29   NFDMIRFSSYRTACKLRFVQKKLYLHTIDIWNVIEAFRENGLNA-----IELQSDSHNFI  83
            + + IRFS+YRTA KLR VQK+L L  I +    E+F  +GL A     I++   +    
Sbjct  445  DLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLH  504

Query  84   QLYS-----------DLAPN-------IESLGRIRVFSIKVALATMCSGKLMDKLRYIFS  125
             LY            DLA N        +  G+IRV S KV L  +C G L +K RY+F 
Sbjct  505  SLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFR  564

Query  126  QLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------------LAQEIFSGN  173
             + D +      +    L D + +P  + E  +F  ++             ++QE   GN
Sbjct  565  LVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGN  624

Query  174  GKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCA  231
              +++    F+  +  EP    L+WLP+LHRL A E+  H   C+ C     VGFRYRC 
Sbjct  625  QDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCL  682

Query  232  KCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLRKSFRCVPEKAKANNI  291
            KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R   R +  K K+   
Sbjct  683  KCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----RDFTRALKNKFKSRKY  738

Query  292  ----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSSMDSRSTSTARSPGRY  346
                PR    P +  L    +  P+P P H      L N      M SR    A    + 
Sbjct  739  FKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----DMHSRLEMYASRLAQV  791

Query  347  NMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLSLDTSRAQRE----LV  398
              G   ++     DDEH+LIA+Y   L    N S  K+P +   ++D    QRE    ++
Sbjct  792  EYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAE--QREELEAII  849

Query  399  SQLESKNREIMREIARLRRQQE----------------LEGVCASGFEDNPALMSELRAL  442
              LE +N  +  E  +L  +++                + G+   G E    +M+E + L
Sbjct  850  RDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQG-EQGQDMMAEAKLL  908

Query  443  RMRKDELESHLASLQDSRRHLMVQLEGLMRLLKTHQGTSPNSSPRG------PKSPPPAS  496
            R  K  LE+ +  L+D  R L  QL+ L +LL       PN           P +P  A 
Sbjct  909  RQHKGRLEARMQILEDHNRQLEAQLQRLRQLLD-----EPNGGGSSATSSGLPSAPGSAL  963

Query  497  RSAPQT  502
             S P T
Sbjct  964  NSKPNT  969



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01190.1.1 RNA-directed

Length=268
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RTXE_DROME  unnamed protein product                                   76.3    1e-15
RTBS_DROME  unnamed protein product                                   68.2    5e-13
CONN_DROME  unnamed protein product                                   27.7    6.5  


>RTXE_DROME unnamed protein product
Length=908

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 101/220 (46%), Gaps = 3/220 (1%)

Query  29   LQAIQSEADTYNIPSEVSFTFEEVTEEKVGSAIL-GIKSLARGYDGIDIRMLKLSLPHIL  87
            LQ ++   D  N   ++          +V   I+    + A G+D I    LK      +
Sbjct  413  LQQVEETQDQLNQALQMDMPITPFEPCEVAEVIVRQSNNKAPGHDVICNATLKALPRQAI  472

Query  88   PAVTHVFNESLTSGVFPSSWCSAEVVPLNKVVSPA-SCGDYRPVAILPVLSKALERIATL  146
              +T VFN  +    FP  W    +  ++K   P      YRP+++LP +SK  ER+  +
Sbjct  473  LYITLVFNAIVRLQYFPYQWKLGIISMIHKPGKPEREPASYRPISLLPSISKVFERLIAV  532

Query  147  QMLQYIEYFNIMDPYQSGFRKQHSTATALVKVTDDIRLALDTRKVTVLVLLDMSKAFDSV  206
            +++  +E   I   +Q GFR  H T   L +V + I  A D+++    + LD+ +AFD V
Sbjct  533  RIVSIMEAQGITPEHQFGFRAGHCTVEQLHRVVEQILTAYDSKEYCNSLFLDIREAFDRV  592

Query  207  DFDVLLAMLGRMRFSSSALSWIESYLRGRRQRVKQHGQVA  246
             + + L +  +    +     ++SYL GRR  V+ H  ++
Sbjct  593  -WHIGLQLKIKQTLPAPYFGLLKSYLEGRRFAVRFHSAIS  631


>RTBS_DROME unnamed protein product
Length=906

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 108/226 (48%), Gaps = 7/226 (3%)

Query  33   QSEADTYNIPSEVSFTFEEVTEEKVGSAI--LGIKSLARGYDGIDIRMLKLSLPHILPAV  90
            Q   D+   P ++S   + +  E++  AI  L +K  + G D +    LK      +  +
Sbjct  418  QETLDSLETPLQMSLPIKPIRVEEIVEAIKSLPLKK-SPGIDNVCNATLKALPVRAILYL  476

Query  91   THVFNESLTSGVFPSSWCSAEVVPLNKVVSPASCGD-YRPVAILPVLSKALERIATLQML  149
              ++N  L    FP  W  A ++ ++K   P    + YRP+++L  LSK  ER+   ++ 
Sbjct  477  ALIYNAILRVQFFPKQWKMAAILMIHKPGKPEESPESYRPISLLSSLSKLWERLIANRLN  536

Query  150  QYIEYFNIMDPYQSGFRKQHSTATALVKVTDDIRLALDTRKVTVLVLLDMSKAFDSVDFD  209
              +    I+  +Q GFR+ HST   + ++T  I  A D ++    V +DM +AFD V  D
Sbjct  537  DIMTERRILPDHQFGFRQGHSTVEQVHRLTKHILQAFDDKEYCNAVFIDMQQAFDRVWHD  596

Query  210  VLLAMLGRMRFSSSALSWIESYLRGRR--QRVKQHGQVARATIGGL  253
             L++ + ++ F +     ++SYL  RR   RV+    + R    G+
Sbjct  597  GLISKVKKL-FPAPYYGVLKSYLEDRRFMVRVRNSYSIPRVMRAGV  641


>CONN_DROME unnamed protein product
Length=682

 Score = 27.7 bits (60),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  213  AMLGRMRFSSSALSWIESYLRGRRQRVKQ  241
            A+ G+ +F+SSA + +ES +R RR+R ++
Sbjct  505  ALRGQRQFASSAENVVESKMRRRRKRQEE  533



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01200.1.1 Plant

Length=239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LAP4_DROME  unnamed protein product                                   86.3    2e-19
FLII_DROME  unnamed protein product                                   79.0    8e-17
SUR8_DROME  unnamed protein product                                   70.1    5e-14


>LAP4_DROME unnamed protein product
Length=1851

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 102/205 (50%), Gaps = 4/205 (2%)

Query  10   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  69
            F   K   V+ L+       P +   L   L +L++ +N +   P  ++    LK L   
Sbjct  125  FSQLKNLTVLGLNDMSLTTLPADFGSLTQ-LESLELRENLLKHLPETISQLTKLKRLDLG  183

Query  70   QNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNL  129
             N+IE LP  +G L  L  +  + N ++ LP     L  L +L +S+N+L + P  +  L
Sbjct  184  DNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGL  243

Query  130  QHLDVLDLSFNRIESIPDGIGKM-KVIEMNLNKNQICHISPDISECVRLKILRLEENCLA  188
              L  LDL+ N +E++PDGI K+ ++  + L++N++  ++  +  C  ++ L L EN L+
Sbjct  244  VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLS  303

Query  189  INAIPTCILTSSNVCTLNVEGNLFE  213
               +P  I   + +  LNV+ N  E
Sbjct  304  --ELPASIGQMTKLNNLNVDRNALE  326


 Score = 75.1 bits (183),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 57/198 (29%), Positives = 91/198 (46%), Gaps = 26/198 (13%)

Query  40   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  99
            LR L +S N+I + P D+ +++ L  L   +N I  +P DI  L+ L+    + N I +L
Sbjct  62   LRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKL  121

Query  100  PLSFSKLHN-----------------------LKHLSLSQNQLNKFPTVLFNLQHLDVLD  136
            P  FS+L N                       L+ L L +N L   P  +  L  L  LD
Sbjct  122  PSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLD  181

Query  137  LSFNRIESIPDGIGKMKVI-EMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTC  195
            L  N IE +P  +G +  + E+ L+ NQ+  + P++    +L  L + EN L    +P  
Sbjct  182  LGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRL--EELPNE  239

Query  196  ILTSSNVCTLNVEGNLFE  213
            I    ++  L++  NL E
Sbjct  240  ISGLVSLTDLDLAQNLLE  257


 Score = 70.5 bits (171),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 84/172 (49%), Gaps = 24/172 (14%)

Query  15   KTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIE  74
            K   +++S    +E P+E++ L + L  LD++QN +   P  +A    L  L  DQN+++
Sbjct  222  KLTYLDVSENRLEELPNEISGLVS-LTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQ  280

Query  75   -----------------------SLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKH  111
                                    LP  IG + KL N++ + N ++ LPL   +  NL  
Sbjct  281  RLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGV  340

Query  112  LSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQ  163
            LSL  N+L K P  L N   L VLD+S N++  +P  +  +++  + L++NQ
Sbjct  341  LSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQ  392


 Score = 67.8 bits (164),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 79/173 (46%), Gaps = 1/173 (1%)

Query  14   KKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKI  73
            ++   ++  H    + P+E+      L  L +  N I   P +      L+ L    N+I
Sbjct  13   RQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEI  72

Query  74   ESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLD  133
              LP DI   E L  +  + N I ++P     L +L+    S N + K P+    L++L 
Sbjct  73   GRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLT  132

Query  134  VLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  185
            VL L+   + ++P   G +  +E + L +N + H+   IS+  +LK L L +N
Sbjct  133  VLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDN  185


>FLII_DROME unnamed protein product
Length=1256

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 103/186 (55%), Gaps = 7/186 (4%)

Query  40   LRTLDISQNKISK-FPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKE  98
            +R +D ++N  S  FP  +     ++ LT D+ ++  +P+++G L+KLE++S N N +++
Sbjct  7    VRGVDFTKNDFSATFPSSMRQMSRVQWLTLDRTQLAEIPEELGHLQKLEHLSLNHNRLEK  66

Query  99   LPLSFSKLHNLKHLSLSQNQL--NKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMK-VI  155
            +    ++L  L+ L L  NQL  +  P  LF+L+ L  LDLS N+++ +P+G+ + K +I
Sbjct  67   IFGELTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKEVPEGLERAKNLI  126

Query  156  EMNLNKNQICHI-SPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEM  214
             +NL+ NQI  I +P       L  L L  N L    +P       N+ TL++  N  E+
Sbjct  127  VLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRL--ETLPPQTRRLINLKTLDLSHNPLEL  184

Query  215  KAFQQL  220
               +QL
Sbjct  185  FQLRQL  190


 Score = 67.0 bits (162),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 4/209 (2%)

Query  10   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  69
             E AK   V+NLS+   +  P  +      L  LD+S N++   P        LK+L   
Sbjct  119  LERAKNLIVLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRLETLPPQTRRLINLKTLDLS  178

Query  70   QNKIESLP-KDIGTLEKLE--NVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVL  126
             N +E    + + +L+ LE   +SG    +   P S   L NL  L LS N L K P  +
Sbjct  179  HNPLELFQLRQLPSLQSLEVLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCV  238

Query  127  FNLQHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  185
            +N+  L  L+LS N +  +  G+   + +E +NL++NQ+  +   + +  +L+ L + +N
Sbjct  239  YNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDN  298

Query  186  CLAINAIPTCILTSSNVCTLNVEGNLFEM  214
             L    IP+ I     +   +   NL EM
Sbjct  299  KLNFEGIPSGIGKLGALEVFSAANNLLEM  327


 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 67/146 (46%), Gaps = 24/146 (16%)

Query  19   INLSHQGFKEFPD----------------EMNELKA------VLRTLDISQNKISKFPLD  56
            ++LSH    + PD                E+ EL A       L +L++S+N++   P  
Sbjct  224  LDLSHNSLPKLPDCVYNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAA  283

Query  57   LASYQLLKSLTFDQNKI--ESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSL  114
            L     L+ L  + NK+  E +P  IG L  LE  S   NL++ +P    +   LK L+L
Sbjct  284  LCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALEVFSAANNLLEMVPEGLCRCGALKQLNL  343

Query  115  SQNQLNKFPTVLFNLQHLDVLDLSFN  140
            S N+L   P  +  L+ LD LDL  N
Sbjct  344  SCNRLITLPDAIHLLEGLDQLDLRNN  369


 Score = 48.9 bits (115),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 77/145 (53%), Gaps = 5/145 (3%)

Query  29   FPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLEN  88
            FP  ++ L A L  LD+S N + K P  + +   L  L    N++  L   +   ++LE+
Sbjct  211  FPTSIDSL-ANLCELDLSHNSLPKLPDCVYNVVTLVRLNLSDNELTELTAGVELWQRLES  269

Query  89   VSGNCNLIKELPLSFSKLHNLKHLSLSQNQLN--KFPTVLFNLQHLDVLDLSFNRIESIP  146
            ++ + N +  LP +  KL  L+ L ++ N+LN    P+ +  L  L+V   + N +E +P
Sbjct  270  LNLSRNQLVALPAALCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALEVFSAANNLLEMVP  329

Query  147  DGIGKMKVI-EMNLNKNQICHISPD  170
            +G+ +   + ++NL+ N++  + PD
Sbjct  330  EGLCRCGALKQLNLSCNRLITL-PD  353


>SUR8_DROME unnamed protein product
Length=641

 Score = 70.1 bits (170),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 120/241 (50%), Gaps = 8/241 (3%)

Query  4    SATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPL-DLASYQL  62
            S+     +  K     N+   G  + PD M    + L T+ +S+N+ + +P    A +  
Sbjct  357  SSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTN  416

Query  63   LKSLTFDQNKIESLPKDIGTLEK-LENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNK  121
            + S+  + N+I+ +P  I +  K L  ++   N++  LPL      N+  L+L+ N L K
Sbjct  417  VYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQK  476

Query  122  FPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKIL  180
             P  + NLQ+L++L LS N ++ IP+ IG ++ +  ++L +N+I  +  +I     L+ L
Sbjct  477  LPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRL  536

Query  181  RLEENCLAINAIPTCILTSSNVCTLNV-EGNL-FEMKAFQQLDGYNN-YMDRYTSVKKKM  237
             L+ N   I  +P  I    N+  L+V E NL F  +    L+   N Y+++   ++K  
Sbjct  537  ILQTN--QITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLP  594

Query  238  F  238
            F
Sbjct  595  F  595


 Score = 70.1 bits (170),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 79/172 (46%), Gaps = 24/172 (14%)

Query  40   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  99
            ++ LD+S++ I+  P  +     L  L    NKI  LP +IG L  L N++ N N +  L
Sbjct  162  IKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSL  221

Query  100  PLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPD------------  147
            P S      LK L L  N+L + P V++ L+ L  L L FNRI ++ D            
Sbjct  222  PESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLS  281

Query  148  -----------GIGKM-KVIEMNLNKNQICHISPDISECVRLKILRLEENCL  187
                        IG +  +  ++++ N + H+  DI  CV L  L L+ N L
Sbjct  282  LRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNEL  333


 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 85/175 (49%), Gaps = 4/175 (2%)

Query  40   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  99
            L+ LD+  NK+++ P  +   + L +L    N+I ++  D+  L  L  +S   N I+EL
Sbjct  231  LKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIREL  290

Query  100  PLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMK-VIEMN  158
              +   L NL  L +S N L   P  + N  +L  LDL  N +  IPD IG +K ++ + 
Sbjct  291  GSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLG  350

Query  159  LNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTS-SNVCTLNVEGNLF  212
            +  N++  +   +  C  +    +E N   I  +P  +L S S + T+ +  N F
Sbjct  351  MRYNRLSSVPATLKNCKSMDEFNVEGN--GITQLPDGMLASLSGLTTITLSRNQF  403


 Score = 60.5 bits (145),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 88/177 (50%), Gaps = 3/177 (2%)

Query  10   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  69
            F  AK    +N+        P ++     ++  L+++ N + K P D+ + Q L+ L   
Sbjct  435  FSRAKGLTKLNMKENMLTALPLDIGTWVNMVE-LNLATNALQKLPDDIMNLQNLEILILS  493

Query  70   QNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNL  129
             N ++ +P  IG L KL  +    N I+ LP     LH L+ L L  NQ+   P  + +L
Sbjct  494  NNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHL  553

Query  130  QHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISP-DISECVRLKILRLEE  184
             +L  L +S N ++ +P+ IG ++ +E + +N+N      P +++ C  LK L +++
Sbjct  554  GNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDK  610


 Score = 47.8 bits (112),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 60/111 (54%), Gaps = 2/111 (2%)

Query  14   KKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKI  73
            +K  +++L     +  P E+  L  + R L +  N+I+  P  +     L  L+  +N +
Sbjct  508  RKLRILDLEENRIEVLPHEIGLLHELQR-LILQTNQITMLPRSIGHLGNLTHLSVSENNL  566

Query  74   ESLPKDIGTLEKLENVSGNCNL-IKELPLSFSKLHNLKHLSLSQNQLNKFP  123
            + LP++IG+LE LEN+  N N  +++LP   +   NLK+L++ +  L+  P
Sbjct  567  QFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIP  617


 Score = 31.6 bits (70),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (54%), Gaps = 7/67 (10%)

Query  20   NLSHQGFKE-----FPDEMNELKAVLRTLDISQNK-ISKFPLDLASYQLLKSLTFDQNKI  73
            NL+H    E      P+E+  L++ L  L I+QN  + K P +LA  Q LK L  D+  +
Sbjct  555  NLTHLSVSENNLQFLPEEIGSLES-LENLYINQNPGLEKLPFELALCQNLKYLNIDKCPL  613

Query  74   ESLPKDI  80
             ++P +I
Sbjct  614  STIPPEI  620



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01210.1.1 MAD2L1-binding

Length=315


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01220.1.1 Plant

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LAP4_DROME  unnamed protein product                                   87.0    2e-19
FLII_DROME  unnamed protein product                                   78.2    1e-16
SUR8_DROME  unnamed protein product                                   69.7    9e-14


>LAP4_DROME unnamed protein product
Length=1851

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 102/205 (50%), Gaps = 4/205 (2%)

Query  19   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  78
            F   K   V+ L+       P +   L   L +L++ +N +   P  ++    LK L   
Sbjct  125  FSQLKNLTVLGLNDMSLTTLPADFGSLTQ-LESLELRENLLKHLPETISQLTKLKRLDLG  183

Query  79   QNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNL  138
             N+IE LP  +G L  L  +  + N ++ LP     L  L +L +S+N+L + P  +  L
Sbjct  184  DNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGL  243

Query  139  QHLDVLDLSFNRIESIPDGIGKM-KVIEMNLNKNQICHISPDISECVRLKILRLEENCLA  197
              L  LDL+ N +E++PDGI K+ ++  + L++N++  ++  +  C  ++ L L EN L+
Sbjct  244  VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLS  303

Query  198  INAIPTCILTSSNVCTLNVEGNLFE  222
               +P  I   + +  LNV+ N  E
Sbjct  304  --ELPASIGQMTKLNNLNVDRNALE  326


 Score = 75.9 bits (185),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 57/198 (29%), Positives = 91/198 (46%), Gaps = 26/198 (13%)

Query  49   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  108
            LR L +S N+I + P D+ +++ L  L   +N I  +P DI  L+ L+    + N I +L
Sbjct  62   LRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKL  121

Query  109  PLSFSKLHN-----------------------LKHLSLSQNQLNKFPTVLFNLQHLDVLD  145
            P  FS+L N                       L+ L L +N L   P  +  L  L  LD
Sbjct  122  PSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLD  181

Query  146  LSFNRIESIPDGIGKMKVI-EMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTC  204
            L  N IE +P  +G +  + E+ L+ NQ+  + P++    +L  L + EN L    +P  
Sbjct  182  LGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRL--EELPNE  239

Query  205  ILTSSNVCTLNVEGNLFE  222
            I    ++  L++  NL E
Sbjct  240  ISGLVSLTDLDLAQNLLE  257


 Score = 71.2 bits (173),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 84/172 (49%), Gaps = 24/172 (14%)

Query  24   KTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIE  83
            K   +++S    +E P+E++ L + L  LD++QN +   P  +A    L  L  DQN+++
Sbjct  222  KLTYLDVSENRLEELPNEISGLVS-LTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQ  280

Query  84   -----------------------SLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKH  120
                                    LP  IG + KL N++ + N ++ LPL   +  NL  
Sbjct  281  RLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGV  340

Query  121  LSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQ  172
            LSL  N+L K P  L N   L VLD+S N++  +P  +  +++  + L++NQ
Sbjct  341  LSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQ  392


 Score = 68.6 bits (166),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 79/173 (46%), Gaps = 1/173 (1%)

Query  23   KKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKI  82
            ++   ++  H    + P+E+      L  L +  N I   P +      L+ L    N+I
Sbjct  13   RQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEI  72

Query  83   ESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLD  142
              LP DI   E L  +  + N I ++P     L +L+    S N + K P+    L++L 
Sbjct  73   GRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLT  132

Query  143  VLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  194
            VL L+   + ++P   G +  +E + L +N + H+   IS+  +LK L L +N
Sbjct  133  VLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDN  185


>FLII_DROME unnamed protein product
Length=1256

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 103/186 (55%), Gaps = 7/186 (4%)

Query  49   LRTLDISQNKISK-FPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKE  107
            +R +D ++N  S  FP  +     ++ LT D+ ++  +P+++G L+KLE++S N N +++
Sbjct  7    VRGVDFTKNDFSATFPSSMRQMSRVQWLTLDRTQLAEIPEELGHLQKLEHLSLNHNRLEK  66

Query  108  LPLSFSKLHNLKHLSLSQNQL--NKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMK-VI  164
            +    ++L  L+ L L  NQL  +  P  LF+L+ L  LDLS N+++ +P+G+ + K +I
Sbjct  67   IFGELTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKEVPEGLERAKNLI  126

Query  165  EMNLNKNQICHI-SPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEM  223
             +NL+ NQI  I +P       L  L L  N L    +P       N+ TL++  N  E+
Sbjct  127  VLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRL--ETLPPQTRRLINLKTLDLSHNPLEL  184

Query  224  KAFQQL  229
               +QL
Sbjct  185  FQLRQL  190


 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 4/209 (2%)

Query  19   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  78
             E AK   V+NLS+   +  P  +      L  LD+S N++   P        LK+L   
Sbjct  119  LERAKNLIVLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRLETLPPQTRRLINLKTLDLS  178

Query  79   QNKIESLP-KDIGTLEKLE--NVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVL  135
             N +E    + + +L+ LE   +SG    +   P S   L NL  L LS N L K P  +
Sbjct  179  HNPLELFQLRQLPSLQSLEVLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCV  238

Query  136  FNLQHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  194
            +N+  L  L+LS N +  +  G+   + +E +NL++NQ+  +   + +  +L+ L + +N
Sbjct  239  YNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDN  298

Query  195  CLAINAIPTCILTSSNVCTLNVEGNLFEM  223
             L    IP+ I     +   +   NL EM
Sbjct  299  KLNFEGIPSGIGKLGALEVFSAANNLLEM  327


 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 94/187 (50%), Gaps = 9/187 (5%)

Query  7    VLKM-GNSATKRHFETAKKTGV----INLSHQGFKEFPDEMNELKAVLRTLDISQNKISK  61
            VLKM G   T  +F T+  +      ++LSH    + PD +  +  ++R L++S N++++
Sbjct  198  VLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCVYNVVTLVR-LNLSDNELTE  256

Query  62   FPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLI--KELPLSFSKLHNLK  119
                +  +Q L+SL   +N++ +LP  +  L KL  +  N N +  + +P    KL  L+
Sbjct  257  LTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALE  316

Query  120  HLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVI-EMNLNKNQICHISP  178
              S + N L   P  L     L  L+LS NR+ ++PD I  ++ + +++L  N    + P
Sbjct  317  VFSAANNLLEMVPEGLCRCGALKQLNLSCNRLITLPDAIHLLEGLDQLDLRNNPELVMPP  376

Query  179  DISECVR  185
              SE  +
Sbjct  377  KPSEASK  383


>SUR8_DROME unnamed protein product
Length=641

 Score = 69.7 bits (169),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 79/172 (46%), Gaps = 24/172 (14%)

Query  49   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  108
            ++ LD+S++ I+  P  +     L  L    NKI  LP +IG L  L N++ N N +  L
Sbjct  162  IKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSL  221

Query  109  PLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPD------------  156
            P S      LK L L  N+L + P V++ L+ L  L L FNRI ++ D            
Sbjct  222  PESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLS  281

Query  157  -----------GIGKM-KVIEMNLNKNQICHISPDISECVRLKILRLEENCL  196
                        IG +  +  ++++ N + H+  DI  CV L  L L+ N L
Sbjct  282  LRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNEL  333


 Score = 69.3 bits (168),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 122/243 (50%), Gaps = 12/243 (5%)

Query  13   SATKRHFETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPL-DLASYQL  71
            S+     +  K     N+   G  + PD M    + L T+ +S+N+ + +P    A +  
Sbjct  357  SSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTN  416

Query  72   LKSLTFDQNKIESLPKDIGTLEK-LENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNK  130
            + S+  + N+I+ +P  I +  K L  ++   N++  LPL      N+  L+L+ N L K
Sbjct  417  VYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQK  476

Query  131  FPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKIL  189
             P  + NLQ+L++L LS N ++ IP+ IG ++ +  ++L +N+I  +  +I     L+ L
Sbjct  477  LPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRL  536

Query  190  RLEENCLAINAIPTCILTSSNVCTLNV-EGNL----FEMKAFQQLDGYNNYMDRYTSVKK  244
             L+ N   I  +P  I    N+  L+V E NL     E+ + + L+  N Y+++   ++K
Sbjct  537  ILQTN--QITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLE--NLYINQNPGLEK  592

Query  245  KMF  247
              F
Sbjct  593  LPF  595


 Score = 65.9 bits (159),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 85/175 (49%), Gaps = 4/175 (2%)

Query  49   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  108
            L+ LD+  NK+++ P  +   + L +L    N+I ++  D+  L  L  +S   N I+EL
Sbjct  231  LKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIREL  290

Query  109  PLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMK-VIEMN  167
              +   L NL  L +S N L   P  + N  +L  LDL  N +  IPD IG +K ++ + 
Sbjct  291  GSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLG  350

Query  168  LNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTS-SNVCTLNVEGNLF  221
            +  N++  +   +  C  +    +E N   I  +P  +L S S + T+ +  N F
Sbjct  351  MRYNRLSSVPATLKNCKSMDEFNVEGN--GITQLPDGMLASLSGLTTITLSRNQF  403


 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 88/177 (50%), Gaps = 3/177 (2%)

Query  19   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  78
            F  AK    +N+        P ++     ++  L+++ N + K P D+ + Q L+ L   
Sbjct  435  FSRAKGLTKLNMKENMLTALPLDIGTWVNMVE-LNLATNALQKLPDDIMNLQNLEILILS  493

Query  79   QNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNL  138
             N ++ +P  IG L KL  +    N I+ LP     LH L+ L L  NQ+   P  + +L
Sbjct  494  NNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHL  553

Query  139  QHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISP-DISECVRLKILRLEE  193
             +L  L +S N ++ +P+ IG ++ +E + +N+N      P +++ C  LK L +++
Sbjct  554  GNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDK  610


 Score = 47.0 bits (110),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 60/111 (54%), Gaps = 2/111 (2%)

Query  23   KKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKI  82
            +K  +++L     +  P E+  L  + R L +  N+I+  P  +     L  L+  +N +
Sbjct  508  RKLRILDLEENRIEVLPHEIGLLHELQR-LILQTNQITMLPRSIGHLGNLTHLSVSENNL  566

Query  83   ESLPKDIGTLEKLENVSGNCNL-IKELPLSFSKLHNLKHLSLSQNQLNKFP  132
            + LP++IG+LE LEN+  N N  +++LP   +   NLK+L++ +  L+  P
Sbjct  567  QFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIP  617


 Score = 31.6 bits (70),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (54%), Gaps = 7/67 (10%)

Query  29   NLSHQGFKE-----FPDEMNELKAVLRTLDISQNK-ISKFPLDLASYQLLKSLTFDQNKI  82
            NL+H    E      P+E+  L++ L  L I+QN  + K P +LA  Q LK L  D+  +
Sbjct  555  NLTHLSVSENNLQFLPEEIGSLES-LENLYINQNPGLEKLPFELALCQNLKYLNIDKCPL  613

Query  83   ESLPKDI  89
             ++P +I
Sbjct  614  STIPPEI  620



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01230.1.1 Unknown

Length=164


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01240.1.1 MAD2L1-binding

Length=315


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01250.1.1 Unknown

Length=89
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFA2_DROME  unnamed protein product                                 27.7    0.67 
M9PFL9_DROME  unnamed protein product                                 24.6    9.7  
M9PD87_DROME  unnamed protein product                                 24.6    9.7  


>Q9VFA2_DROME unnamed protein product
Length=366

 Score = 27.7 bits (60),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 24/49 (49%), Gaps = 3/49 (6%)

Query  16   MALSEPILDYPAHHSTGGASINERRGSRTGGSMFLAPYCQLAPRRRHSW  64
            + L   I+D PA  S+    I +   +  GG++F    C++ PR +  W
Sbjct  286  IGLGMLIVDVPAAWSSKTLPIVQ---ALAGGTLFYVTVCEVIPREKARW  331


>M9PFL9_DROME unnamed protein product
Length=2132

 Score = 24.6 bits (52),  Expect = 9.7, Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 14/29 (48%), Gaps = 0/29 (0%)

Query  52    PYCQLAPRRRHSWIGGTSTSVTIFYSSIS  80
             P C  +P RR   +    TS+T   S +S
Sbjct  1056  PGCPTSPSRREQEVATLKTSITELQSQVS  1084


>M9PD87_DROME unnamed protein product
Length=2134

 Score = 24.6 bits (52),  Expect = 9.7, Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 14/29 (48%), Gaps = 0/29 (0%)

Query  52    PYCQLAPRRRHSWIGGTSTSVTIFYSSIS  80
             P C  +P RR   +    TS+T   S +S
Sbjct  1056  PGCPTSPSRREQEVATLKTSITELQSQVS  1084



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01260.1.1 Unknown

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFA2_DROME  unnamed protein product                                 26.9    1.8  


>Q9VFA2_DROME unnamed protein product
Length=366

 Score = 26.9 bits (58),  Expect = 1.8, Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 3/43 (7%)

Query  35   ILDYPAHHSTGGASINERRGSRTGGSMFLAPYCQLAPRRRHSW  77
            I+D PA  S+    I +   +  GG++F    C++ PR +  W
Sbjct  292  IVDVPAAWSSKTLPIVQ---ALAGGTLFYVTVCEVIPREKARW  331



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01270.1.1 Unknown

Length=148
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ19_DROME  unnamed protein product                                 26.2    7.2  
M9PBE8_DROME  unnamed protein product                                 26.2    7.5  


>A8DZ19_DROME unnamed protein product
Length=1310

 Score = 26.2 bits (56),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  103   GIFTDYRKNLASQDSKLENFICPQCLTKL  131
             GI   Y K+L S+DSK    +C  C   L
Sbjct  1056  GIAHAYNKSLPSKDSKDSGSVCSSCFCSL  1084


>M9PBE8_DROME unnamed protein product
Length=1198

 Score = 26.2 bits (56),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  103   GIFTDYRKNLASQDSKLENFICPQCLTKL  131
             GI   Y K+L S+DSK    +C  C   L
Sbjct  1056  GIAHAYNKSLPSKDSKDSGSVCSSCFCSL  1084



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01280.1.1 Unknown

Length=72
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNU2_DROME  unnamed protein product                                 31.6    0.015
MADD_DROME  unnamed protein product                                   24.6    5.0  


>Q9VNU2_DROME unnamed protein product
Length=334

 Score = 31.6 bits (70),  Expect = 0.015, Method: Composition-based stats.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  21   HGVAPRTDSKTSCFSLESTSLWADSYHQNINN  52
            HG  PR D  +SC  L++  L+ + +H   NN
Sbjct  96   HGCQPRLDDGSSCSDLQNAELYVEQFHCTNNN  127


>MADD_DROME unnamed protein product
Length=2084

 Score = 24.6 bits (52),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 11/19 (58%), Gaps = 0/19 (0%)

Query  47    HQNINNRVFLKDTNNNKLA  65
             H N  N+ FLKD  N  LA
Sbjct  1182  HSNAENQTFLKDVTNQVLA  1200



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01290.1.1 dentin

Length=143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVC6_DROME  unnamed protein product                                 27.3    2.8  
Q7KHK9_DROME  unnamed protein product                                 26.6    4.8  


>Q9VVC6_DROME unnamed protein product
Length=2029

 Score = 27.3 bits (59),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  55   NGKSKLLIQTKRGYSYQEDHHDTRRNS  81
             G+ K   +T  G SY + HH +RR S
Sbjct  333  GGRRKYSFKTHAGKSYHQHHHPSRRTS  359


>Q7KHK9_DROME unnamed protein product
Length=527

 Score = 26.6 bits (57),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 13/15 (87%), Gaps = 0/15 (0%)

Query  18   CSSLNRSGDSTDLDT  32
            C +LNRSG ++D+DT
Sbjct  478  CEALNRSGKTSDIDT  492



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01300.1.1 cAMP-specific

Length=217
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVC6_DROME  unnamed protein product                                 26.9    8.2  


>Q9VVC6_DROME unnamed protein product
Length=2029

 Score = 26.9 bits (58),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  56   GKSKILIQTKRGYSYQEDHHDTRRNS  81
            G+ K   +T  G SY + HH +RR S
Sbjct  334  GRRKYSFKTHAGKSYHQHHHPSRRTS  359



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01310.1.1 Metallo-beta-lactamase

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPU3_DROME  unnamed protein product                                 40.0    3e-04
Q9VPB3_DROME  unnamed protein product                                 39.3    5e-04
Q9I7P8_DROME  unnamed protein product                                 39.3    6e-04


>Q8IPU3_DROME unnamed protein product
Length=348

 Score = 40.0 bits (92),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 20/122 (16%)

Query  61   QVLNKESISLEHIVLSHWHNDHVGGLKDIFKHINPDSATIWKFKGTEKDEAQATDFVPE-  119
            + + ++ ++L  ++ +H H DH GG + + K        +W+    E D     D +   
Sbjct  127  KTVQEQQLTLSKVLTTHHHWDHAGGNEKLLK--------LWE---KELDVYGGDDRIGAL  175

Query  120  NKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEE-----ENVVFSGDTILGEGTT  174
            NK VQ         + G  ++ + TP HTT HI   +       E  VF+GDT+   G  
Sbjct  176  NKKVQ---QDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCG  232

Query  175  VF  176
             F
Sbjct  233  RF  234


>Q9VPB3_DROME unnamed protein product
Length=305

 Score = 39.3 bits (90),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 20/122 (16%)

Query  61   QVLNKESISLEHIVLSHWHNDHVGGLKDIFKHINPDSATIWKFKGTEKDEAQATDFVPE-  119
            + + ++ ++L  ++ +H H DH GG + + K        +W+    E D     D +   
Sbjct  84   KTVQEQQLTLSKVLTTHHHWDHAGGNEKLLK--------LWE---KELDVYGGDDRIGAL  132

Query  120  NKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEE-----ENVVFSGDTILGEGTT  174
            NK VQ         + G  ++ + TP HTT HI   +       E  VF+GDT+   G  
Sbjct  133  NKKVQ---QDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCG  189

Query  175  VF  176
             F
Sbjct  190  RF  191


>Q9I7P8_DROME unnamed protein product
Length=271

 Score = 39.3 bits (90),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 20/122 (16%)

Query  61   QVLNKESISLEHIVLSHWHNDHVGGLKDIFKHINPDSATIWKFKGTEKDEAQATDFVPE-  119
            + + ++ ++L  ++ +H H DH GG + + K        +W+    E D     D +   
Sbjct  50   KTVQEQQLTLSKVLTTHHHWDHAGGNEKLLK--------LWE---KELDVYGGDDRIGAL  98

Query  120  NKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEE-----ENVVFSGDTILGEGTT  174
            NK VQ         + G  ++ + TP HTT HI   +       E  VF+GDT+   G  
Sbjct  99   NKKVQ---QDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCG  155

Query  175  VF  176
             F
Sbjct  156  RF  157



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01320.1.1 Mitotic

Length=222
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRQ2_DROME  unnamed protein product                                 215     2e-71
Q9VNE1_DROME  unnamed protein product                                 48.1    5e-07
FUTSC_DROME  unnamed protein product                                  27.3    6.6  


>Q9VRQ2_DROME unnamed protein product
Length=207

 Score = 215 bits (548),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 145/218 (67%), Gaps = 14/218 (6%)

Query  1    MATTQKTENAITLKGSAKLVTDYLSLGINSILFQRGIYPPESFKSEQHFGLTIYVATDKE  60
            M+T Q T+N ITLKGSA+++ +YL  GINSILFQRGIYP E F + Q +GLTI ++ D +
Sbjct  1    MSTAQATKNCITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPK  60

Query  61   IQDFINRILGQIKDWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNT  120
            I+ F+  +L Q ++WL +  + K+S++I+N +TKEVLE WDF +Q          A +  
Sbjct  61   IKTFLQNVLSQTEEWLSKNMINKISMVITNAHTKEVLECWDFNMQ----------AELGD  110

Query  121  ASKTDSTNAEKDKIGNKDIKVIQKEIRDVLRQICSTVSFLPLLDAPCAFDCLIFTNFDTS  180
               +D T A       K++  IQ EIRDV+RQI +TVS+LPLLD  C FD +I T  +T 
Sbjct  111  GDISDPTKATT----TKELSRIQNEIRDVMRQISATVSYLPLLDCICTFDIMIHTLQNTE  166

Query  181  VPENWVETEPVFIANSQEVQLRSFSTSLHKMDTVVSYK  218
            +P  W ET  + I N Q VQLRSFST LHK+DTVV+YK
Sbjct  167  LPAKWDETGAIVIQNPQAVQLRSFSTGLHKVDTVVNYK  204


>Q9VNE1_DROME unnamed protein product
Length=198

 Score = 48.1 bits (113),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query  17   AKLVTDYLSLGINSILFQRGIYPPESFKSEQHFGLTIYVATDKEIQDFINRILGQIKDWL  76
            A ++ + + + +N IL+ RGIYP   FK ++ +   IYV+    + +++  +L   ++ L
Sbjct  7    ADIIVEAMEVLVNHILYVRGIYPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELL  66

Query  77   LQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSS  110
             + ++Q L LI+  +   E LE +  +L+  +S 
Sbjct  67   RRRELQCLELIVYQKEN-EKLESYKMQLETQRSG  99


>FUTSC_DROME unnamed protein product
Length=5495

 Score = 27.3 bits (59),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 57/124 (46%), Gaps = 13/124 (10%)

Query  68    ILGQIKDWLLQEKVQKLSLIISNRNTKE--VLERWDFKLQYDKSSDENDAASVNTASKTD  125
             ++  IKD   + + ++ S + S   ++   VLE    K +  KS++++   SV  + K D
Sbjct  1715  VIDGIKDESAKPESRRDSPLASKEASRPESVLE--SVKDEPIKSTEKSRRESVAESFKAD  1772

Query  126   STNAEKDKIGNKDIKVIQKEIRDVLRQICSTVSFLPLLDAPCAFDCLIFTNFDTSVPENW  185
             ST  EK  + +KDI   +  + +V+  + S     P           +  + D S PE+ 
Sbjct  1773  STKDEKSPLTSKDISRPESAVENVMDAVGSAERSQPE---------SVTASRDVSRPESV  1823

Query  186   VETE  189
              E+E
Sbjct  1824  AESE  1827



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01330.1.1 Myelin

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHC7_DROME  unnamed protein product                                 176     4e-48
Q8MSI9_DROME  unnamed protein product                                 168     1e-46
A0A0B4K6Z1_DROME  unnamed protein product                             103     2e-25


>Q9VHC7_DROME unnamed protein product
Length=632

 Score = 176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 139/209 (67%), Gaps = 32/209 (15%)

Query  161  YGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRG  220
            YGLS  FLESLGI+ PL NKVFVANLDYKVD KKL++VF+LAGKV++V+++LDK+G SRG
Sbjct  214  YGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRG  273

Query  221  FGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGAN  280
            F  +E+DHPVEAVQ+ISML+ Q LF+RR+TVR+DR+ D+ +G ++LPEGL  +G+GLG N
Sbjct  274  FAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEG-IKLPEGLGGVGIGLGPN  332

Query  281  GAPLQDVARNLPN--------------------MNTNPTPTASVSTPAALAAAVTALT--  318
            G PL+DVA NLPN                    + + P  +A  +    L   +T +   
Sbjct  333  GEPLRDVAHNLPNGGQSQGQLLGNAQQGSQLGSVGSQPNSSAVSNATTNLLNNLTGVMFG  392

Query  319  --QAQQPPP----PQPSLGNLGLNLGLGG  341
               A QP P     +PSLGN   N G GG
Sbjct  393  NHAAVQPSPVAPVQKPSLGN---NTGSGG  418


>Q8MSI9_DROME unnamed protein product
Length=430

 Score = 168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 113/134 (84%), Gaps = 1/134 (1%)

Query  160  TYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSR  219
              G   +FLESLGI+ PL NKVFVANLDYKVD KKL++VF+LAGKV++V+++LDK+G SR
Sbjct  11   CMGFLLRFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSR  70

Query  220  GFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGA  279
            GF  +E+DHPVEAVQ+ISML+ Q LF+RR+TVR+DR+ D+ +G ++LPEGL  +G+GLG 
Sbjct  71   GFAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEG-IKLPEGLGGVGIGLGP  129

Query  280  NGAPLQDVARNLPN  293
            NG PL+DVA NLPN
Sbjct  130  NGEPLRDVAHNLPN  143


 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  52   IIVSNIPFEYRWQDLKDLFRTEVGDVTYVEILNDDTGKPR  91
            II+ N+P    WQ L+D FR E+GDV + EI  +D G  R
Sbjct  363  IIIKNVPITCTWQTLRDKFR-EIGDVKFAEIRGNDVGVVR  401


>A0A0B4K6Z1_DROME unnamed protein product
Length=214

 Score = 103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 66/88 (75%), Gaps = 3/88 (3%)

Query  51   RIIVSNIPFEYRWQDLKDLFRTEVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNK  110
            R+ +SNIP++YRWQDLKDLFR  VG + YV++  D++GK RG  IVEF+ P+ V+KA+ K
Sbjct  58   RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEK  117

Query  111  MHRFETKGRKLVIKEAVEDKGGRRNMGG  138
            M+R+E  GR+LV+K   ED G +R+  G
Sbjct  118  MNRYEVNGRELVVK---EDHGEQRDQYG  142


 Score = 48.9 bits (115),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 5/82 (6%)

Query  174  NCPLINKVFVANLDYKVDEKKLREVFR-LAGKVENVEIALDKDGKSRGFGTVEFDHPVEA  232
            NC    +V+++N+ Y    + L+++FR + G +E V++  D+ GK+RG G VEF  P   
Sbjct  56   NC----RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENV  111

Query  233  VQSISMLNNQNLFERRITVRMD  254
             +++  +N   +  R + V+ D
Sbjct  112  QKALEKMNRYEVNGRELVVKED  133


 Score = 35.8 bits (81),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 38/69 (55%), Gaps = 8/69 (12%)

Query  477  VVVKNLPPTITWQELRDKFRN-CGDIKFAEI------KGKGDIGLVRFDSEWTAKRAIDM  529
            V + N+P    WQ+L+D FR   G I++ ++      K +G  G+V F      ++A++ 
Sbjct  59   VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARG-CGIVEFKDPENVQKALEK  117

Query  530  MDRTRIDGK  538
            M+R  ++G+
Sbjct  118  MNRYEVNGR  126



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


Query= Dcitr00g01340.1.1 Testis-expressed

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HPF1_DROME  unnamed protein product                                   37.7    0.016
Q9VQ78_DROME  unnamed protein product                                 29.3    7.7  


>HPF1_DROME unnamed protein product
Length=449

 Score = 37.7 bits (86),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (48%), Gaps = 14/109 (13%)

Query  69   LMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVK  128
            ++ R   +N A KQ  L  L  +      +V +S F S L+    L +D+  +  K    
Sbjct  352  MLERKDVDNGAAKQAVLEKLQPVANAANIAVDESDFGSALE----LGIDMFCSGHKELHM  407

Query  129  LLSAMFSQVTEEELAPLFEIVVR--YLACAMSHLDAGVREDSLLIIDVL  175
            L S++        L P + ++ R  ++A A +H++   RED+L I DVL
Sbjct  408  LASSL--------LVPAYSMLSRPQFIAIAKAHMEQRSREDNLSIFDVL  448


>Q9VQ78_DROME unnamed protein product
Length=1189

 Score = 29.3 bits (64),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 19/83 (23%), Positives = 36/83 (43%), Gaps = 0/83 (0%)

Query  32   NVTNTEFKVKRIVIREQLKERGENELLSVQRKLSVKELMSRLRHNNSAVKQDGLSGLLEI  91
            N+  T       V+ EQ  E GE  ++    +  ++EL+  LR   + ++     GL  +
Sbjct  322  NLNQTTAAGGEPVVLEQSLEEGEEIVVPDAIEEVIEELLQALRSGGNDIRWSAAKGLGRV  381

Query  92   ITLNPTSVIKSHFSSILDSVSPL  114
                P  +      S++D ++PL
Sbjct  382  TNRLPKELADEVIGSVIDILNPL  404



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 364122176


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g01350.1.1 Mitogen-activated

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M3K7_DROME  unnamed protein product                                   332     7e-110
Q9VW24_DROME  unnamed protein product                                 149     2e-40 
D3DMF6_DROME  unnamed protein product                                 149     2e-40 


>M3K7_DROME unnamed protein product
Length=678

 Score = 332 bits (852),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 204/290 (70%), Gaps = 3/290 (1%)

Query  18   IDYNEIEKIEIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIV  77
            +D++EI   E VG G++GVV K +W+++ VAVK     AE+K    EV+QLSRV HPNI+
Sbjct  14   VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKEVKQLSRVKHPNII  73

Query  78   KLYGACT-GNPVCLVMEYAEGGSLYNVLHNKPEPAYSAGHAMSWALQCAEGVAYLHNIKP  136
             L+G  +      L+ME+AEGGSL+N LH K +PAYS  HAMSWA QCAEG+AYLH + P
Sbjct  74   ALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTP  133

Query  137  KPLIHRSEAP-NLLSSAHGTKLKICDFGTVCDKKTIMTNNKGSAAWMAPEVFEGSNYTEK  195
            KPLIHR   P NLL +  G  LKICDFGTV DK T+MTNN+GSAAWMAPEVFEGS YTEK
Sbjct  134  KPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNRGSAAWMAPEVFEGSKYTEK  193

Query  196  CDIFSWGIILWEILSRRKPFHEIYGSAFGILWAIHKGIRPALMEGCPKPIEQLMTRCWSK  255
            CDIFSW I+LWE+LSR++PF  I  +A+ I W I+KG RP L+  CPK IE LMT CW  
Sbjct  194  CDIFSWAIVLWEVLSRKQPFKGI-DNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKT  252

Query  256  DPLARPSMDEVVRIMTTLFQFFSGHEEPLQYTVGEIQESARKSDSKTAAQ  305
             P  RPSM  +V +M  + + ++G ++ L+YT    Q   ++SD   AAQ
Sbjct  253  VPEDRPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQ  302


>Q9VW24_DROME unnamed protein product
Length=977

 Score = 149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 145/256 (57%), Gaps = 18/256 (7%)

Query  17   EIDYNEIEKIEIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNI  76
            +I +  I ++E +G GA G V+ G  +N+ VAVK ++   E      +++ L ++ H NI
Sbjct  155  QIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKVKELKE-----TDIKHLRKLDHENI  209

Query  77   VKLYGACTGNPV-CLVMEYAEGGSLYNVLHNKPEPAYSAGHAMSWALQCAEGVAYLHNIK  135
            +K  G CT +PV C++ME+   G L N+L  K E        +SW+ Q A G+ YLH+ K
Sbjct  210  IKFKGVCTQSPVFCIIMEFCPYGPLQNIL--KEEQVMLPSRLVSWSKQIALGMQYLHSHK  267

Query  136  PKPLIHRS-EAPNLLSSAHGTKLKICDFGTVCDKKTIMTNNK--GSAAWMAPEVFEGSNY  192
               +IHR  ++PN+L S +   +KI DFGT  +   I T     G+ AWMAPEV      
Sbjct  268  ---IIHRDLKSPNILISTNEV-VKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPC  323

Query  193  TEKCDIFSWGIILWEILSRRKPFHEIYGSAFGILWAI-HKGIRPALMEGCPKPIEQLMTR  251
            +EK DI+S+G++LWE+L+   P+ ++  SA  I+W + +  ++  +   CP+  + L+  
Sbjct  324  SEKVDIWSYGVVLWEMLTCEIPYKDVDSSA--IIWGVGNNSLKLLVPSTCPEGFKLLVKL  381

Query  252  CWSKDPLARPSMDEVV  267
            CW   P  RPS  +++
Sbjct  382  CWKSKPRNRPSFRQIL  397


>D3DMF6_DROME unnamed protein product
Length=950

 Score = 149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 145/256 (57%), Gaps = 18/256 (7%)

Query  17   EIDYNEIEKIEIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNI  76
            +I +  I ++E +G GA G V+ G  +N+ VAVK ++   E      +++ L ++ H NI
Sbjct  128  QIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKVKELKE-----TDIKHLRKLDHENI  182

Query  77   VKLYGACTGNPV-CLVMEYAEGGSLYNVLHNKPEPAYSAGHAMSWALQCAEGVAYLHNIK  135
            +K  G CT +PV C++ME+   G L N+L  K E        +SW+ Q A G+ YLH+ K
Sbjct  183  IKFKGVCTQSPVFCIIMEFCPYGPLQNIL--KEEQVMLPSRLVSWSKQIALGMQYLHSHK  240

Query  136  PKPLIHRS-EAPNLLSSAHGTKLKICDFGTVCDKKTIMTNNK--GSAAWMAPEVFEGSNY  192
               +IHR  ++PN+L S +   +KI DFGT  +   I T     G+ AWMAPEV      
Sbjct  241  ---IIHRDLKSPNILISTNEV-VKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPC  296

Query  193  TEKCDIFSWGIILWEILSRRKPFHEIYGSAFGILWAI-HKGIRPALMEGCPKPIEQLMTR  251
            +EK DI+S+G++LWE+L+   P+ ++  SA  I+W + +  ++  +   CP+  + L+  
Sbjct  297  SEKVDIWSYGVVLWEMLTCEIPYKDVDSSA--IIWGVGNNSLKLLVPSTCPEGFKLLVKL  354

Query  252  CWSKDPLARPSMDEVV  267
            CW   P  RPS  +++
Sbjct  355  CWKSKPRNRPSFRQIL  370



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01360.1.1 Unknown

Length=446


***** No hits found *****



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01370.1.1 TATA-binding

Length=323
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 146     5e-39
Q71V44_DROME  unnamed protein product                                 142     2e-37
MED6_DROME  unnamed protein product                                   28.1    5.7  


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 138/252 (55%), Gaps = 30/252 (12%)

Query  1    MTSRLDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLA  60
            MTSRLDRLF+LLETGST  TR AAA Q+GE+Q+L+PHELH LL R    L S SW+TR+A
Sbjct  1    MTSRLDRLFILLETGSTAATRQAAAKQIGEVQKLYPHELHALLNRLVGYLHSTSWETRIA  60

Query  61   AAQAVGAVVRHTPPWSP----MPV---CVQEPDGNIMVIQDGVVSGK-----------LS  102
            AAQ V A+++  PPW P    +P    C           ++                 LS
Sbjct  61   AAQTVEAILKQVPPWQPEFQVLPKKERCATNTATAAAAAEEDSCQSSGSNSTTASERLLS  120

Query  103  LAMFDIERILDSSSCLTASQGSEFDMEEDSMGSTSTGIGPNNKDSLQRAHQQ---LHAKL  159
               FD+++IL   + L  S+G+EFD++E+   S   G G  ++    R  +Q   L+ KL
Sbjct  121  FDEFDLQQILHKGARLIGSEGNEFDVQEEQPAS---GGGEEDRSLASRLSRQRAVLNDKL  177

Query  160  GFPL---LDPSITDTLLTKED--LITTSRTKDIEQDKPNVGDILSSGSLNNSGGGGAMSS  214
            G      L  ++TD ++T ED  L  +  T ++  +K  V  +L+  +  N  G   +S 
Sbjct  178  GLTTAAKLGVNLTD-MITDEDVALNRSGSTYNVNAEKLPVEHLLNIKTAANGSGQAPLSC  236

Query  215  REMNRARRKARR  226
            REMNRA+RKAR+
Sbjct  237  REMNRAKRKARQ  248


>Q71V44_DROME unnamed protein product
Length=1924

 Score = 142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 135/250 (54%), Gaps = 30/250 (12%)

Query  1    MTSRLDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLA  60
            MTSRLDRLF+LLETGST  TR AAA Q+GE+Q+L+PHELH LL R    L S SW+TR+A
Sbjct  1    MTSRLDRLFILLETGSTAATRQAAAKQIGEVQKLYPHELHALLNRLVGYLHSTSWETRIA  60

Query  61   AAQAVGAVVRHTPPWSP----MPV---CVQEPDGNIMVIQDGVVSGK-----------LS  102
            AAQ V A+++  PPW P    +P    C           ++                 LS
Sbjct  61   AAQTVEAILKQVPPWQPEFQVLPKKERCATNTATAAAAAEEDSCQSSGSNSTTASERLLS  120

Query  103  LAMFDIERILDSSSCLTASQGSEFDMEEDSMGSTSTGIGPNNKDSLQRAHQQ---LHAKL  159
               FD+++IL   + L  S+G+EFD++E+   S   G G  ++    R  +Q   L+ KL
Sbjct  121  FDEFDLQQILHKGARLIGSEGNEFDVQEEQPAS---GGGEEDRSLASRLSRQRAVLNDKL  177

Query  160  GFPL---LDPSITDTLLTKED--LITTSRTKDIEQDKPNVGDILSSGSLNNSGGGGAMSS  214
            G      L  ++TD ++T ED  L  +  T ++  +K  V  +L+  +  N  G   +S 
Sbjct  178  GLTTAAKLGVNLTD-MITDEDVALNRSGSTYNVNAEKLPVEHLLNIKTAANGSGQAPLSC  236

Query  215  REMNRARRKA  224
            REMNRA+RK 
Sbjct  237  REMNRAKRKV  246


>MED6_DROME unnamed protein product
Length=249

 Score = 28.1 bits (61),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (49%), Gaps = 0/35 (0%)

Query  16  STPYTRHAAATQLGELQRLHPHELHTLLRRTYCLL  50
           S P+  H    +   +QRL P  LH ++   Y LL
Sbjct  37  SNPFYDHMCNNETVRMQRLGPEHLHNMIGLEYILL  71



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01380.1.1 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     5e-128
MED12_DROME  unnamed protein product                                  29.3    3.1   


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>MED12_DROME unnamed protein product
Length=2531

 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 5/95 (5%)

Query  112   IQAAFREPRLLVVTDPH---TDHQ-PITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKS  167
             +Q  F  PR     DPH   T H+ P    ++V+  +IA C      R  D+A+ C   +
Sbjct  1105  LQELFMAPRRGGKLDPHWLGTLHESPANVYSFVSNALIAVCRETDNERLNDVALACAELT  1164

Query  168   PHSIGLM-WWLLAREVLRFRGTIPREPKWDVVVDL  201
                  L   W+ A + L      PR P     VD+
Sbjct  1165  ASCNVLSEEWIYALQSLCSGSKSPRYPHLGGQVDI  1199



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01380.1.2 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     5e-128
MED12_DROME  unnamed protein product                                  29.3    3.1   


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>MED12_DROME unnamed protein product
Length=2531

 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 5/95 (5%)

Query  112   IQAAFREPRLLVVTDPH---TDHQ-PITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKS  167
             +Q  F  PR     DPH   T H+ P    ++V+  +IA C      R  D+A+ C   +
Sbjct  1105  LQELFMAPRRGGKLDPHWLGTLHESPANVYSFVSNALIAVCRETDNERLNDVALACAELT  1164

Query  168   PHSIGLM-WWLLAREVLRFRGTIPREPKWDVVVDL  201
                  L   W+ A + L      PR P     VD+
Sbjct  1165  ASCNVLSEEWIYALQSLCSGSKSPRYPHLGGQVDI  1199



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01380.1.3 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     5e-128
MED12_DROME  unnamed protein product                                  29.3    3.1   


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>MED12_DROME unnamed protein product
Length=2531

 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 5/95 (5%)

Query  112   IQAAFREPRLLVVTDPH---TDHQ-PITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKS  167
             +Q  F  PR     DPH   T H+ P    ++V+  +IA C      R  D+A+ C   +
Sbjct  1105  LQELFMAPRRGGKLDPHWLGTLHESPANVYSFVSNALIAVCRETDNERLNDVALACAELT  1164

Query  168   PHSIGLM-WWLLAREVLRFRGTIPREPKWDVVVDL  201
                  L   W+ A + L      PR P     VD+
Sbjct  1165  ASCNVLSEEWIYALQSLCSGSKSPRYPHLGGQVDI  1199



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01380.1.4 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     5e-128
MED12_DROME  unnamed protein product                                  29.3    3.1   


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>MED12_DROME unnamed protein product
Length=2531

 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 5/95 (5%)

Query  112   IQAAFREPRLLVVTDPH---TDHQ-PITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKS  167
             +Q  F  PR     DPH   T H+ P    ++V+  +IA C      R  D+A+ C   +
Sbjct  1105  LQELFMAPRRGGKLDPHWLGTLHESPANVYSFVSNALIAVCRETDNERLNDVALACAELT  1164

Query  168   PHSIGLM-WWLLAREVLRFRGTIPREPKWDVVVDL  201
                  L   W+ A + L      PR P     VD+
Sbjct  1165  ASCNVLSEEWIYALQSLCSGSKSPRYPHLGGQVDI  1199



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01390.1.1 Unknown

Length=52
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNX2_DROME  unnamed protein product                                 25.0    1.9  
RYR_DROME  unnamed protein product                                    23.1    8.1  


>Q9VNX2_DROME unnamed protein product
Length=568

 Score = 25.0 bits (53),  Expect = 1.9, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 3/35 (9%)

Query  9    VLSCGIVEVWWSHGQVLEVLT--MFHNSWSALVQI  41
            VL+C ++ V+++ G+VL  ++   FH+ W  L++I
Sbjct  248  VLACSVITVFYAVGEVLLAMSAKAFHD-WRILLRI  281


>RYR_DROME unnamed protein product
Length=5127

 Score = 23.1 bits (48),  Expect = 8.1, Method: Composition-based stats.
 Identities = 8/16 (50%), Positives = 9/16 (56%), Gaps = 0/16 (0%)

Query  7     ILVLSCGIVEVWWSHG  22
             IL L C  +  WWS G
Sbjct  3383  ILPLLCAYLPFWWSQG  3398



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01400.1.1 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     3e-128
MED12_DROME  unnamed protein product                                  29.3    2.8   


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (937),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/266 (73%), Positives = 214/266 (80%), Gaps = 11/266 (4%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKE-----SAAAIADKPVDEFAAH  235
            EVLR RGTI R  +W VVVDLFFYRDPEEAEKEE A KE           D PV+E    
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDPEEAEKEEAAAKELLPPPKIEEAVDHPVEE----  236

Query  236  APTESWNDTVVPSADLAPQSWAEESA  261
              T +W D V        + W E++ 
Sbjct  237  --TTNWADEVAAETVGGVEDWNEDTV  260


>MED12_DROME unnamed protein product
Length=2531

 Score = 29.3 bits (64),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 5/95 (5%)

Query  112   IQAAFREPRLLVVTDPH---TDHQ-PITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKS  167
             +Q  F  PR     DPH   T H+ P    ++V+  +IA C      R  D+A+ C   +
Sbjct  1105  LQELFMAPRRGGKLDPHWLGTLHESPANVYSFVSNALIAVCRETDNERLNDVALACAELT  1164

Query  168   PHSIGLM-WWLLAREVLRFRGTIPREPKWDVVVDL  201
                  L   W+ A + L      PR P     VD+
Sbjct  1165  ASCNVLSEEWIYALQSLCSGSKSPRYPHLGGQVDI  1199



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01410.1.1 TATA-binding

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 353     1e-108
Q71V44_DROME  unnamed protein product                                 342     1e-104
Q8SX88_DROME  unnamed protein product                                 33.1    0.28  


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 353 bits (905),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 223/538 (41%), Positives = 301/538 (56%), Gaps = 89/538 (17%)

Query  11   LDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLAAAQA  70
            LDRLF+LLETGST  TR AAA Q+GE+Q+L+PHELH LL R    L S SW+TR+AAAQ 
Sbjct  5    LDRLFILLETGSTAATRQAAAKQIGEVQKLYPHELHALLNRLVGYLHSTSWETRIAAAQT  64

Query  71   VGAVVRHTPPWSP----MP-------------VCVQEPDCNTMVLQDGVVSGKL-SLAMF  112
            V A+++  PPW P    +P                +E  C +        S +L S   F
Sbjct  65   VEAILKQVPPWQPEFQVLPKKERCATNTATAAAAAEEDSCQSSGSNSTTASERLLSFDEF  124

Query  113  DIERILDSSSFLTASQGSEFDMEEDSMGSTSTGIGPNNKDSLQRAHQQ---LHAKLGFPL  169
            D+++IL   + L  S+G+EFD++E+   S   G G  ++    R  +Q   L+ KLG   
Sbjct  125  DLQQILHKGARLIGSEGNEFDVQEEQPAS---GGGEEDRSLASRLSRQRAVLNDKLGLTT  181

Query  170  ---LDPSITDTLLTKED--LITTSRTKDIEQDKPNVGDILSSGSLNNSGGGGAMSSREMN  224
               L  ++TD ++T ED  L  +  T ++  +K  V  +L+  +  N  G   +S REMN
Sbjct  182  AAKLGVNLTD-MITDEDVALNRSGSTYNVNAEKLPVEHLLNIKTAANGSGQAPLSCREMN  240

Query  225  ----RARRK-------------ARRAV-------AKHRPRAGSG---QDPGEH-------  250
                +AR+              +RR         + H     +G   ++P +        
Sbjct  241  RAKRKARQNTSGCSVTAVTPTCSRRNSNSNHSTGSNHSSNGTTGAAIEEPEKKKLKSTDR  300

Query  251  --------------------ATEWPLEGFCDGLCGDLFSPLWEVRHGVATALREIIKVHG  290
                                A  WPLE FC  L  DLF   WEVRHG ATALRE+I  H 
Sbjct  301  QEIFYSLNAAVPDATGTWVDAVSWPLENFCSRLFIDLFHAKWEVRHGAATALRELINQHA  360

Query  291  RGAGKVVGQTKVQMEHSNRAWLEDVSVRLLCVLALDRFGDFVSDQVVAPVRETCAQALGV  350
            +GAGK V QT+ QM+ ++  WLED ++RLLCVL LDRFGDFVSDQVVAPVRETCAQ LG 
Sbjct  361  QGAGKAVLQTREQMDEAHSRWLEDAALRLLCVLCLDRFGDFVSDQVVAPVRETCAQVLGT  420

Query  351  VISLIDEESLVTRVVDLLLTLAQQKH-WETRHGGLLGLKYILAVKQDMVPSLLPRSLPLI  409
            ++  + E S V R+V++LL L Q K+ W+ RHGGLLGLKY+  V+++++P  LP+S+  I
Sbjct  421  LVKEM-EASKVQRIVNILLQLIQHKNEWDVRHGGLLGLKYVFVVREELLPIYLPQSISNI  479

Query  410  LSGLADPVDDVGNIAAATLIPVA---PHLIATPHVPALITQLWTLLADHDQLTSAFRS  464
            L GL D VDDVG +AAATLIPV+   P L+    V +++  LW LL D D+LTSA  S
Sbjct  480  LIGLLDAVDDVGAVAAATLIPVSSWLPKLLNPAQVSSIVKMLWDLLLDQDELTSACNS  537


>Q71V44_DROME unnamed protein product
Length=1924

 Score = 342 bits (876),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 220/539 (41%), Positives = 296/539 (55%), Gaps = 91/539 (17%)

Query  11   LDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLAAAQA  70
            LDRLF+LLETGST  TR AAA Q+GE+Q+L+PHELH LL R    L S SW+TR+AAAQ 
Sbjct  5    LDRLFILLETGSTAATRQAAAKQIGEVQKLYPHELHALLNRLVGYLHSTSWETRIAAAQT  64

Query  71   VGAVVRHTPPWSP----MP-------------VCVQEPDCNTMVLQDGVVSGKL-SLAMF  112
            V A+++  PPW P    +P                +E  C +        S +L S   F
Sbjct  65   VEAILKQVPPWQPEFQVLPKKERCATNTATAAAAAEEDSCQSSGSNSTTASERLLSFDEF  124

Query  113  DIERILDSSSFLTASQGSEFDMEEDSMGSTSTGIGPNNKDSLQRAHQQ---LHAKLGFPL  169
            D+++IL   + L  S+G+EFD++E+   S   G G  ++    R  +Q   L+ KLG   
Sbjct  125  DLQQILHKGARLIGSEGNEFDVQEEQPAS---GGGEEDRSLASRLSRQRAVLNDKLGLTT  181

Query  170  ---LDPSITDTLLTKED--LITTSRTKDIEQDKPNVGDIL--------------------  204
               L  ++TD ++T ED  L  +  T ++  +K  V  +L                    
Sbjct  182  AAKLGVNLTD-MITDEDVALNRSGSTYNVNAEKLPVEHLLNIKTAANGSGQAPLSCREMN  240

Query  205  -------------------------------SSGSLNNSGG--GGAMSSREMNRARRKAR  231
                                           S+GS ++S G  G A+   E  + +   R
Sbjct  241  RAKRKVCQNTSGCSVTAVTPTCSRRNSNSNHSTGSNHSSNGTTGAAIEEPEKKKLKSTDR  300

Query  232  RAVAKHRPRAGSGQDPGE--HATEWPLEGFCDGLCGDLFSPLWEVRHGVATALREIIKVH  289
            + +  +   A      G    A  WPLE FC  L  DLF   WEVRHG ATALRE+I  H
Sbjct  301  QEIF-YSLNAAVPDATGTWVDAVSWPLENFCSRLFIDLFHAKWEVRHGAATALRELINQH  359

Query  290  GRGAGKVVGQTKVQMEHSNRAWLEDVSVRLLCVLALDRFGDFVSDQVVAPVRETCAQALG  349
             +GAGK V QT+ QM+ ++  WLED ++RLLCVL LDRFGDFVSDQVVAPVRETCAQ LG
Sbjct  360  AQGAGKAVLQTREQMDEAHSRWLEDAALRLLCVLCLDRFGDFVSDQVVAPVRETCAQVLG  419

Query  350  VVISLIDEESLVTRVVDLLLTLAQQKH-WETRHGGLLGLKYILAVKQDMVPSLLPRSLPL  408
             ++  + E S V R+V++LL L Q K+ W+ RHGGLLGLKY+  V+++++P  LP+S+  
Sbjct  420  TLVKEM-EASKVQRIVNILLQLIQHKNEWDVRHGGLLGLKYVFVVREELLPIYLPQSISN  478

Query  409  ILSGLADPVDDVGNIAAATLIPVA---PHLIATPHVPALITQLWTLLADHDQLTSAFRS  464
            IL GL D VDDVG +AAATLIPV+   P L+    V +++  LW LL D D+LTSA  S
Sbjct  479  ILIGLLDAVDDVGAVAAATLIPVSSWLPKLLNPAQVSSIVKMLWDLLLDQDELTSACNS  537


>Q8SX88_DROME unnamed protein product
Length=642

 Score = 33.1 bits (74),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 3/102 (3%)

Query  340  VRETCAQALGVVISLIDEESLVTRVVDLLLTLAQQKHWETRHGGLLGLKYIL-AVKQDMV  398
            +R+  A AL V+ ++  E+ L   +  L  TL  Q+ W  +  G+L L  I     Q M+
Sbjct  128  LRKCSAAALDVLANVFREDCLPVVLPILKETLFHQE-WVIKESGVLALGAIAEGCMQGMI  186

Query  399  PSLLPRSLPLILSGLADPVDDVGNIAAATLIPVAPHLIATPH  440
              L P  +P ++S L+D    V +I   TL   A  ++  PH
Sbjct  187  QHL-PELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPH  227



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01420.1.1 TATA-binding

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 202     2e-56
Q86NV8_DROME  unnamed protein product                                 201     2e-56
Q71V44_DROME  unnamed protein product                                 166     3e-44


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/280 (41%), Positives = 165/280 (59%), Gaps = 5/280 (2%)

Query  45    GVETVPLATREVNATRCRLLASCLLGLASTYVIQPMTGLYLGTEQPPCPIQCYVNLLLVY  104
             G E  PL  R+ N  R R+ +S  LG  S Y++QP  G+   T Q   P  CY  +LL +
Sbjct  738   GSEATPLDVRDANFMRARISSSRALGALSHYLVQPAPGVVY-TPQTESPTDCYTKVLLGH  796

Query  105   VNSKSALQRLVSGLVIADWN-RRQVLQPPQDTLNSALVQCLDENIYYDELGAVYTKLLHD  163
             +N+ SA+QR+V GL+IA W    + ++P    L   L QC+ E +YYDE+    T+LL +
Sbjct  797   LNAHSAVQRIVCGLIIAFWALEDEPVRPGPPNLQEKLHQCVSEYVYYDEVAISLTRLLQE  856

Query  164   TTDLLSYMKHYELGFDYDAFNRVLTLDEIEQLVGTLLVQSMNEQRTSKTVKCLERIDERR  223
               D ++ +K  ++  +     ++LTLD+IE +  TL   S N +      K L+ ++ERR
Sbjct  857   AQDFIATLKQNKIPINDFNNAKILTLDQIEAVATTL---SENLRSYPLKPKVLDMLEERR  913

Query  224   KSILSFVQTTRKDQFNWHIMVQAVLAGALLRLQCLPPKVNPIIKPLMESIKFETNPLLQD  283
             +S+ +  Q T  +Q  +H+  QA LAGA+  L CLP K+NP++KPLMESIK E    LQ 
Sbjct  914   RSLQASYQQTTSEQSAYHVSAQAALAGAICALHCLPDKLNPVVKPLMESIKREQCLQLQQ  973

Query  284   MAATHLAILLGLCSQRNPCPNNKIVHNLCTFLCCDPEFTP  323
             ++A  L  L+     RNP PN+KI++NLCT L  DPEFTP
Sbjct  974   LSAEFLVHLMDQVCDRNPSPNSKILNNLCTLLRSDPEFTP  1013


>Q86NV8_DROME unnamed protein product
Length=1221

 Score = 201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/280 (41%), Positives = 166/280 (59%), Gaps = 5/280 (2%)

Query  45   GVETVPLATREVNATRCRLLASCLLGLASTYVIQPMTGLYLGTEQPPCPIQCYVNLLLVY  104
            G E  PL  R+ N  R R+ +S  LG  S Y++QP  G+ + T Q   P  CY  +LL +
Sbjct  36   GSEATPLDVRDANFMRARISSSRALGALSHYLVQPAPGV-VYTPQTESPTDCYTKVLLGH  94

Query  105  VNSKSALQRLVSGLVIADWN-RRQVLQPPQDTLNSALVQCLDENIYYDELGAVYTKLLHD  163
            +N+ SA+QR+V GL+IA W    + ++P    L   L QC+ E +YYDE+    T+LL +
Sbjct  95   LNAHSAVQRIVCGLIIAFWALEDEPVRPGPPNLQEKLHQCVSEYVYYDEVAISLTRLLQE  154

Query  164  TTDLLSYMKHYELGFDYDAFNRVLTLDEIEQLVGTLLVQSMNEQRTSKTVKCLERIDERR  223
              D ++ +K  ++  +     ++LTLD+IE +  TL   S N +      K L+ ++ERR
Sbjct  155  AQDFIATLKQNKIPINDFNNAKILTLDQIEAVATTL---SENLRSYPLKPKVLDMLEERR  211

Query  224  KSILSFVQTTRKDQFNWHIMVQAVLAGALLRLQCLPPKVNPIIKPLMESIKFETNPLLQD  283
            +S+ +  Q T  +Q  +H+  QA LAGA+  L CLP K+NP++KPLMESIK E    LQ 
Sbjct  212  RSLQASYQQTTSEQSAYHVSAQAALAGAICALHCLPDKLNPVVKPLMESIKREQCLQLQQ  271

Query  284  MAATHLAILLGLCSQRNPCPNNKIVHNLCTFLCCDPEFTP  323
            ++A  L  L+     RNP PN+KI++NLCT L  DPEFTP
Sbjct  272  LSAEFLVHLMDQVCDRNPSPNSKILNNLCTLLRSDPEFTP  311


>Q71V44_DROME unnamed protein product
Length=1924

 Score = 166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/283 (39%), Positives = 158/283 (56%), Gaps = 9/283 (3%)

Query  45    GVETVPLATREVNATRCRLLASCLLGLASTYVIQPMTGLYLGTEQPPCPIQCYVNLLLVY  104
             G E  PL  R+ N  R R+ +S  LG  S Y++QP  G+   T Q   P  CY  +LL +
Sbjct  738   GSEATPLDVRDANFMRARISSSRALGALSHYLVQPAPGVVY-TPQTESPTDCYTKVLLGH  796

Query  105   VNSKSALQRLVSGLVIADWN-RRQVLQPPQDTLNSALVQCLDENIYYDELGAVYTKLLHD  163
             +N+ SA+QR+V GL+IA W    + ++P    L   L QC+ E +YYDE+    T+LL +
Sbjct  797   LNAHSAVQRIVCGLIIAFWALEDEPVRPGPPNLQEKLHQCVSEYVYYDEVAISLTRLLQE  856

Query  164   TTDLLSYMKHYELGFDYDAFNRVLTLDEIEQLVGTLLVQSMNEQRTSKTVKCLERIDERR  223
               D ++ +K  ++  +     ++LTLD+IE +  TL   S N +      K L+ ++ERR
Sbjct  857   AQDFIATLKQNKIPINDFNNAKILTLDQIEAVATTL---SENLRSYPLKPKVLDMLEERR  913

Query  224   KSILSFVQTTRKDQFNWHIMV---QAVLAGALLRLQCLPPKVNPIIKPLMESIKFETNPL  280
             +       T+R+      IM    Q  LA +   L CLP K+NP++KPLMESIK E    
Sbjct  914   RRAAFRPPTSRQPVSKAAIMSVLRQHSLAPSA-ALHCLPDKLNPVVKPLMESIKREQCLQ  972

Query  281   LQDMAATHLAILLGLCSQRNPCPNNKIVHNLCTFLCCDPEFTP  323
             LQ ++A  L  L+     RNP PN+KI++NLCT L  DPEFTP
Sbjct  973   LQQLSAEFLVHLMDQVCDRNPSPNSKILNNLCTLLRSDPEFTP  1015



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01430.1.1 SNF2

Length=176
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IG93_DROME  unnamed protein product                                 238     7e-76
Q86NV8_DROME  unnamed protein product                                 240     5e-74
Q9VF02_DROME  unnamed protein product                                 240     6e-74


>Q8IG93_DROME unnamed protein product
Length=673

 Score = 238 bits (608),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 4/169 (2%)

Query  1    MLDIVENDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNL  60
            MLDIVE DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNL
Sbjct  475  MLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNL  534

Query  61   TGADTVIFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTA  120
            TGADTVIFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTA
Sbjct  535  TGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTA  594

Query  121  NTVINSENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGGLKV  166
            NTV+++EN +L TM T +I DLF   G+D   E+GSS   GT  GG+ +
Sbjct  595  NTVVSAENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSM  642


>Q86NV8_DROME unnamed protein product
Length=1221

 Score = 240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 4/169 (2%)

Query  1     MLDIVENDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNL  60
             MLDIVE DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNL
Sbjct  1023  MLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNL  1082

Query  61    TGADTVIFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTA  120
             TGADTVIFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTA
Sbjct  1083  TGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTA  1142

Query  121   NTVINSENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGGLKV  166
             NTV+++EN +L TM T +I DLF   G+D   E+GSS   GT  GG+ +
Sbjct  1143  NTVVSAENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSM  1190


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 240 bits (612),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 4/169 (2%)

Query  1     MLDIVENDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNL  60
             MLDIVE DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNL
Sbjct  1725  MLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNL  1784

Query  61    TGADTVIFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTA  120
             TGADTVIFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTA
Sbjct  1785  TGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTA  1844

Query  121   NTVINSENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGGLKV  166
             NTV+++EN +L TM T +I DLF   G+D   E+GSS   GT  GG+ +
Sbjct  1845  NTVVSAENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSM  1892



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01440.1.1 F-box

Length=410
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K2J4_DROME  unnamed protein product                                 353     3e-117
Q9VT01_DROME  unnamed protein product                                 120     4e-31 
Q95RF4_DROME  unnamed protein product                                 102     7e-25 


>Q7K2J4_DROME unnamed protein product
Length=603

 Score = 353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/340 (54%), Positives = 233/340 (69%), Gaps = 31/340 (9%)

Query  77   LMQFPTELLEKILLYLDFKHIAALRLVNRRMNTVCGSILSTTFNRLQSTMLARFQSIKSK  136
            L   P EL+EKIL Y+D+K ++ LRLV+ RMN +C ++L+T F +   T L+RFQ+IK+ 
Sbjct  122  LYDLPNELIEKILSYVDYKKVSNLRLVSHRMNDICMAMLNTAFTKQIKTTLSRFQAIKAS  181

Query  137  MPRRESARRQHPLACESDIVEMLHMRLALLQMSFGKHIERQHCCFFAGEILDEIYRIIHY  196
            MPRRES RR HPLACE DI+E  +MRL+LLQMS GKHIER HCCFF G ILDE+  I++Y
Sbjct  182  MPRRESHRRNHPLACECDIIETCYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNY  241

Query  197  IKTTPRLARPYKVTDELFDLSTMAMEYFKEKIEPTLPEITYFGTDFMDIAGPFPSSKNDS  256
            I  TPRL RPY+VTDELFDLSTMAMEYFK++IE TLP + YF  DF  +     ++K  +
Sbjct  242  ISITPRLQRPYRVTDELFDLSTMAMEYFKDRIEATLPGLAYFNKDFYTLPT---TTKRPT  298

Query  257  IACGSDAGGCGFESTLELSP-RSPPQSNMVLRKRIHKIKQGMKRYSSQLTLMKRDLKLCK  315
            +A  SD         LE S   SPPQ++MVLRK I KIKQGMK Y++QL++++ +L+ CK
Sbjct  299  LAISSD---------LEDSASNSPPQNHMVLRKGIRKIKQGMKMYNNQLSVLRTELRTCK  349

Query  316  VKLVDQTKTV--------------VEYATRLDEYDKKNEETSRKFSQVLQELNKCKTELQ  361
             K  +Q+K +              +EYA RLDE DKKNEE SRKFS +LQELNKCKTELQ
Sbjct  350  RKAAEQSKQLAEQSNLISEQQKQTLEYANRLDENDKKNEEMSRKFSTLLQELNKCKTELQ  409

Query  362  FFRSKFPFNPD-CTCSGPAVATDAPLIAPDLSQVLSPQVI  400
            F+RSK P  P  C+     V   AP++ P+  Q L  Q +
Sbjct  410  FWRSKSPAIPAVCSSCNQKV---APVVPPEDFQALVNQGV  446


>Q9VT01_DROME unnamed protein product
Length=314

 Score = 120 bits (301),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/301 (30%), Positives = 151/301 (50%), Gaps = 18/301 (6%)

Query  75   INLMQFPTELLEKILLYLDFKHIAALRLVNRRMNTVCGSILSTTFNRLQSTMLARFQSIK  134
            +NL+  P  L++ IL  L +  +A  R V    N +   IL+  FN++       F+ IK
Sbjct  1    MNLLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIK  60

Query  135  SKMPRRESARRQHPLACESDIVEMLHMRLALLQMSFGKHIERQHCCFFAGEILDEIYRII  194
            S +PRRES RR H L+  SDI+  +  R+++L M++ K I+   CCF  G +LDEI  I+
Sbjct  61   SMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSIL  120

Query  195  HYIKTTPRLARPYKVTDELFDLSTMAMEYFKEKI--------EPTLPEITYFGTDFM---  243
              + T+ +  RP++V  EL D+S+MA+E+F EKI           L E T  G   +   
Sbjct  121  RILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFKLEHRKQLAESTAAGARLVVCS  180

Query  244  ---DIAGPFPSSKNDSIACGSDAGGCGFESTLELSPRSPPQSNMVLRKRIHKIKQGMKRY  300
               DI+  F   +   I+   D G    ++ ++L+P S  +S+    ++    KQ  K+Y
Sbjct  181  ALGDIS--FSGVRRTGISRPVDHGLVQ-QAIVQLAPISASKSHSDSSQKDRMSKQLFKQY  237

Query  301  SSQLTLMKRDLKLCKVKLVDQTKTVVEYATRLDEYDKKNEETSRKFSQVLQELNKCKTEL  360
              Q +L ++ ++L +V    Q + + E  + + E   +  E  R+   V+  +  C  + 
Sbjct  238  QLQRSLSQK-IRLLEVSRKVQDRRLQEALSSITELTTQVSELKRQMEDVVANMPSCAVKR  296

Query  361  Q  361
            Q
Sbjct  297  Q  297


>Q95RF4_DROME unnamed protein product
Length=265

 Score = 102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 126/246 (51%), Gaps = 18/246 (7%)

Query  130  FQSIKSKMPRRESARRQHPLACESDIVEMLHMRLALLQMSFGKHIERQHCCFFAGEILDE  189
            F+ IKS +PRRES RR H L+  SDI+  +  R+++L M++ K I+   CCF  G +LDE
Sbjct  7    FKRIKSMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDE  66

Query  190  IYRIIHYIKTTPRLARPYKVTDELFDLSTMAMEYFKEKI--------EPTLPEITYFGTD  241
            I  I+  + T+ +  RP++V  EL D+S+MA+E+F EKI           L E T  G  
Sbjct  67   INSILRILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFKLEHRKQLAESTAAGAR  126

Query  242  FM------DIAGPFPSSKNDSIACGSDAGGCGFESTLELSPRSPPQSNMVLRKRIHKIKQ  295
             +      DI+  F   +   I+   D G    ++ ++L+P S  +S+    ++    KQ
Sbjct  127  LVVCSALGDIS--FSGVRRTGISRPVDHGLVQ-QAIVQLAPISASKSHSDSSQKDRMSKQ  183

Query  296  GMKRYSSQLTLMKRDLKLCKVKLVDQTKTVVEYATRLDEYDKKNEETSRKFSQVLQELNK  355
              K+Y  Q +L ++ ++L +V    Q + + E  + + E   +  E  R+   V+  +  
Sbjct  184  LFKQYQLQRSLSQK-IRLLEVSRKVQDRRLQEALSSITELTTQVSELKRQMEDVVANMPS  242

Query  356  CKTELQ  361
            C  + Q
Sbjct  243  CAVKRQ  248



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01450.1.1 SNF2

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86NV8_DROME  unnamed protein product                                 832     0.0  
Q9VF02_DROME  unnamed protein product                                 831     0.0  
Q71V44_DROME  unnamed protein product                                 831     0.0  


>Q86NV8_DROME unnamed protein product
Length=1221

 Score = 832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/793 (56%), Positives = 541/793 (68%), Gaps = 106/793 (13%)

Query  1     MGARCLSILATLQPNAVMSTVLSQVLPLLNASQPDIVRQGAVEALCNILDKMELKAVPYL  60
             M ARC+++LA +     M  V+  +LPLL   +  I RQGA+EA+  ++ ++++K VPY+
Sbjct  509   MAARCIAVLAEIDACQTMQFVVHDLLPLLGKIEQLIERQGAIEAIERVVSRLQIKVVPYI  568

Query  61    ILLVVPLLGRVSDQDTWVRLGATSCFATCIHLMPLDSALGTSTPSNSTQVCSSLHLPAD-  119
             +LLVVPLLG +SD D  VRL +T CFA  + LMPLD                +  L +D 
Sbjct  569   VLLVVPLLGAMSDPDESVRLLSTHCFANLVQLMPLDG--------------KTEQLKSDP  614

Query  120   LASRKASESRFLEQLFDPSRIPDFTLPSALGLTVTLRSYQQAGVNWLWFLRRYNLHGILC  179
             L +RK  +  FL+ LF+P  IP++ +P  + ++V LR YQQAG+NWLWFL +YNLHGILC
Sbjct  615   LQARKTRDREFLDYLFNPKSIPNYKVP--VPISVELRCYQQAGINWLWFLNKYNLHGILC  672

Query  180   DDMGLGKTLQSICVLAGDQWCRHEEEGEETRLPSLVVCPPTLTGHWMYEVLKFL-PNKFL  238
             DDMGLGKTLQ+IC+LAGD    H +      LPSLV+CPPTLTGHW+YEV KFL     L
Sbjct  673   DDMGLGKTLQTICILAGDHM--HRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVL  730

Query  239   NPLQYAGPPHEREKLRSRM-KEHNLIIASYDIIRKDNHVFSEVQWNYCILDEGHVIKNDK  297
              PL Y G P  REKLRS +  + NL++ASYD +RKD   FS + +NYC+LDEGH+IKN K
Sbjct  731   RPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGK  790

Query  298   AKSTRAIKSLRANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTPIQNNVLELWSLFDFL  357
              KS++AIK L+ANHRLILSGTPIQ                       NNVLELWSLFDFL
Sbjct  791   TKSSKAIKRLKANHRLILSGTPIQ-----------------------NNVLELWSLFDFL  827

Query  358   MPGFLGTPIQNNVLELWSLFDFLMPGFLGTEKQFASRYARPILASRDPKSSPRDQEAGVL  417
             MP                       GFLGTEKQF  R++RPIL+SRD KSS ++QEAGVL
Sbjct  828   MP-----------------------GFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVL  864

Query  418   AMEALHRQVLPLVLRRVKQDVLKDLPPKITQDYYCDLSPLQEKLYQDFARMKNLDLND--  475
             AMEALHRQVLP +LRRVK+DVLKDLPPKITQD  C+LSPLQ +LY+DF+     D  D  
Sbjct  865   AMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKL  924

Query  476   --------VKQN-----HVFQSLRYLQSVCNHPKLVLGPSH--AQYEALVSRPGLNLSDI  520
                     V +N     H+FQ+LRYLQ+VCNHPKLVL  S    +  + ++    +L DI
Sbjct  925   GDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTKVTSQLALSNSSLDDI  984

Query  521   RHAAKLPALKQLLMDCGIGASPGMSGSGPHYDPGAPPPSILTQHRALIFCQLRAMLDIVE  580
              H+AKLPALKQLL+DCGIG                     ++QHRALIFCQL+AMLDIVE
Sbjct  985   EHSAKLPALKQLLLDCGIGVQ----------------TESVSQHRALIFCQLKAMLDIVE  1028

Query  581   NDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTV  640
              DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNLTGADTV
Sbjct  1029  QDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTV  1088

Query  641   IFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTANTVINS  700
             IFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTANTV+++
Sbjct  1089  IFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSA  1148

Query  701   ENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGG--LKGLLDTLPELWDEREYE  755
             EN +L TM T +I DLF   G+D   E+GSS   GT  GG  +  +++ LPELW E +YE
Sbjct  1149  ENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSMNTIIENLPELWSEHQYE  1207

Query  756   EEYDLSNFVQSLN  768
             EEYDL NFVQ+L 
Sbjct  1208  EEYDLGNFVQALK  1220


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/793 (56%), Positives = 541/793 (68%), Gaps = 106/793 (13%)

Query  1     MGARCLSILATLQPNAVMSTVLSQVLPLLNASQPDIVRQGAVEALCNILDKMELKAVPYL  60
             M ARC+++LA +     M  V+  +LPLL   +  I RQGA+EA+  ++ ++++K VPY+
Sbjct  1211  MAARCIAVLAEIDACQTMQFVVHDLLPLLGKIEQLIERQGAIEAIERVVSRLQIKVVPYI  1270

Query  61    ILLVVPLLGRVSDQDTWVRLGATSCFATCIHLMPLDSALGTSTPSNSTQVCSSLHLPAD-  119
             +LLVVPLLG +SD D  VRL +T CFA  + LMPLD                +  L +D 
Sbjct  1271  VLLVVPLLGAMSDPDESVRLLSTHCFANLVQLMPLDG--------------KTEQLKSDP  1316

Query  120   LASRKASESRFLEQLFDPSRIPDFTLPSALGLTVTLRSYQQAGVNWLWFLRRYNLHGILC  179
             L +RK  +  FL+ LF+P  IP++ +P  + ++V LR YQQAG+NWLWFL +YNLHGILC
Sbjct  1317  LQARKTRDREFLDYLFNPKSIPNYKVP--VPISVELRCYQQAGINWLWFLNKYNLHGILC  1374

Query  180   DDMGLGKTLQSICVLAGDQWCRHEEEGEETRLPSLVVCPPTLTGHWMYEVLKFL-PNKFL  238
             DDMGLGKTLQ+IC+LAGD    H +      LPSLV+CPPTLTGHW+YEV KFL     L
Sbjct  1375  DDMGLGKTLQTICILAGDHM--HRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVL  1432

Query  239   NPLQYAGPPHEREKLRSRM-KEHNLIIASYDIIRKDNHVFSEVQWNYCILDEGHVIKNDK  297
              PL Y G P  REKLRS +  + NL++ASYD +RKD   FS + +NYC+LDEGH+IKN K
Sbjct  1433  RPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGK  1492

Query  298   AKSTRAIKSLRANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTPIQNNVLELWSLFDFL  357
              KS++AIK L+ANHRLILSGTPIQ                       NNVLELWSLFDFL
Sbjct  1493  TKSSKAIKRLKANHRLILSGTPIQ-----------------------NNVLELWSLFDFL  1529

Query  358   MPGFLGTPIQNNVLELWSLFDFLMPGFLGTEKQFASRYARPILASRDPKSSPRDQEAGVL  417
             MP                       GFLGTEKQF  R++RPIL+SRD KSS ++QEAGVL
Sbjct  1530  MP-----------------------GFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVL  1566

Query  418   AMEALHRQVLPLVLRRVKQDVLKDLPPKITQDYYCDLSPLQEKLYQDFARMKNLDLND--  475
             AMEALHRQVLP +LRRVK+DVLKDLPPKITQD  C+LSPLQ +LY+DF+     D  D  
Sbjct  1567  AMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKL  1626

Query  476   --------VKQN-----HVFQSLRYLQSVCNHPKLVLGPSH--AQYEALVSRPGLNLSDI  520
                     V +N     H+FQ+LRYLQ+VCNHPKLVL  S    +  + ++    +L DI
Sbjct  1627  GDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTKVTSQLALSNSSLDDI  1686

Query  521   RHAAKLPALKQLLMDCGIGASPGMSGSGPHYDPGAPPPSILTQHRALIFCQLRAMLDIVE  580
              H+AKLPALKQLL+DCGIG                     ++QHRALIFCQL+AMLDIVE
Sbjct  1687  EHSAKLPALKQLLLDCGIGVQ----------------TESVSQHRALIFCQLKAMLDIVE  1730

Query  581   NDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTV  640
              DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNLTGADTV
Sbjct  1731  QDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTV  1790

Query  641   IFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTANTVINS  700
             IFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTANTV+++
Sbjct  1791  IFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSA  1850

Query  701   ENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGG--LKGLLDTLPELWDEREYE  755
             EN +L TM T +I DLF   G+D   E+GSS   GT  GG  +  +++ LPELW E +YE
Sbjct  1851  ENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSMNTIIENLPELWSEHQYE  1909

Query  756   EEYDLSNFVQSLN  768
             EEYDL NFVQ+L 
Sbjct  1910  EEYDLGNFVQALK  1922


>Q71V44_DROME unnamed protein product
Length=1924

 Score = 831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/792 (56%), Positives = 541/792 (68%), Gaps = 106/792 (13%)

Query  1     MGARCLSILATLQPNAVMSTVLSQVLPLLNASQPDIVRQGAVEALCNILDKMELKAVPYL  60
             M ARC+++LA +     M  V+  +LPLL   +  I RQGA+EA+  ++ ++++K VPY+
Sbjct  1212  MAARCIAVLAEIDACQTMQFVVHDLLPLLGKIEQLIERQGAIEAIERVVSRLQIKVVPYI  1271

Query  61    ILLVVPLLGRVSDQDTWVRLGATSCFATCIHLMPLDSALGTSTPSNSTQVCSSLHLPAD-  119
             +LLVVPLLG +SD D  VRL +T CFA  + LMPLD                +  L +D 
Sbjct  1272  VLLVVPLLGAMSDPDESVRLLSTHCFANLVQLMPLDG--------------KTEQLKSDP  1317

Query  120   LASRKASESRFLEQLFDPSRIPDFTLPSALGLTVTLRSYQQAGVNWLWFLRRYNLHGILC  179
             L +RK  +  FL+ LF+P  IP++ +P  + ++V LR YQQAG+NWLWFL +YNLHGILC
Sbjct  1318  LQARKTRDREFLDYLFNPKSIPNYKVP--VPISVELRCYQQAGINWLWFLNKYNLHGILC  1375

Query  180   DDMGLGKTLQSICVLAGDQWCRHEEEGEETRLPSLVVCPPTLTGHWMYEVLKFL-PNKFL  238
             DDMGLGKTLQ+IC+LAGD    H +      LPSLV+CPPTLTGHW+YEV KFL     L
Sbjct  1376  DDMGLGKTLQTICILAGDHM--HRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVL  1433

Query  239   NPLQYAGPPHEREKLRSRM-KEHNLIIASYDIIRKDNHVFSEVQWNYCILDEGHVIKNDK  297
              PL Y G P  REKLRS +  + NL++ASYD +RKD   FS + +NYC+LDEGH+IKN K
Sbjct  1434  RPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGK  1493

Query  298   AKSTRAIKSLRANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTPIQNNVLELWSLFDFL  357
              KS++AIK L+ANHRLILSGTPIQ                       NNVLELWSLFDFL
Sbjct  1494  TKSSKAIKRLKANHRLILSGTPIQ-----------------------NNVLELWSLFDFL  1530

Query  358   MPGFLGTPIQNNVLELWSLFDFLMPGFLGTEKQFASRYARPILASRDPKSSPRDQEAGVL  417
             MP                       GFLGTEKQF  R++RPIL+SRD KSS ++QEAGVL
Sbjct  1531  MP-----------------------GFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVL  1567

Query  418   AMEALHRQVLPLVLRRVKQDVLKDLPPKITQDYYCDLSPLQEKLYQDFARMKNLDLND--  475
             AMEALHRQVLP +LRRVK+DVLKDLPPKITQD  C+LSPLQ +LY+DF+     D  D  
Sbjct  1568  AMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKL  1627

Query  476   --------VKQN-----HVFQSLRYLQSVCNHPKLVLGPSH--AQYEALVSRPGLNLSDI  520
                     V +N     H+FQ+LRYLQ+VCNHPKLVL  S    +  + ++    +L DI
Sbjct  1628  GDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTKVTSQLALSNSSLDDI  1687

Query  521   RHAAKLPALKQLLMDCGIGASPGMSGSGPHYDPGAPPPSILTQHRALIFCQLRAMLDIVE  580
              H+AKLPALKQLL+DCGIG                     ++QHRALIFCQL+AMLDIVE
Sbjct  1688  EHSAKLPALKQLLLDCGIGVQ----------------TESVSQHRALIFCQLKAMLDIVE  1731

Query  581   NDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTV  640
              DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNLTGADTV
Sbjct  1732  QDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTV  1791

Query  641   IFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTANTVINS  700
             IFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTANTV+++
Sbjct  1792  IFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSA  1851

Query  701   ENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGG--LKGLLDTLPELWDEREYE  755
             EN +L TM T +I DLF   G+D   E+GSS   GT  GG  +  +++ LPELW E +YE
Sbjct  1852  ENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSMNTIIENLPELWSEHQYE  1910

Query  756   EEYDLSNFVQSL  767
             EEYDL NFVQ+L
Sbjct  1911  EEYDLGNFVQAL  1922



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01460.1.1 Odorant

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBQ3_DROME  unnamed protein product                                 28.5    1.2  
A1ZBQ4_DROME  unnamed protein product                                 28.5    1.3  
O18397_DROME  unnamed protein product                                 26.9    6.9  


>A1ZBQ3_DROME unnamed protein product
Length=131

 Score = 28.5 bits (62),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  145  NMKKKIYCVNECIGKKQELLNEDGSLNQEKIQAYVTAENFK  185
            + K  + C ++CI  K   ++  G L  +KI++Y    NFK
Sbjct  58   DAKDNVKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFK  98


>A1ZBQ4_DROME unnamed protein product
Length=132

 Score = 28.5 bits (62),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  145  NMKKKIYCVNECIGKKQELLNEDGSLNQEKIQAYVTAENFK  185
            + K  + C ++CI  K   ++  G L  +KI++Y    NFK
Sbjct  59   DAKDNVKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFK  99


>O18397_DROME unnamed protein product
Length=784

 Score = 26.9 bits (58),  Expect = 6.9, Method: Composition-based stats.
 Identities = 13/42 (31%), Positives = 22/42 (52%), Gaps = 0/42 (0%)

Query  155  ECIGKKQELLNEDGSLNQEKIQAYVTAENFKRRLAERFGHRW  196
            E +G + +++NE  +L +    A + A N     AE  GH+W
Sbjct  173  ESLGSRTKIVNERATLFRITSNAMINAGNDYLHTAEAQGHKW  214



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01470.1.1 Transcription

Length=156
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DICH_DROME  unnamed protein product                                   162     2e-49
Q9VUD1_DROME  unnamed protein product                                 157     1e-47
M9PFG6_DROME  unnamed protein product                                 158     2e-47


>DICH_DROME unnamed protein product
Length=382

 Score = 162 bits (410),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)

Query  27   EQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSEISKRLGAEWKLLTEMEKRPFIDEAKRL  86
            E HIKRPMNAFMVWSR+QRR+IA DNPKMHNSEISKRLGAEWKLL E EKRPFIDEAKRL
Sbjct  139  EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRL  198

Query  87   RAMHMKEHPDYKYRPRRKPKTP  108
            RA+HMKEHPDYKYRPRRKPK P
Sbjct  199  RALHMKEHPDYKYRPRRKPKNP  220


>Q9VUD1_DROME unnamed protein product
Length=388

 Score = 157 bits (398),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 79/87 (91%), Gaps = 1/87 (1%)

Query  21   SHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSEISKRLGAEWKLLTEMEKRPFI  80
            SH N    HIKRPMNAFMVWSR QRRK+A DNPKMHNSEISKRLGAEWKLLTE +KRPFI
Sbjct  113  SHHN-SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFI  171

Query  81   DEAKRLRAMHMKEHPDYKYRPRRKPKT  107
            DEAKRLRA+HMKEHPDYKYRPRRKPKT
Sbjct  172  DEAKRLRALHMKEHPDYKYRPRRKPKT  198


>M9PFG6_DROME unnamed protein product
Length=407

 Score = 158 bits (399),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 0/80 (0%)

Query  28   QHIKRPMNAFMVWSRIQRRKIALDNPKMHNSEISKRLGAEWKLLTEMEKRPFIDEAKRLR  87
             HIKRPMNAFMVWSR QRRK+A DNPKMHNSEISKRLGAEWKLLTE +KRPFIDEAKRLR
Sbjct  119  DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLR  178

Query  88   AMHMKEHPDYKYRPRRKPKT  107
            A+HMKEHPDYKYRPRRKPKT
Sbjct  179  ALHMKEHPDYKYRPRRKPKT  198



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01480.1.1 Carboxylic

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24201_DROME  unnamed protein product                                 221     7e-65
Q9VIB5_DROME  unnamed protein product                                 221     1e-64
Q24195_DROME  unnamed protein product                                 216     1e-62


>Q24201_DROME unnamed protein product
Length=556

 Score = 221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 160/517 (31%), Positives = 246/517 (48%), Gaps = 67/517 (13%)

Query  39   GKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCPQI  98
            G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C Q 
Sbjct  24   GQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWEG-------VRDCSQP  75

Query  99   FDASSNIE-VLTSTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSS  157
             D +  ++ V    E  EDCLYLNVYT     NV   +A     PV+ +IHGG F +G +
Sbjct  76   KDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIGEA  127

Query  158  HS--MTPHYLLEKDVVLVTIQYRLGILGFLSLETNE--IPGNMGFLDMLLALEWVNDHIR  213
            +     P Y +++DVVLVTIQYRLG LGF+SL++ E  +PGN G  D +LAL+W+ ++  
Sbjct  128  NREWYGPDYFMKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCA  187

Query  214  SFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDDLFHRAIIQSGSGLCDWSFENETGMGRQ  273
            SF GD NC+T+ G+SAGGA+  + + +   +  LFHR I+QSGS +C W++  +      
Sbjct  188  SFGGDPNCITVFGESAGGASTHYMMLTDQTQ-GLFHRGILQSGSAICPWAYNGDITHNPY  246

Query  274  FIEDLGCRLDNVDDSFVAECLRRKSLSDLFKTYYSM--------EYGGKFCQAVKQTHGK  325
             I  L       +D  V E L+     DL +   ++        +   +F  +++     
Sbjct  247  RIAKLVGYKGEDNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFRFGPSLEPFSTP  306

Query  326  KRFLTETPEESFAKGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLA  385
            +  +++ P+E        ++P+ +G T +EG         +LW   +           L 
Sbjct  307  ECVISKPPKEMMKTAWSNSIPMFIGNTSYEG---------LLWVPEV----------KLM  347

Query  386  HQFMEYTRLDVSAIVSHLVETQYFSQNY----ATMKDVIPAMSDLAGLAVLKSC-----V  436
             Q ++        I   L+ T+   +      A ++DV    S+      +  C     V
Sbjct  348  PQVLQQLDAGTPFIPKELLATEPSKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFV  407

Query  437  FHTARLLSSMH-----NSTFLYSFHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWD  491
            F   R++ S H        + Y + F       F YR     R   GV+H+DDL Y F  
Sbjct  408  FPALRVVHSRHAYAAGAPVYFYRYDFDSE-ELIFPYRIMRMGRGVKGVSHADDLSYQFSS  466

Query  492  ---PTMPLNDREQKQARTMVDLWTNFATYGYPFSEDV  525
                 +P   RE +     V +WT FA  G P+SE +
Sbjct  467  LLARRLPKESREYRNIERTVGIWTQFAATGNPYSEKI  503


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 162/517 (31%), Positives = 246/517 (48%), Gaps = 67/517 (13%)

Query  39   GKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCPQI  98
            G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C Q 
Sbjct  40   GQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWER-------VRDCSQP  91

Query  99   FDASSNIE-VLTSTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSS  157
             D +  ++ V    E  EDCLYLNVYT     NV   +A     PV+ +IHGG F +G +
Sbjct  92   KDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIGEA  143

Query  158  HS--MTPHYLLEKDVVLVTIQYRLGILGFLSLETNE--IPGNMGFLDMLLALEWVNDHIR  213
            +     P Y +++DVVLVTIQYRLG LGF+SL++ E  +PGN G  D +LAL+W+ ++  
Sbjct  144  NREWYGPDYFMKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCA  203

Query  214  SFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDDLFHRAIIQSGSGLCDWSFENETGMGRQ  273
            SF GD NC+T+ G+SAGGA+  + + +   +  LFHR I+QSGS +C W++  +      
Sbjct  204  SFGGDPNCITVFGESAGGASTHYMMLTDQTQ-GLFHRGILQSGSAICPWAYNGDITHNPY  262

Query  274  FIEDLGCRLDNVDDSFVAECLRRKSLSDLFKTYYSM----EYGGK----FCQAVKQTHGK  325
             I  L       +D  V E L+     DL +   ++    E   K    F  +++     
Sbjct  263  RIAKLVGYKGEDNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFAFGPSLEPFSTP  322

Query  326  KRFLTETPEESFAKGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLA  385
            +  +++ P+E        ++P+ +G T +EG         +LW   +           L 
Sbjct  323  ECVISKPPKEMMKTAWSNSIPMFIGNTSYEG---------LLWVPEV----------KLM  363

Query  386  HQFMEYTRLDVSAIVSHLVETQYFSQNY----ATMKDVIPAMSDLAGLAVLKSC-----V  436
             Q ++        I   L+ T+   +      A ++DV    S+      +  C     V
Sbjct  364  PQVLQQLDAGTPFIPKELLATEPSKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFV  423

Query  437  FHTARLLSSMH-----NSTFLYSFHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWD  491
            F   R++ S H        + Y + F       F YR     R   GV+H+DDL Y F  
Sbjct  424  FPALRVVHSRHAYAAGAPVYFYRYDFDSE-ELIFPYRIMRLGRGVKGVSHADDLSYQFSS  482

Query  492  ---PTMPLNDREQKQARTMVDLWTNFATYGYPFSEDV  525
                 +P   RE +     V +WT FA  G P+SE +
Sbjct  483  LLARRLPKESREYRNIERTVGIWTQFAATGNPYSEKI  519


>Q24195_DROME unnamed protein product
Length=554

 Score = 216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 153/503 (30%), Positives = 250/503 (50%), Gaps = 47/503 (9%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            K G+VRG    + + K   ++F+GIPYA PPVG +RF++P+P +PW   LN T+ + +  
Sbjct  26   KYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPM  85

Query  97   QIFDASSNIEVLTSTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVG-  155
            Q      N+ +L   E  EDCL+LNVY   +         S+K  PVI +I+GG F+ G 
Sbjct  86   Q-----RNM-LLGIVEGSEDCLHLNVYVKALK--------SEKPLPVIVWIYGGGFQKGE  131

Query  156  -SSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETN--EIPGNMGFLDMLLALEWVNDHI  212
             S    +P Y ++K VV V I YRL  LGFLSL+    ++PGN G  D ++AL W++ +I
Sbjct  132  ASRDIYSPDYFMKKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNI  191

Query  213  RSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDDLFHRAIIQSGSGLCDWSFENETGMGR  272
              FNGD N +TLMG+SAG A+V   +T+   R  LFH+AI+QSG  L +W    +     
Sbjct  192  AQFNGDPNNITLMGESAGSASVHVMMTTEQTR-GLFHKAIMQSGCALSEWVESPDNNWAF  250

Query  273  QFIEDLGCRLDNVDD---SFVAECLRRKSLS--------DLFKTYYSMEYGGKFCQAVKQ  321
            +  ++LG   D  D    SF+++   R+  +        D  +++    +G      ++ 
Sbjct  251  RLAQNLGYMGDEKDADVLSFLSKVSARQIAAIDQDVINLDEVRSFLLFAFG----PVIEP  306

Query  322  THGKKRFLTETPEESFAKGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKV  381
                     + P++  ++    ++PV++G    EG    ++V +  W    ++NF +   
Sbjct  307  YETDHCVWPKRPKDLLSEAWGNDIPVIVGGNSFEGLFSYQLVRKDPW---ALKNFHNI--  361

Query  382  QDLAHQFMEYTRLDVSAIVSHLVETQYFSQNYATMKDVIPAMSDLAGLAVLKSC-VFHTA  440
              L  +  E + L+   ++   ++  YF+       ++  A++  +   +      F  A
Sbjct  362  --LPREVRETSSLEGQDLLVRRLKQLYFNNEMQESMEMFEALNIFSHRQIWHDTHRFILA  419

Query  441  RLLSSMHNSTFLYSFHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWDPTMPLNDR-  499
            R   +    T+LY F F      + + R         GVAH+D+L YLF++      D+ 
Sbjct  420  RQSYAPKTPTYLYRFDFDS--PHFNQXRRLVCGDRIRGVAHADELSYLFYNIIASKLDKS  477

Query  500  --EQKQARTMVDLWTNFATYGYP  520
              E K    MV +WT+FA+ G P
Sbjct  478  SMEYKTIERMVGMWTSFASSGNP  500



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01490.1.1 Venom

Length=330
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BMT7_DROME  unnamed protein product                                 66.2    5e-12
A1ZA98_DROME  unnamed protein product                                 66.2    5e-12
GLT_DROME  unnamed protein product                                    53.9    6e-08


>Q9BMT7_DROME unnamed protein product
Length=574

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 111/250 (44%), Gaps = 18/250 (7%)

Query  15   NVDDSFVAECLRRKSLSDLFKT-----YYSMEYGGKFCQAVKQTHGKKRFLTETPEESFA  69
            N+    + + LRR + + L        Y+ +++   F   V++      FL   P +  A
Sbjct  270  NLSTVKLTKALRRINATKLLNAGDGLKYWDVDHMTNFRPVVEEGLEVDAFLNAHPMDMLA  329

Query  70   KGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLAHQFMEYT---RLD  126
            +G   ++P+LLG    EG+     V  +L ++ + ++F + +  +L  + +E+      D
Sbjct  330  QGMPTSIPLLLGTVPGEGAV---RVVNILGNETLRQSF-NLRFDELLQELLEFPASFSQD  385

Query  127  VSAIVSHLVETQYFSQNYATMKDVIPAMSDLAGLAVLKSCVFHTA-RLLSSMHNSTFLYS  185
                +  L+   YF   +   +  +    +L      K  +++T  + +    N  +LYS
Sbjct  386  RREKMMDLLVEVYFQGQHEVNELTVQGFMNLISDRGFKQPLYNTIHKNVCHTPNPVYLYS  445

Query  186  FHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWDPTM----PLNDREQKQARTMVDL  241
            F+++G  +    Y   N +   +GV H DDL+YLF  P +      N  E K   + VD 
Sbjct  446  FNYQGPLSYASAYTSANVTG-KYGVVHCDDLLYLFRSPLLFPDFQRNSTEAKVIHSFVDY  504

Query  242  WTNFATYGYP  251
            + +FA +G P
Sbjct  505  FVHFAKFGKP  514


>A1ZA98_DROME unnamed protein product
Length=579

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 111/250 (44%), Gaps = 18/250 (7%)

Query  15   NVDDSFVAECLRRKSLSDLFKT-----YYSMEYGGKFCQAVKQTHGKKRFLTETPEESFA  69
            N+    + + LRR + + L        Y+ +++   F   V++      FL   P +  A
Sbjct  275  NLSTVKLTKALRRINATKLLNAGDGLKYWDVDHMTNFRPVVEEGLEVDAFLNAHPMDMLA  334

Query  70   KGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLAHQFMEYT---RLD  126
            +G   ++P+LLG    EG+     V  +L ++ + ++F + +  +L  + +E+      D
Sbjct  335  QGMPTSIPLLLGTVPGEGAV---RVVNILGNETLRQSF-NLRFDELLQELLEFPASFSQD  390

Query  127  VSAIVSHLVETQYFSQNYATMKDVIPAMSDLAGLAVLKSCVFHTA-RLLSSMHNSTFLYS  185
                +  L+   YF   +   +  +    +L      K  +++T  + +    N  +LYS
Sbjct  391  RREKMMDLLVEVYFQGQHEVNELTVQGFMNLISDRGFKQPLYNTIHKNVCHTPNPVYLYS  450

Query  186  FHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWDPTM----PLNDREQKQARTMVDL  241
            F+++G  +    Y   N +   +GV H DDL+YLF  P +      N  E K   + VD 
Sbjct  451  FNYQGPLSYASAYTSANVTG-KYGVVHCDDLLYLFRSPLLFPDFQRNSTEAKVIHSFVDY  509

Query  242  WTNFATYGYP  251
            + +FA +G P
Sbjct  510  FVHFAKFGKP  519


>GLT_DROME unnamed protein product
Length=1026

 Score = 53.9 bits (128),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 42/140 (30%), Positives = 68/140 (49%), Gaps = 21/140 (15%)

Query  142  QNYATMKDVIPAMSDLAGLAVLKSCVFHTARLLSSMHNS-----TFLYSFHFKGRFTKYF  196
            +  A+++ V P      GL  L + + + A +++S+  S      +LY+F ++G   ++ 
Sbjct  437  EQTASLQTVAP------GLLELSNYILYRAPVINSISQSYRSVPAYLYTFDYRGEHHRFG  490

Query  197  EYRDKNDSRFPHGV--AHSDDLIYLFWDP--TMPLNDREQKQARTMVDLWTNFATYGYPF  252
               +      P GV  + SDD +YLF  P     LN  ++  +R +V +W NFAT G P 
Sbjct  491  HLSNP----LPFGVDASLSDDSVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVP-  545

Query  253  SEDVPDWQPVANDSLGPFLR  272
            +     W P A    GPFLR
Sbjct  546  NPSSGVW-PQATSEYGPFLR  564



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01500.1.1 Carboxylic

Length=243
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24201_DROME  unnamed protein product                                 151     1e-42
Q9VIB5_DROME  unnamed protein product                                 151     1e-42
Q24195_DROME  unnamed protein product                                 148     1e-41


>Q24201_DROME unnamed protein product
Length=556

 Score = 151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 123/200 (62%), Gaps = 22/200 (11%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            + G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C 
Sbjct  22   EYGQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWEG-------VRDCS  73

Query  97   QIFDASSNIE-VLTSTEALEDCLYLNVYTPMISSNVNQTEASQKLFPVIFYIHGGSFRVG  155
            Q  D +  ++ V    E  EDCLYLNVYT    +NV   +A     PV+ +IHGG F +G
Sbjct  74   QPKDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIG  125

Query  156  SSHS--MTPHYLLEKDVVLVTIQYRLGYWVSFLSLETNE--IPGNMGFLDMLLALEWVND  211
             ++     P Y +++DVVLVTIQYRLG  + F+SL++ E  +PGN G  D +LAL+W+ +
Sbjct  126  EANREWYGPDYFMKEDVVLVTIQYRLGA-LGFMSLKSPELNVPGNAGLKDQVLALKWIKN  184

Query  212  HIRSFNGDKNCVTLMGQSAG  231
            +  SF GD NC+T+ G+SAG
Sbjct  185  NCASFGGDPNCITVFGESAG  204


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 123/200 (62%), Gaps = 22/200 (11%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            + G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C 
Sbjct  38   EYGQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWER-------VRDCS  89

Query  97   QIFDASSNIE-VLTSTEALEDCLYLNVYTPMISSNVNQTEASQKLFPVIFYIHGGSFRVG  155
            Q  D +  ++ V    E  EDCLYLNVYT    +NV   +A     PV+ +IHGG F +G
Sbjct  90   QPKDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIG  141

Query  156  SSHS--MTPHYLLEKDVVLVTIQYRLGYWVSFLSLETNE--IPGNMGFLDMLLALEWVND  211
             ++     P Y +++DVVLVTIQYRLG  + F+SL++ E  +PGN G  D +LAL+W+ +
Sbjct  142  EANREWYGPDYFMKEDVVLVTIQYRLGA-LGFMSLKSPELNVPGNAGLKDQVLALKWIKN  200

Query  212  HIRSFNGDKNCVTLMGQSAG  231
            +  SF GD NC+T+ G+SAG
Sbjct  201  NCASFGGDPNCITVFGESAG  220


>Q24195_DROME unnamed protein product
Length=554

 Score = 148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 119/199 (60%), Gaps = 19/199 (10%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            K G+VRG    + + K   ++F+GIPYA PPVG +RF++P+P +PW   LN T+ + +  
Sbjct  26   KYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPM  85

Query  97   QIFDASSNIEVLTSTEALEDCLYLNVYTPMISSNVNQTEASQKLFPVIFYIHGGSFRVG-  155
            Q      N+ +L   E  EDCL+LNVY   +         S+K  PVI +I+GG F+ G 
Sbjct  86   Q-----RNM-LLGIVEGSEDCLHLNVYVKALK--------SEKPLPVIVWIYGGGFQKGE  131

Query  156  -SSHSMTPHYLLEKDVVLVTIQYRLGYWVSFLSLETN--EIPGNMGFLDMLLALEWVNDH  212
             S    +P Y ++K VV V I YRL   + FLSL+    ++PGN G  D ++AL W++ +
Sbjct  132  ASRDIYSPDYFMKKPVVFVAINYRLAA-LGFLSLKDPKLDVPGNAGLKDQVMALRWISQN  190

Query  213  IRSFNGDKNCVTLMGQSAG  231
            I  FNGD N +TLMG+SAG
Sbjct  191  IAQFNGDPNNITLMGESAG  209



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01510.1.1 Unknown

Length=93
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960G6_DROME  unnamed protein product                                 26.9    1.6  
Q8IPN1_DROME  unnamed protein product                                 26.6    2.2  
Q9VN51_DROME  unnamed protein product                                 26.6    2.2  


>Q960G6_DROME unnamed protein product
Length=2409

 Score = 26.9 bits (58),  Expect = 1.6, Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 20/38 (53%), Gaps = 1/38 (3%)

Query  44  RMTFRI-RRELLEMEQYHGKNTFVFKNDTKMQTTYLSQ  80
           +M F + +R  L   Q H  +   F  + ++QTTY SQ
Sbjct  9   QMAFSVSQRSCLPSHQVHSSDRVQFWQEVQVQTTYTSQ  46


>Q8IPN1_DROME unnamed protein product
Length=1226

 Score = 26.6 bits (57),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  17   SDSKTEKG--QITGAAGTMNSMKNFGLKQRMTFRIRRELLEMEQYHGKNTFVFKNDTKMQ  74
            ++ K++KG   I  ++    S+ +   KQR TF + +   E E+   + TF  +N+   +
Sbjct  639  TEDKSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCMENENPRR  698

Query  75   TTYLSQ  80
            T  + Q
Sbjct  699  TFCMQQ  704


>Q9VN51_DROME unnamed protein product
Length=1227

 Score = 26.6 bits (57),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  17   SDSKTEKG--QITGAAGTMNSMKNFGLKQRMTFRIRRELLEMEQYHGKNTFVFKNDTKMQ  74
            ++ K++KG   I  ++    S+ +   KQR TF + +   E E+   + TF  +N+   +
Sbjct  639  TEDKSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCMENENPRR  698

Query  75   TTYLSQ  80
            T  + Q
Sbjct  699  TFCMQQ  704



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01520.1.1 Unknown

Length=113
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5LJN5_DROME  unnamed protein product                                 27.7    1.2  
Q9U3Y5_DROME  unnamed protein product                                 26.2    5.2  


>Q5LJN5_DROME unnamed protein product
Length=4559

 Score = 27.7 bits (60),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/49 (31%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  3     IRRIVYDFRETRKHQGSSLPYLFSKVKRMPEGLRSLGAFPVDNGDFDIV  51
             +R+  Y+F++T   Q + LP  + KVKR+    + L A P+ +   D++
Sbjct  1249  LRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIA-PIQSYQVDLI  1296


>Q9U3Y5_DROME unnamed protein product
Length=4559

 Score = 26.2 bits (56),  Expect = 5.2, Method: Composition-based stats.
 Identities = 14/49 (29%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  3     IRRIVYDFRETRKHQGSSLPYLFSKVKRMPEGLRSLGAFPVDNGDFDIV  51
             +R+  Y+F++T   Q + LP  + KVKR+    + L A P+ +   +++
Sbjct  1249  LRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIA-PIQSYQVNLI  1296



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01530.1.1 Unknown

Length=90
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VK46_DROME  unnamed protein product                                 32.0    0.021
Q8WSN4_DROME  unnamed protein product                                 25.4    4.7  
GNBP1_DROME  unnamed protein product                                  25.0    7.0  


>Q9VK46_DROME unnamed protein product
Length=264

 Score = 32.0 bits (71),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  33  MSQFYQPGS--GQMP-QDSSFSFDMPDQYGSELNFQNF  67
           MSQF  P    G  P  D+S++FDMP ++G ELNFQ F
Sbjct  1   MSQFGGPNDFYGSAPSADASYNFDMP-EFGQELNFQTF  37


>Q8WSN4_DROME unnamed protein product
Length=720

 Score = 25.4 bits (54),  Expect = 4.7, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 15/22 (68%), Gaps = 1/22 (5%)

Query  38   QPGSGQMP-QDSSFSFDMPDQY  58
            +PGSGQMP Q S FS  + + Y
Sbjct  659  EPGSGQMPLQVSQFSIFLKNVY  680


>GNBP1_DROME unnamed protein product
Length=494

 Score = 25.0 bits (53),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 25/49 (51%), Gaps = 9/49 (18%)

Query  47  DSSFSFDMPDQYGSEL---------NFQNFPGQGQANFGVSDPNLGYDT  86
           ++ FS  +PD+ G ++         NF +F  +GQ N  +++P  G  T
Sbjct  31  ETGFSVSIPDEEGVKVVAFNVNRNRNFTSFINEGQYNVRLTEPQNGRWT  79



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01540.1.1 Protein

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLP1_DROME  unnamed protein product                                   116     6e-32
A0JL24_DROME  unnamed protein product                                 117     5e-31
Q0E8F8_DROME  unnamed protein product                                 117     7e-31


>SLP1_DROME unnamed protein product
Length=322

 Score = 116 bits (291),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 0/78 (0%)

Query  40   KPPYSYASLIRLAISNAPQGRMTLNEIYQFITHTFPYYREANAGWKNSIRHNLSLNKCFT  99
            KPPYSY +LI +AI ++P+ R+TLN IYQ++ + FPY++    GW+NSIRHNLSLNKCFT
Sbjct  120  KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFT  179

Query  100  KVARPKDDPGKGSYWAID  117
            K+ R  DDPGKG+YW +D
Sbjct  180  KIPRSYDDPGKGNYWILD  197


>A0JL24_DROME unnamed protein product
Length=654

 Score = 117 bits (294),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 82/130 (63%), Gaps = 14/130 (11%)

Query  40   KPPYSYASLIRLAISNAPQGRMTLNEIYQFITHTFPYYR-EANAGWKNSIRHNLSLNKCF  98
            KPPYSYA LI  AIS AP  ++TL+ IY FI   +PYYR E N GW+NSIRHNLSLN+ F
Sbjct  447  KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYF  506

Query  99   TKVARPKDDPGKGSYWAIDYNHTAD--DGPSKKKVK-----------LPRVSPYSPVECN  145
             KVAR +D+PGKGS+W ID +  A   D   KK+ +           +PR +P SP   +
Sbjct  507  IKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMD  566

Query  146  NSNSSSDVHN  155
            NS  SS + +
Sbjct  567  NSRESSPLQD  576


>Q0E8F8_DROME unnamed protein product
Length=740

 Score = 117 bits (293),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 82/130 (63%), Gaps = 14/130 (11%)

Query  40   KPPYSYASLIRLAISNAPQGRMTLNEIYQFITHTFPYYR-EANAGWKNSIRHNLSLNKCF  98
            KPPYSYA LI  AIS AP  ++TL+ IY FI   +PYYR E N GW+NSIRHNLSLN+ F
Sbjct  447  KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYF  506

Query  99   TKVARPKDDPGKGSYWAIDYNHTAD--DGPSKKKVK-----------LPRVSPYSPVECN  145
             KVAR +D+PGKGS+W ID +  A   D   KK+ +           +PR +P SP   +
Sbjct  507  IKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMD  566

Query  146  NSNSSSDVHN  155
            NS  SS + +
Sbjct  567  NSRESSPLQD  576



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01550.1.1 Protein

Length=281
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SY87_DROME  unnamed protein product                                 149     1e-44
Q9VHT3_DROME  unnamed protein product                                 147     5e-44
Q2XYI8_DROME  unnamed protein product                                 129     2e-37


>Q8SY87_DROME unnamed protein product
Length=178

 Score = 149 bits (375),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 117/187 (63%), Gaps = 14/187 (7%)

Query  96   NIRHNWYQTEKQVVVDALIKQAKAETTQVNIDQNSVDIVVTLDPSSSTQHRLHLNLYRPI  155
            ++RH+WYQ+E +VV+  L+K A  +   V I Q  V +       ++  + L L L  PI
Sbjct  2    SVRHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHM-------TADGYELDLKLLHPI  54

Query  156  DPTTSSFRILGTKIEVKLAKTSDERWSDLEAKEETKAPSAPKTPYKRDWDKVA---QQIE  212
                SS++   TK+E+ LAK +  RW +LE        +AP  P  ++WD++    ++I+
Sbjct  55   VVERSSYKAFSTKVEITLAKETGIRWENLEEA----IVAAPVKPKAKNWDQLVSEEEKID  110

Query  213  DEKKEGEAALNELFQKIYGEGSDEVRKAMNKSFLESGGTVLSTNWDEVKRSTVDIKPPEG  272
            D++ +GEAAL  LF+KIY   S EV+KAMNKSF ESGGTVLSTNW+EV +  V +KPP G
Sbjct  111  DKEAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNG  170

Query  273  LEYKKWD  279
             E+++W+
Sbjct  171  TEFREWE  177


>Q9VHT3_DROME unnamed protein product
Length=178

 Score = 147 bits (370),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 117/187 (63%), Gaps = 14/187 (7%)

Query  96   NIRHNWYQTEKQVVVDALIKQAKAETTQVNIDQNSVDIVVTLDPSSSTQHRLHLNLYRPI  155
            ++RH+WYQ+E +VV+  L+K A  +   V I Q  V +       ++  + L L L  PI
Sbjct  2    SVRHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHM-------TADGYELDLKLLHPI  54

Query  156  DPTTSSFRILGTKIEVKLAKTSDERWSDLEAKEETKAPSAPKTPYKRDWDKVA---QQIE  212
                SS++   TK+E+ LAK +  RW +LE        +AP  P  ++WD++    ++I+
Sbjct  55   VVERSSYKAFSTKVEITLAKETGIRWENLEEA----IVAAPVKPKAKNWDQLVSEEEKID  110

Query  213  DEKKEGEAALNELFQKIYGEGSDEVRKAMNKSFLESGGTVLSTNWDEVKRSTVDIKPPEG  272
            +++ +GEAAL  LF+KIY   S EV+KAMNKSF ESGGTVLSTNW+EV +  V +KPP G
Sbjct  111  EKEAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNG  170

Query  273  LEYKKWD  279
             E+++W+
Sbjct  171  TEFREWE  177


>Q2XYI8_DROME unnamed protein product
Length=165

 Score = 129 bits (325),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 106/176 (60%), Gaps = 14/176 (8%)

Query  102  YQTEKQVVVDALIKQAKAETTQVNIDQNSVDIVVTLDPSSSTQHRLHLNLYRPIDPTTSS  161
            YQ+E +VV+  L+K A  +   V I Q  V +       ++  + L L L  PI    SS
Sbjct  1    YQSETKVVITVLLKNAVDKNYAVEITQKRVHM-------TADGYELDLKLLHPIVVERSS  53

Query  162  FRILGTKIEVKLAKTSDERWSDLEAKEETKAPSAPKTPYKRDWDKVA---QQIEDEKKEG  218
            ++   TK+E+ LAK +  RW +LE        +AP  P  ++WD++    ++I++++ +G
Sbjct  54   YKAFSTKVEITLAKETGIRWENLEEA----IVAAPVKPKAKNWDQLVSEEEKIDEKEAKG  109

Query  219  EAALNELFQKIYGEGSDEVRKAMNKSFLESGGTVLSTNWDEVKRSTVDIKPPEGLE  274
            EAAL  LF+KIY   S EV+KAMNKSF ESGGTVLSTNW+EV +  V +KPP G E
Sbjct  110  EAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNGTE  165



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01560.1.1 Collagen

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CO4A1_DROME  unnamed protein product                                  165     5e-44
Q9VMV5_DROME  unnamed protein product                                 119     8e-29
O18407_DROME  unnamed protein product                                 115     2e-27


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 153/341 (45%), Positives = 179/341 (52%), Gaps = 32/341 (9%)

Query  93   RDSYNRANESSSYYPGRDR-TPYNRTYYERDNFLVVNQRGDSANCTPKCFAEKGSKGAQG  151
            +DS    N +   +P  D     +     R +    N     A C PKC AEKG++G  G
Sbjct  36   QDSVKHYNRNEPKFPIDDSYDIVDSAGVARGDLPPKNCTAGYAGCVPKCIAEKGNRGLPG  95

Query  152  EPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPG  211
              G TG+ G+ GFPG EG  G+KGQ+G P   GP GQ+GD G+ G PG  G  G+ G  G
Sbjct  96   PLGPTGLKGEMGFPGMEGPSGDKGQKGDP---GPYGQRGDKGERGSPGLHGQAGVPGVQG  152

Query  212  IAGLPGAPGL---DGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPAL-TGIHNKG  267
             AG PGAPG+   DGC+G DG PGL GL G  GPRG+ G  G KGEKGEPA   G + KG
Sbjct  153  PAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKG  212

Query  268  QKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGVGFE-----  322
            +KGEP   G  G  G+ G  G PGE G +GD GP G  GP G  G KG  G         
Sbjct  213  EKGEP---GWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKP  269

Query  323  GAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSG  382
            GA G KG KGEP    P    KP+          +GP GD G KG+       GL G  G
Sbjct  270  GAPGIKGEKGEPASSFPV---KPTHT-------VMGPRGDMGQKGEP------GLVGRKG  313

Query  383  TPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRK  423
             PG +   G  G  GEKGLPG PG RGR G  GPP    +K
Sbjct  314  EPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQK  354


 Score = 118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 152/295 (52%), Gaps = 35/295 (12%)

Query  145   GSKGAQGEPGLTGMPGQ---------QGFPGGEGSPGEKGQRGPPG-------PSGPQGQ  188
             G +G +GEPGL+G+PG          QGF G  G  GE+G RG PG         G +G 
Sbjct  1171  GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGS  1230

Query  189   KGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGL  248
             +G+ G TG+ G  G  G+ G  G+AG  G  GL G  G  G  G+PG +G +GPRG  G 
Sbjct  1231  QGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGY  1290

Query  249   PG--DKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPG  306
             PG   KGEKG P           G PG +G  G  G PG IG  G PG  G+ G +G PG
Sbjct  1291  PGVTIKGEKGLP-----------GRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPG  1339

Query  307   PYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANT-PTGFVGPAGDKGD  365
             P GP G KG    G  G+ G  G  G PG PG  G+  P   +      GF G  GDKGD
Sbjct  1340  PIGPAGSKGER--GLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGD  1397

Query  366   KGDEGP---PGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
             +G +GP   PG  G +GD+G PG     G  G PGE+G  GP G  GRDG  G P
Sbjct  1398  RGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLP  1452


 Score = 108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 144/383 (38%), Positives = 171/383 (45%), Gaps = 97/383 (25%)

Query  130  RGDSANCTPKCFAE-KGSKGAQGEPGLTGM------PGQQGFPGGEGSPGEKGQRGPPGP  182
            +GD       C A  KG KG  G PG+ G       PG++G+PG  G  G  GQ GPPG 
Sbjct  563  KGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGE  622

Query  183  SGPQGQKGDMGKTGQ---------------------PGFPGINGIQGFPGIAGLPGAP--  219
             G  G+ G  G TG+                     PG PG  G+QGF G  GLPG P  
Sbjct  623  KGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGP  682

Query  220  ----GLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTG----------IHN  265
                G  G  G  G+PG  G  G  G  G+PG+PG    KGEP   G             
Sbjct  683  KGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQS-IKGEPGFHGRDGAKGDKGSFGR  741

Query  266  KGQKGEPGADGID-------GARGMPGDIGPPGEPGP------------KGDMGPIGPPG  306
             G+KGEPG+  +D       G +G PG  G PG PG             KG+ GP GPPG
Sbjct  742  SGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPG  801

Query  307  P------YGPKGEKGNDG-VGFEGAKGDKGFKGEPGPPGPPG-NGKPSLLQANTPTGFVG  358
                    GP+GEKGN G VG  G  G  G +G PG  G PG  G+P + +   P G  G
Sbjct  802  VEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPG-PMGPPG  860

Query  359  PAGDKGDKGDEGPPGPQGL------------RGDSGTPGDQCRPGE------------PG  394
              G +G+KGD GP GP G             RGD+G PG   RPG              G
Sbjct  861  LNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAG  920

Query  395  LPGEKGLPGPPGLRGRDGFAGPP  417
            + G  G+PG  G+RGRDG  G P
Sbjct  921  VAGPPGVPGIDGVRGRDGAKGEP  943


 Score = 106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 148/432 (34%), Positives = 181/432 (42%), Gaps = 142/432 (33%)

Query  126   VVNQRGDSANCTPKCFA-------------EKGSKGAQGEPGLTGMPGQQG---------  163
             +V ++GD     P   A               G+KG  G PGL GMPG +G         
Sbjct  906   IVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDG  965

Query  164   ---FPGGEGSPGEKGQRGPPGPSGPQGQKG---------------------------DMG  193
                F G  G+PG++G  G PG SG +G KG                           D G
Sbjct  966   PKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQG  1025

Query  194   KTGQPGFPGINGI------QGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPG  247
               G PG  G++G+      QGFPG+ G PG PG     G  G PG  GL G  GP G PG
Sbjct  1026  LAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG  1085

Query  248   LPGDK--------------------------------GEKGEPALTGIHNK-GQKGEPGA  274
              PG+K                                GEKGE  L G+  + G+KG  GA
Sbjct  1086  WPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGA  1145

Query  275   DGIDGARGM---------------PGDIGPPGE------PGPKGDMGPI------GPPGP  307
              GI GA GM               PGD G  GE      PG KG+ GP+      G PGP
Sbjct  1146  PGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGP  1205

Query  308   YGPKGEKGNDGV--------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGP  359
              G +G +G  G+        G +G++G++G+ GE G  G  G            TG  G 
Sbjct  1206  KGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGL-----------TGPAGV  1254

Query  360   AGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLP-----GEKGLPGPPGLRGRDGFA  414
             AG KGD+G +GPPG  GL G  G  GD    GE G P     GEKGLPG PG  GR G  
Sbjct  1255  AGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLI  1314

Query  415   GPPAPLVRKEIP  426
             G P  +  + +P
Sbjct  1315  GAPGLIGERGLP  1326


 Score = 103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 172/360 (48%), Gaps = 72/360 (20%)

Query  144   KGSKGAQGEPGLTGMPGQQGF------PGGEGSPGEKGQRGPPGPSGPQG---QKGDMGK  194
             +G KG+QGE G TG  G+QG        G  G+ G++G +GPPG SG  G    KGD+G 
Sbjct  1225  RGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGP  1284

Query  195   TGQPGFPG--INGIQGFPGI------AGLPGAPGL---DGCNGTDGSPGLPGLEGPMGP-  242
              G+ G+PG  I G +G PG        GL GAPGL    G  G  G PGL GL GP+GP 
Sbjct  1285  RGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPA  1344

Query  243   -----RGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKG  297
                  RG  G PG  G+ G P   G+     KG+ G  G  G RG+ G  G  G+ G +G
Sbjct  1345  GSKGERGLAGSPGQPGQDGFPGAPGL-----KGDTGPQGFKGERGLNGFEGQKGDKGDRG  1399

Query  298   DMGPIGPPGPYGPKGE------KGNDG-------VGFEGAKGDKGFKGEPGPPGPPGNGK  344
               GP G PG  G KG+       GNDG        GF G KG  G  G PG PG    G+
Sbjct  1400  LQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQ--KGE  1457

Query  345   PSLLQA------------NTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPG-  391
             P +L              N P G  G  G++G  G +G  G +G RG  G  G+  RPG 
Sbjct  1458  PGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGP  1517

Query  392   --EPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIPVTKVFQDYLAG-LDSRESQGRGV  448
               + G PGE+G  G  GL G+ G  G PAP             DYL G L +R SQ   V
Sbjct  1518  KGDRGEPGERGYEGAIGLIGQKGEPGAPAPAAL----------DYLTGILITRHSQSETV  1567


 Score = 101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 128/315 (41%), Positives = 153/315 (49%), Gaps = 68/315 (22%)

Query  144   KGSKGAQGEPGL-------TGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTG  196
             KG +G +G+PGL        G  G QG  G  G  GE+G+RG  GP+G  G KGD G  G
Sbjct  1206  KGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQG  1265

Query  197   QPGFPGINGI------------QGFPGIA-----GLPGAPGLDGCNGTDGSPGLPGLEGP  239
              PG  G+NGI             G+PG+      GLPG PG +G  G  G+PGL      
Sbjct  1266  PPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGL------  1319

Query  240   MGPRGFPGLPGDKGEKGEPALTGIHN-KGQKGEPGADGIDGARGMPGDIGPPGEPGPKGD  298
             +G RG PGL       GEP L G+    G  G  G  G+ G+ G PG  G PG PG KGD
Sbjct  1320  IGERGLPGL------AGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGD  1373

Query  299   MGPIGPPGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVG  358
              GP       G KGE+G +G  FEG KGDKG +G  GP G PG     L+     TG+ G
Sbjct  1374  TGP------QGFKGERGLNG--FEGQKGDKGDRGLQGPSGLPG-----LVGQKGDTGYPG  1420

Query  359   PAGDKG---DKGDEGPPGPQGLRGDSGTPGDQCRPGEPGL---------------PGEKG  400
               G+ G     G+ G  GP+G  G  GTPG   + GEPG+                G KG
Sbjct  1421  LNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKG  1480

Query  401   LPGPPGLRGRDGFAG  415
              PG PG RG  G  G
Sbjct  1481  EPGRPGERGLIGIQG  1495


 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 143/301 (48%), Gaps = 27/301 (9%)

Query  129  QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEK--GQRGPPGPSGPQ  186
            Q+GD+          KG  G  G PGL G  G++GF G  G+PG+   G+ G PG +G  
Sbjct  483  QKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAP  542

Query  187  GQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFP  246
            GQKGD G+ G PG  G  GI+G  G        G  G  GT G PG+PG +G  GP G  
Sbjct  543  GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGER  602

Query  247  GLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPG  306
            G PG++G  G          GQ G PG  G DG  G+PG  G PG+P    D+  I P  
Sbjct  603  GYPGERGHDG--------INGQTGPPGEKGEDGRTGLPGATGEPGKPALC-DLSLIEPL-  652

Query  307  PYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDK  366
                KG+KG  G    GAKG +GFKG  G PG PG             GF G  G  G  
Sbjct  653  ----KGDKGYPGA--PGAKGVQGFKGAEGLPGIPG--------PKGEFGFKGEKGLSGAP  698

Query  367  GDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIP  426
            G++G PG  G  G  G PG   + GEPG  G  G  G  G  GR G  G P      EI 
Sbjct  699  GNDGTPGRAGRDGYPGIPGQSIK-GEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK  757

Query  427  V  427
            +
Sbjct  758  M  758


 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 145/300 (48%), Gaps = 42/300 (14%)

Query  151  GEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQ------GQKGDMGKTGQPGFPGIN  204
            G PG  G PGQ+G  G  G+PG+KG  G  G  G +      G KGD G +G PG PG +
Sbjct  534  GTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKD  593

Query  205  GIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTGIH  264
            G +G PG  G PG  G DG NG  G PG  G +G  G      LPG  GE G+PAL  + 
Sbjct  594  GARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTG------LPGATGEPGKPALCDLS  647

Query  265  N----KGQKGEPGA------DGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEK  314
                 KG KG PGA       G  GA G+PG  GP GE G KG+ G  G PG  G  G  
Sbjct  648  LIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRA  707

Query  315  GNDGV---------------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQ--ANTPTGFV  357
            G DG                G +GAKGDKG  G  G  G PG+     ++  A    G  
Sbjct  708  GRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEP  767

Query  358  GPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
            G  G  G  G++G PG +G  G  G  G Q   G PG+ G +GL GP G +G  G  G P
Sbjct  768  GQTGMPGPPGEDGSPGERGYTGLKGNTGPQ---GPPGVEGPRGLNGPRGEKGNQGAVGVP  824


 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 144/296 (49%), Gaps = 37/296 (13%)

Query  143   EKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQP---G  199
             ++G  G  G  G+ G  G+QG  G  G PGEKG  G PG  G  G  G  G  G P   G
Sbjct  1109  DQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVG  1168

Query  200   FPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLP-------GDK  252
             +PG  G +G PG++GLPG  G  G  G  G  G PG +G  G RG PGLP       GDK
Sbjct  1169  YPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDK  1228

Query  253   GEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKG  312
             G +GE   TG   KG++GE G  G  G  G  GD G  G PG  G  G  G  G  GP+G
Sbjct  1229  GSQGERGYTG--EKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRG  1286

Query  313   EKGNDGVGFEGAKG---------DKGFKGEPGPPGPPG----NGKPSLLQANTPTGFVGP  359
             E G  GV  +G KG          +G  G PG  G  G     G+P L+    P   +GP
Sbjct  1287  EIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGP---IGP  1343

Query  360   AGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAG  415
             AG KG++         GL G  G PG    PG PGL G+ G  G  G RG +GF G
Sbjct  1344  AGSKGER---------GLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEG  1390


 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 152/328 (46%), Gaps = 52/328 (16%)

Query  130   RGDS----ANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGP  185
             RGD+     +  P    EKG  G  G  G+ G PG  G  G  G  G KG+ G PG  G 
Sbjct  892   RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGM  951

Query  186   QGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGP---  242
              G KGD G  G  G  G  G+ G PG  G  G PG+ G  G  G+ GL G +GP+G    
Sbjct  952   PGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGP  1011

Query  243   ---------------------RGFPGLPGDKGEKGEPALTG-------IHNKGQKGEPGA  274
                                  +G  G+PG+KG +G P L G          KGQKGEPG 
Sbjct  1012  PGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGP  1071

Query  275   DGIDGARGMPGDIGPPGE--------------PGPKGDMGPIGPPGPYGPKGEKGNDGV-  319
              G+ G  G  G  G PGE              PG KGD G  G  G  G  GEKG  G+ 
Sbjct  1072  SGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQ  1131

Query  320   GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRG  379
             G  G  G+KG  G PG PG P  G   L  A    G VG  GD+GDKG+ G  G  GL+G
Sbjct  1132  GVWGQPGEKGSVGAPGIPGAP--GMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKG  1189

Query  380   DSGTPGDQCRPGEPGLPGEKGLPGPPGL  407
             ++G  G Q   G PG  GE+G+ G PGL
Sbjct  1190  ETGPVGLQGFTGAPGPKGERGIRGQPGL  1217


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 166/346 (48%), Gaps = 75/346 (22%)

Query  117  TYYERDNFLVVNQRGDSAN-CTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKG  175
            ++  +    V+  RGD      P     KG  G +G+ GL G  G++G PGG   PG++G
Sbjct  284  SFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGG---PGDRG  340

Query  176  QRGPPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLP-------------------  216
            ++G  GP G  GQKGD G+ G  G PG  G +G PG AG                     
Sbjct  341  RQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTP  400

Query  217  ------------GAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTGIH  264
                        GAPG  G NG DG   LPG +G  G +G  GLPG  G +G P      
Sbjct  401  GPPGPKGPRGYVGAPGPQGLNGVDG---LPGPQGYNGQKGGAGLPGRPGNEGPP------  451

Query  265  NKGQKGEPGADGIDGARGMPGDIGPPGEPGP------KGDMGPIGPPGPYGPKGEKGNDG  318
              G+KGE G  G++G +G    IGP G PGP      KGD G  G    YG +G KG+ G
Sbjct  452  --GKKGEKGTAGLNGPKG---SIGPIGHPGPPGPEGQKGDAGLPG----YGIQGSKGDAG  502

Query  319  V----GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGP  374
            +    G +G+KG++GFKG  G PG    G+P         G  G AG  G KGD G PG 
Sbjct  503  IPGYPGLKGSKGERGFKGNAGAPGDSKLGRP---------GTPGAAGAPGQKGDAGRPGT  553

Query  375  QGLRGDSGTPGD---QCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
             G +GD G  GD   +C     G  G+KG  G PG+ G+DG  GPP
Sbjct  554  PGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPP  599


 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 166/356 (47%), Gaps = 81/356 (23%)

Query  143   EKGSKGAQGEPGLTGMPGQ---QGFPGGEGSPG------EKGQRGPPGPSG---------  184
             ++G  GA G+ GL GMPG+   QGFPG +G PG      EKGQ+G PGPSG         
Sbjct  1023  DQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAG  1082

Query  185   --------------------PQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGC  224
                                 P G+KGD G++G  G  GING +G  G+ G+ G PG  G 
Sbjct  1083  TPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGS  1142

Query  225   NGTDGSPGLPGLEGPMGPRGFP---GLPGDKGEKGEPALTGIHN-KGQKGEPGADGIDGA  280
              G  G PG PG++G  G  G P   G PGD+G+KGEP L+G+   KG+ G  G  G  GA
Sbjct  1143  VGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGA  1202

Query  281   RGMPGDIGPPGEPG-------PKGDMGPIGPPGPYGPKGEKGNDGV----GFEGAKGDKG  329
              G  G+ G  G+PG        +GD G  G  G  G KGE+G  G+    G  GAKGD+G
Sbjct  1203  PGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRG  1262

Query  330   FKGEPGPPGPPGNGKPSLLQANTPTGFVGPAG--DKGDKGDEGPPGPQG---------LR  378
              +G PG  G   NG P       P G +G  G   KG+KG  G PG  G         L 
Sbjct  1263  LQGPPGASGL--NGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLI  1320

Query  379   GDSGTPGDQCRPG---------------EPGLPGEKGLPGPPGLRGRDGFAGPPAP  419
             G+ G PG    PG               E GL G  G PG  G  G  G  G   P
Sbjct  1321  GERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGP  1376


 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 145/299 (48%), Gaps = 53/299 (18%)

Query  144   KGSKGAQGEPGLTGMPGQQGFPGG----EGSPGEKGQRGPPGPS---GPQGQKGDMGKTG  196
              G  GA+G+ G  G  G++G PG     E     KG +G PG +   GP G+ G  G+ G
Sbjct  727   HGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERG  786

Query  197   QPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKG  256
               G  G  G QG PG+ G  G  G  G  G  G+ G+PG  G  G RG PG  G  G +G
Sbjct  787   YTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRG  846

Query  257   EPALT--------GIHN-KGQKGE---------PGADGI------DGARGMPGDIGPPGE  292
             EP ++        G++  +G+KG+         PGADG        G  G+PG  G PG 
Sbjct  847   EPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGI  906

Query  293   PGPKGDMGPIGPPGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANT  352
              G KGD+GPIGP G  GP G  G DGV     +G  G KGEPG P               
Sbjct  907   VGEKGDVGPIGPAGVAGPPGVPGIDGV-----RGRDGAKGEPGSP---------------  946

Query  353   PTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRD  411
               G VG  G+KGD+G  G  GP+G  G +G PG +   G PG+ G KG  G  GL G D
Sbjct  947   --GLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGND  1003


 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 114/234 (49%), Gaps = 33/234 (14%)

Query  137   TPKCFAEKGSKGAQGEPGLTGMPG---------QQGFPGGEGSPGEKGQRGPPGPSGPQG  187
              P    E+G  G  GEPGL G+PG         ++G  G  G PG+ G  G PG  G  G
Sbjct  1316  APGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTG  1375

Query  188   QKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGP---RG  244
              +G  G+ G  GF G  G +G  G+ G  G PGL G  G  G PGL G +GP+G    RG
Sbjct  1376  PQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERG  1435

Query  245   FP---------GLPGDKGEKGEPALT----------GIHNKGQKGEPGADGIDGARGMPG  285
             F          G PG  G+KGEP +                G KGEPG  G  G  G+ G
Sbjct  1436  FTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQG  1495

Query  286   DIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGP  339
             + G  GE G  G+ G +G PGP G +GE G    G+EGA G  G KGEPG P P
Sbjct  1496  ERGEKGERGLIGETGNVGRPGPKGDRGEPGER--GYEGAIGLIGQKGEPGAPAP  1547


 Score = 36.6 bits (83),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 63/139 (45%), Gaps = 35/139 (25%)

Query  126   VVNQRGDSANCTPKCFAEKGSKGAQGEPGLTG------------MPGQQGFPGG------  167
             +V Q+GD+    P      G  GA GE G TG            +PGQ+G PG       
Sbjct  1409  LVGQKGDTG--YPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGP  1466

Query  168   ------------EGSPGEKGQRGPPGPSGPQGQKGD---MGKTGQPGFPGINGIQGFPGI  212
                         +G PG  G+RG  G  G +G+KG+   +G+TG  G PG  G +G PG 
Sbjct  1467  KGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGE  1526

Query  213   AGLPGAPGLDGCNGTDGSP  231
              G  GA GL G  G  G+P
Sbjct  1527  RGYEGAIGLIGQKGEPGAP  1545


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 161/324 (50%), Gaps = 49/324 (15%)

Query  140   CFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPS-----GPQGQKGDMGK  194
               A  G KG  GE GLT   G  G+P   G+PG KGQRGP G S     G  G+KG++G 
Sbjct  1015  VAAYSGIKGDDGESGLT---GPIGYP---GAPGAKGQRGPVGDSQPALDGVAGRKGEVGS  1068

Query  195   TGQPGFPGINGIQGFPGIAGLPGA---PGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGD  251
              G  G PG +G++G  G  GLPG    PG  G  G  G PG  G+ G  G  GFPG  G 
Sbjct  1069  PGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGP  1128

Query  252   KGEKGEPALTGIHNK-GQKGEPGADGIDGA----------------------------RG  282
             KG +GE  + G+  + GQ G+ G  G+ G                             RG
Sbjct  1129  KGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRG  1188

Query  283   MPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDG----VGFEGAKGDKGFKGEPGPPG  338
               GD G  GE G +GDMGPIG  GP G KGE+G+ G    +GF+GA+G KGF+G+ GP G
Sbjct  1189  FTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRG  1248

Query  339   PPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQ--CRPGEPGLP  396
             PPG   P+        G  G AG  G  G +G PGP G  G +G  G +     G PG  
Sbjct  1249  PPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQ  1308

Query  397   GEKGLPGPPGLRGRDGFAGPPAPL  420
             G+ G PG PG  GR G  GP   L
Sbjct  1309  GDVGFPGAPGHNGRHGLIGPKGEL  1332


 Score = 107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 154/332 (46%), Gaps = 53/332 (16%)

Query  125  LVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPG------EKGQRG  178
            LV     D   C       KG KG  G PG  G+PG +G  G  G PG      EKG  G
Sbjct  22   LVSVTLADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVG  81

Query  179  PPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEG  238
              G  G +G +GD+G  G+ G+PGI G  G PG    PG  G+DGC+G  G  G  G  G
Sbjct  82   EYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGT---PGPRGIDGCDGRPGMQGPSGAPG  138

Query  239  PMGPRGFPGLPGDKGEKGEPALTGIHNKGQKG------------------EPGADGIDGA  280
              G RG PG PG +G  GE    GI++KG KG                  + G+ G  G 
Sbjct  139  QNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGY  198

Query  281  RGMPGDIGPPGEPGPKGDMG-----PIGPPGPYGPKGEKGNDGVG-------FEGAKGDK  328
             G+ G+ G PG PGPKGD G     P    GP G KGE G+   G        +G KG  
Sbjct  199  AGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYV  258

Query  329  GFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTP---G  385
            G +G+ GP GP G             G VG  G  G +G+ G PG +G  G  G P   G
Sbjct  259  GLQGDEGPQGPTGE-----------QGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFG  307

Query  386  DQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
            D+   G PG  G  GL G PG RG DGF G P
Sbjct  308  DKGMKGAPGWTGADGLDGSPGERGEDGFTGMP  339


 Score = 102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 147/410 (36%), Positives = 174/410 (42%), Gaps = 98/410 (24%)

Query  126   VVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGP  185
              +  RG+  +  P      G  GA+G PG TG  GQQG PG  G  GE G  G  G  G 
Sbjct  744   AIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQ  803

Query  186   QGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGF  245
             +G  G     G+ G PG +GI+GFPG  G PG  GL    G  G  G+ G +GP G  G 
Sbjct  804   RGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGL---AGRPGPKGVKGEQGPDGAVGQ  860

Query  246   PGLPGDKGEKGEPALTGIHN---------------KGQKGE-------------------  271
              GLPG+KG++G+  +                    KGQKGE                   
Sbjct  861   TGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFS  920

Query  272   --------------PGADGIDGARGMPGDIGPPGEP---GPKGDMGPIGPPGPYGPKGEK  314
                           PG+ GI G  GM G+IG  GE    G +GD+GP GP G +GPKG  
Sbjct  921   GRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLS  980

Query  315   GNDG-VGFEGAKGDKGFKGEPGPPGPPGN----------------------------GKP  345
             G+DG  G+ GA G  G KGE G PG PG                             G P
Sbjct  981   GDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAP  1040

Query  346   SLLQANTPTGFVGPA--GDKGDKGDEGPPGPQGL---------RGDSGTPGDQCRPGEPG  394
                    P G   PA  G  G KG+ G PGP GL         RGD G PG Q RPGEPG
Sbjct  1041  GAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPG  1100

Query  395   LPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIPVTKVFQDYLAGLDSRESQ  444
               G  G PG  G+ G  G  G P P    + P     +  + GLD R  Q
Sbjct  1101  AKGLGGYPGRNGINGLKGATGFPGP----QGPKGPQGESGVVGLDGRNGQ  1146


 Score = 102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 135/398 (34%), Positives = 168/398 (42%), Gaps = 110/398 (28%)

Query  132   DSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRG------------P  179
             +  N         G +G  G  GL G+PG  G PG  G  GE G+RG            P
Sbjct  908   NGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGP  967

Query  180   PGPSGPQGQKGDMGKTGQPGFPGINGI------QGFPGIAGLPGAPGLDGCNGTDGSPGL  233
              GP+G  G KG  G  G  G+PG NG+       G PG  G PGA G+   +G  G  G 
Sbjct  968   RGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGE  1027

Query  234   PGLEGPMGPRGFPGLPGDKGEKG-----EPALTGIH-NKGQKGEPGADGI---------D  278
              GL GP+   G+PG PG KG++G     +PAL G+   KG+ G PG +G+          
Sbjct  1028  SGLTGPI---GYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQR  1084

Query  279   GARGMPGDIGPPGEPGPK------------GDMGPIGPPGPYGPKGEKGNDGV-------  319
             G RG+PG  G PGEPG K            G  G  G PGP GPKG +G  GV       
Sbjct  1085  GDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRN  1144

Query  320   -------------------------------------------GFEGAKGDKGFKGEPGP  336
                                                        GF G +G +G +GE G 
Sbjct  1145  GQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGD  1204

Query  337   PGPPG-------NGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGL-----RGDSGTP  384
              GP G        G+   +      GF G  G KG +GD+GP GP G+     +GD G  
Sbjct  1205  MGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA  1264

Query  385   GDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVR  422
             G   R G PG  G+KG PGPPG  G +G  G   P ++
Sbjct  1265  GLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQ  1302


 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 126/332 (38%), Positives = 157/332 (47%), Gaps = 39/332 (12%)

Query  106   YPGRDRTPYNRTYYE--RDNFLVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQG  163
              PGR     +R++Y     +  +  +RG+  +  P  F   G  GA+GE G  G  GQ G
Sbjct  1173  IPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFI--GPPGAKGERGDIGYAGQLG  1230

Query  164   FPGGEGSPGEKGQRGPPGP-----------------SGPQGQKGDMGKTGQPGFPGINGI  206
             F G EG  G +G +GP GP                  G  G+ G  G+ G PG PG NG 
Sbjct  1231  FDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGP  1290

Query  207   QGFPGIAG--LPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEP--ALTG  262
              G  G  G  + G PG  G  G  G+PG  G  G +GP+G  G  G +GE+GE   A+ G
Sbjct  1291  NGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVG  1350

Query  263   ----IHNKGQKGEPGADGIDGARGMPG------DIGPPGEPGPKGDMGPIGPPGPYGPKG  312
                 I + G +GEPG DG  G +G PG       +G PG  GP GD G  G  G  G  G
Sbjct  1351  RQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVG  1410

Query  313   EKGNDGVGFEGAKGDKGFKGEPGPPGPPGN----GKPSLLQANTPTGFVGPAGDKGDKGD  368
              KG  GV +  +    G +GEPG  G  G     G P L+      G VG  GD+G+ G 
Sbjct  1411  PKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGY  1470

Query  369   EGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKG  400
              G  GPQG RGD G  G    PG  GLPG +G
Sbjct  1471  TGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG  1502


 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 136/291 (47%), Gaps = 35/291 (12%)

Query  155  LTGMPGQQGFPGGEGSPGEKGQRGP------PGPSGPQGQKGDMGKTGQPGFPGINGIQG  208
              G+PG  G+ G  G PGEKG RG        GP GP+GQ+GD G  G  G  G  G+ G
Sbjct  502  FRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTG  561

Query  209  FPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGE--KGEPALTGIHNK  266
              G+ GL G PG  G  G  G  G+PG  G +G  G  G   + G   KGE   TG  + 
Sbjct  562  PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTG--DS  619

Query  267  GQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV-------  319
            G +G+ G DG  G  G  G  G  GE G +GD G  G  G  G  G  G DG        
Sbjct  620  GHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATT  679

Query  320  ---------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANT----PTGFVGPAGDKGDK  366
                     G++G KG++G  G+ G  G  G   P  +  NT      G+ GP G KG K
Sbjct  680  PKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAK  739

Query  367  GDEGPPGPQGLRGDSG-----TPGDQCRPGEPGLPGEKGLPGPPGLRGRDG  412
            G++G  G +G  GD G      PG     G PG  G+ G  G PGL GRDG
Sbjct  740  GEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDG  790


 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 148/378 (39%), Gaps = 101/378 (27%)

Query  129   QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ  188
             QRG   +  P      G KG  G PG  G+PG+ G          KGQRG  G  G QG+
Sbjct  1045  QRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGL---------KGQRGDRGLPGQQGR  1095

Query  189   KGDMGKTGQPGFPGINGIQGFPGIAGLPG------------APGLDGCNGTDGSPGLPGL  236
              G+ G  G  G+PG NGI G  G  G PG              GLDG NG  G  G  GL
Sbjct  1096  PGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGL  1155

Query  237   ----------------------------------------------EGPMGPRGFPGLPG  250
                                                           +G MGP GF G PG
Sbjct  1156  IGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPG  1215

Query  251   DKGEKGEPALTG------------------------IHNKGQKGEPGADGIDGARGMPGD  286
              KGE+G+    G                        I    +KG+ G  G+DG  G PG 
Sbjct  1216  AKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGH  1275

Query  287   IGPPGEPGPKGDMGPIGPPGPYGPK-----GEKGNDGVGFEGAKGDKGFKGEPGPPGPPG  341
              G  G PGP G+ GP G  G  GP+     G +G+  VGF GA G  G  G  GP G  G
Sbjct  1276  FGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGD--VGFPGAPGHNGRHGLIGPKGELG  1333

Query  342   NGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDS---GTPGDQCRPGEPGLPGE  398
             +      +  +    VG  GD GD G +G PG  G +G+    G PG   R G PG  G 
Sbjct  1334  DMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGP  1393

Query  399   KGLPGPPGLRGRDGFAGP  416
              G  G  G+ G DG  GP
Sbjct  1394  TGDAGWGGIDGMDGLVGP  1411


 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 150/348 (43%), Gaps = 73/348 (21%)

Query  141  FAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGK------  194
              + G  G +G+ G  G  G+ G  G +G  GE GQRG  G +G QG+ G+ G+      
Sbjct  613  IGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGA  672

Query  195  ------------TGQPGFPGI------NGIQGFPGIAGLP------------------GA  218
                         G+PG+ GI      +G  GF G+ G P                  G 
Sbjct  673  PGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGP  732

Query  219  PGLDGCNGTDGSPGLPG-----------LEGPMGPRGFPGLPGDKGEKGEPAL-------  260
             G+ G  G  G+ GL G           + GP+G +G+PG  GD G++G P L       
Sbjct  733  KGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEP  792

Query  261  ---TGIHNKGQKGEPGADGI---------DGARGMPGDIGPPGEPGPKGDMGPIGPPGPY  308
                GI  KGQ+G PG + I          G +G PGD+G PG+ G  G  GP G  G  
Sbjct  793  GLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQ  852

Query  309  GPKGEKGNDGV-GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKG  367
            GP G  G  G+ G +G +GD           P  NG+ +   A    G VG  G  G  G
Sbjct  853  GPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNG  912

Query  368  DEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAG  415
             +G  G  G RG  G  G Q  PG PG+PG  G+ G  G RG  G+ G
Sbjct  913  AKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNG  960


 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 136/305 (45%), Gaps = 38/305 (12%)

Query  145  GSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTG--------  196
            GS G +G  GLTG  G QG    +G+PG  G +G PGP+G  G+ G +G  G        
Sbjct  549  GSHGNRGAIGLTGPRGVQGL---QGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEV  605

Query  197  ---QPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKG  253
               + G  G  G  G  G  G  G  G DG +G+ G  G  G  G  G  G+ G  G+ G
Sbjct  606  GSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPG  665

Query  254  EKGEPALTGIHNKGQK----GEPGADGIDGARGMPGDI---GPPGEPGPKGDMGPIGPPG  306
              G     G +    K    GEPG DGI G RG  GD    G  GEP P       G PG
Sbjct  666  RDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPG  725

Query  307  PYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDK  366
              G  G KG  G   +G +G  G +GE G  GP G   P  + A    G+ GP GD G +
Sbjct  726  EDGYTGPKGVKGA--KGEQGAIGLRGEIGDRGPAGEVIPGPVGAK---GYPGPTGDYGQQ  780

Query  367  GDEGPPGPQ---------GLRGDSGTPGDQCRPGE---PGLPGEKGLPGPPGLRGRDGFA  414
            G  G PG           G +G  G PG +   GE   PG  G KG PG  G  G+ G A
Sbjct  781  GAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLA  840

Query  415  GPPAP  419
            G P P
Sbjct  841  GRPGP  845


 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 162/370 (44%), Gaps = 80/370 (22%)

Query  130  RGDSANCTPKCFAEKGSKGAQGEPG------------LTGMPGQQGFPGGEGSPGEKGQR  177
            +GD+   +   ++  G  GA+GEPG            L G  G  G  G EG  G  G++
Sbjct  214  KGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQ  273

Query  178  GPPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSP------  231
            G  G +G  G +G++G  G+ G PG +G  G  G  G+ GAPG  G +G DGSP      
Sbjct  274  GAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGED  333

Query  232  ---GLPGLEGPMGPRGF------PGLPGDKGEKGEPALTG----------------IHNK  266
               G+PG++G  GP G         LPG  G +G+    G                I   
Sbjct  334  GFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLA  393

Query  267  GQKGEPGADGIDG-----ARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV--  319
            GQ G+PG +G  G      RG  GD G  G PGP+G  G  G PG YG  GE G + V  
Sbjct  394  GQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGP  453

Query  320  ----------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTP--------------TG  355
                      G EG +GD+G  G PG  G PG G   +    +                G
Sbjct  454  KGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNG  513

Query  356  FVGPAGDKGDKGDE------GPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRG  409
              G  G+KG +GD+      GP GP+G  GD+G PG     G  GL G +G+ G  G  G
Sbjct  514  LRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG  573

Query  410  RDGFAGPPAP  419
            R G  G P P
Sbjct  574  RAGHKGLPGP  583


 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 124/389 (32%), Positives = 155/389 (40%), Gaps = 99/389 (25%)

Query  122  DNFLVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPG  181
            D+   V +  D+          +G +G QG  G  G  G+ G PG  G  G  G+RG PG
Sbjct  239  DSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPG  298

Query  182  PSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGL------PG  235
              G  G+ GD G  G PG+ G +G+ G PG  G  G  G+ G  G  G PG+        
Sbjct  299  KDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKS  358

Query  236  LEGPMGPRGF------------------------------PGLPGDKG------------  253
            L GP+G +G                               PGL G +G            
Sbjct  359  LPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGD  418

Query  254  --------------EKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDM  299
                          E G P   G+H     GEPG + + G +G PG  G PG  G +GD 
Sbjct  419  YGFIGPPGPQGPPGEAGLPGRYGLH-----GEPGQN-VVGPKGEPGLNGQPGLEGYRGDR  472

Query  300  GPIGPPGPYGPKGEKGN--------DGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQAN  351
            G +G PG  G  GE  N           GF G  GD G+ G  G PG  G     L   +
Sbjct  473  GEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKG-----LRGDD  527

Query  352  TPTGFVGPAGDKGDKGDEGPPG------------PQGLRGDSGTPGDQCRPGEPGLPGEK  399
             P    GP G +G +GD G PG            P+G++G  G PG   R G  GLPG  
Sbjct  528  CPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG---RAGHKGLPGPA  584

Query  400  GLPGPPGLRGR---DGFAGPPAPLVRKEI  425
            G+PG PG  G    DG A     L + EI
Sbjct  585  GIPGEPGKVGAAGPDGKAIEVGSLRKGEI  613


 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 89/172 (52%), Gaps = 16/172 (9%)

Query  129   QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ  188
             +RG+S         + G  G QGEPG  G  G+QG+P   G PG+ G+ G PGP GP   
Sbjct  1340  ERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYP---GLPGKNGRVGAPGPRGP---  1393

Query  189   KGDMGKTGQPGFPGINGIQGFPGIA--------GLPGAPGLDGCNGTDGSPGLPGLEGPM  240
              GD G  G  G  G+ G +G PG+         G  G PGLDG  G +G  G PGL G  
Sbjct  1394  TGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQ  1453

Query  241   GPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGE  292
             G RG  G  GD+GE G     G   +GQ+G+ G  G+ GA G+ G  GP GE
Sbjct  1454  GQRGAVGYRGDQGEVGYTGADG--PQGQRGDKGYMGLTGAPGLRGLPGPQGE  1503


 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 152/424 (36%), Gaps = 150/424 (35%)

Query  138  PKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQ-----------  186
            P    + G  G  G  G+ G  G+ G  G  G+PG+ G RGPPG  G Q           
Sbjct  104  PGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGI  163

Query  187  ---GQKGDMGKT------------------GQPGFPGINGIQGFPGIAG-----------  214
               G KG+ G+T                  G  G+ G+ G +G PG+ G           
Sbjct  164  NSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSEL  223

Query  215  ---LPGAPGL---------------DGCNGTDGSPGLPGLEGPMGPR------GFPGLPG  250
               L G PG                D   G  G  GL G EGP GP       G  GLPG
Sbjct  224  PYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPG  283

Query  251  DKGEKGEPALTG----------IHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMG  300
             +GE G P   G            +KG KG PG  G DG  G PG+ G  G  G  G  G
Sbjct  284  ARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQG  343

Query  301  PIGPPGPY---------GPKGEKGNDG-------------------VGFEGAKGDKGFKG  332
              GPPG Y         GP G +G+ G                   +G  G  GD G  G
Sbjct  344  GAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNG  403

Query  333  EPGPPGPPGNGKPSL-----------------------LQANTPTGFVGPAGDKGDKGDE  369
              GPPG    G+                          L        VGP G+ G  G  
Sbjct  404  SRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQP  463

Query  370  GPPGPQGLRGDSGTPGDQCRPGE----------------PGLPGE------KGLPGPPGL  407
            G  G +G RG+ G PGD+  PGE                 GLPG+      +GLPG  GL
Sbjct  464  GLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGL  523

Query  408  RGRD  411
            RG D
Sbjct  524  RGDD  527


 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 50/96 (52%), Gaps = 2/96 (2%)

Query  324  AKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGT  383
             KG KG  G PGP G PG   P+      P G  GP G+KGD G+ G  G +G RGD G 
Sbjct  40   CKGIKGRMGAPGPIGVPGLEGPA--GDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP  97

Query  384  PGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAP  419
             G+   PG  G  GE G PGP G+ G DG  G   P
Sbjct  98   KGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGP  133


>O18407_DROME unnamed protein product
Length=1761

 Score = 115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 132/324 (41%), Positives = 160/324 (49%), Gaps = 49/324 (15%)

Query  140   CFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPS-----GPQGQKGDMGK  194
               A  G KG  GE GLT   G  G+P   G+PG KGQRGP G S     G  G+KG++G 
Sbjct  1013  VAAYSGIKGDDGESGLT---GPIGYP---GAPGVKGQRGPVGDSQPALDGVAGRKGEVGS  1066

Query  195   TGQPGFPGINGIQGFPGIAGLPGA---PGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGD  251
              G  G PG +G++G  G  GLPG    PG  G  G  G PG  G+ G     GFPG  G 
Sbjct  1067  PGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPGPQGP  1126

Query  252   KGEKGEPALTGIHNK-GQKGEPGADGIDGA----------------------------RG  282
             KG +GE  + G+  + GQ G+ G  G+ G                             RG
Sbjct  1127  KGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRG  1186

Query  283   MPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDG----VGFEGAKGDKGFKGEPGPPG  338
               GD G  GE G +GDMGPIG  GP G KGE+G+ G    +GF+GA+G KGF+G+ GP G
Sbjct  1187  FTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRG  1246

Query  339   PPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQ--CRPGEPGLP  396
             PPG   P+        G  G AG  G  G +G PGP G  G +G  G +     G PG  
Sbjct  1247  PPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQ  1306

Query  397   GEKGLPGPPGLRGRDGFAGPPAPL  420
             G+ G PG PG  GR G  GP   L
Sbjct  1307  GDVGFPGAPGHNGRHGLIGPKGEL  1330


 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 128/332 (39%), Positives = 152/332 (46%), Gaps = 53/332 (16%)

Query  125  LVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPG------EKGQRG  178
            LV     D   C       KG KG  G PG  G+PG +G  G  G PG      EKG  G
Sbjct  22   LVSVTLADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVG  81

Query  179  PPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEG  238
              G  G +G +GD+G  G+ G+PGI G  G PG    PG  G+DGC+G  G  G  G  G
Sbjct  82   EYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGT---PGPRGIDGCDGRPGMQGPSGRPG  138

Query  239  PMGPRGFPGLPGDKGEKGEPALTGIHNKGQKG------------------EPGADGIDGA  280
              G RG PG    +G  GE    GI++KG KG                  + G+ G  G 
Sbjct  139  QNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGY  198

Query  281  RGMPGDIGPPGEPGPKGDMG-----PIGPPGPYGPKGEKGNDGVG-------FEGAKGDK  328
             G+ G+ G PG PGPKGD G     P    GP G KGE G+   G        +G KG  
Sbjct  199  AGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYV  258

Query  329  GFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTP---G  385
            G +G+ GP GP G             G VG  G  G +G+ G PG +G  G  G P   G
Sbjct  259  GLQGDEGPQGPTGE-----------QGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFG  307

Query  386  DQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
            D+   G PG  G  GL G PG RG DGF G P
Sbjct  308  DKGMKGAPGWTGADGLDGSPGERGEDGFTGMP  339


 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 126/332 (38%), Positives = 157/332 (47%), Gaps = 39/332 (12%)

Query  106   YPGRDRTPYNRTYYE--RDNFLVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQG  163
              PGR     +R++Y     +  +  +RG+  +  P  F   G  GA+GE G  G  GQ G
Sbjct  1171  IPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFI--GPPGAKGERGDIGYAGQLG  1228

Query  164   FPGGEGSPGEKGQRGPPGP-----------------SGPQGQKGDMGKTGQPGFPGINGI  206
             F G EG  G +G +GP GP                  G  G+ G  G+ G PG PG NG 
Sbjct  1229  FDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGP  1288

Query  207   QGFPGIAG--LPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEP--ALTG  262
              G  G  G  + G PG  G  G  G+PG  G  G +GP+G  G  G +GE+GE   A+ G
Sbjct  1289  NGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVG  1348

Query  263   ----IHNKGQKGEPGADGIDGARGMPG------DIGPPGEPGPKGDMGPIGPPGPYGPKG  312
                 I + G +GEPG DG  G +G PG       +G PG  GP GD G  G  G  G  G
Sbjct  1349  RQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVG  1408

Query  313   EKGNDGVGFEGAKGDKGFKGEPGPPGPPGN----GKPSLLQANTPTGFVGPAGDKGDKGD  368
              KG  GV +  +    G +GEPG  G  G     G P L+      G VG  GD+G+ G 
Sbjct  1409  PKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGY  1468

Query  369   EGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKG  400
              G  GPQG RGD G  G    PG  GLPG +G
Sbjct  1469  TGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG  1500


 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 132/374 (35%), Positives = 165/374 (44%), Gaps = 98/374 (26%)

Query  144   KGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFPGI  203
             +G  G+ G PGL GM G+ G  G  G  G +G  GP GP+G  G KG  G  G  G+PG 
Sbjct  930   QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGA  989

Query  204   NGI------QGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKG-  256
             NG+       G PG  G PGA G+   +G  G  G  GL GP+   G+PG PG KG++G 
Sbjct  990   NGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPI---GYPGAPGVKGQRGP  1046

Query  257   ----EPALTGIH-NKGQKGEPGADGI---------DGARGMPGDIGPPGEPGPKGDMG--  300
                 +PAL G+   KG+ G PG +G+          G RG+PG  G PGEPG KG  G  
Sbjct  1047  VGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYP  1106

Query  301   ----------PIGPPGPYGPKGEKGNDGV-------------------------------  319
                         G PGP GPKG +G  GV                               
Sbjct  1107  GRNGINGLKAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDE  1166

Query  320   -------------------GFEGAKGDKGFKGEPGPPGPPG-------NGKPSLLQANTP  353
                                GF G +G +G +GE G  GP G        G+   +     
Sbjct  1167  GEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ  1226

Query  354   TGFVGPAGDKGDKGDEGPPGPQGL-----RGDSGTPGDQCRPGEPGLPGEKGLPGPPGLR  408
              GF G  G KG +GD+GP GP G+     +GD G  G   R G PG  G+KG PGPPG  
Sbjct  1227  LGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGEN  1286

Query  409   GRDGFAGPPAPLVR  422
             G +G  G   P ++
Sbjct  1287  GPNGAIGHRGPQIQ  1300


 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 136/291 (47%), Gaps = 35/291 (12%)

Query  155  LTGMPGQQGFPGGEGSPGEKGQRGP------PGPSGPQGQKGDMGKTGQPGFPGINGIQG  208
              G+PG  G+ G  G PGEKG RG        GP GP+GQ+GD G  G  G  G  G+ G
Sbjct  502  FRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAG  561

Query  209  FPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGE--KGEPALTGIHNK  266
              G+ GL G PG  G  G  G  G+PG  G +G  G  G   + G   KGE   TG  + 
Sbjct  562  PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTG--DS  619

Query  267  GQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV-------  319
            G +G+ G DG  G  G  G  G  GE G +GD G  G  G  G  G  G DG        
Sbjct  620  GHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATT  679

Query  320  ---------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANT----PTGFVGPAGDKGDK  366
                     G++G KG++G  G+ G  G  G   P  +  NT      G+ GP G KG K
Sbjct  680  PKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAK  739

Query  367  GDEGPPGPQGLRGDSG-----TPGDQCRPGEPGLPGEKGLPGPPGLRGRDG  412
            G++G  G +G  GD G      PG     G PG  G+ G  G PGL GRDG
Sbjct  740  GEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDG  790


 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 173/418 (41%), Gaps = 123/418 (29%)

Query  144   KGSKGAQGEPGLTGMPGQQG--FPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFP  201
             KG KGA+GE G  G+ G+ G   P GE  PG  G +G PGP+G  GQ+G  G  G+ G P
Sbjct  733   KGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEP  792

Query  202   GINGIQGFPGIAGLPGA------------PGLDGCNGTDGSPGLPGLEGPMGPRGFPGLP  249
             G++G  G+ G  G+PG              G+ G  G  G+PG  GL G  GP+G  G  
Sbjct  793   GLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQ  852

Query  250   GDKGEKGEPALTGIHNKGQKGE--------------------------------------  271
             G  G  G+  L G  NKGQ+G+                                      
Sbjct  853   GPDGAVGQTGLPG--NKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQ  910

Query  272   ----------------------PGADGIDGARGMPGDIGPPGEP---GPKGDMGPIGPPG  306
                                   PG+ GI G  GM G+IG  GE    G +GD+GP GP G
Sbjct  911   NGAKGSIGFSGRRGLLGNLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNG  970

Query  307   PYGPKGEKGNDG-VGFEGAKGDKGFKGEPGPPGPPGN-----------------------  342
              +GPKG  G+DG  G+ GA G  G KGE G PG PG                        
Sbjct  971   EFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTG  1030

Query  343   -----GKPSLLQANTPTGFVGPAGD--KGDKGDEGPPGPQGL---------RGDSGTPGD  386
                  G P +     P G   PA D   G KG+ G PGP GL         RGD G PG 
Sbjct  1031  PIGYPGAPGVKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQ  1090

Query  387   QCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIPVTKVFQDYLAGLDSRESQ  444
             Q RPGEPG  G  G PG  G+ G     G P P    + P     +  + GLD R  Q
Sbjct  1091  QGRPGEPGAKGLGGYPGRNGINGLKAATGFPGP----QGPKGPQGESGVVGLDGRNGQ  1144


 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 124/381 (33%), Positives = 148/381 (39%), Gaps = 98/381 (26%)

Query  126   VVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGP  185
             V  QRG   +  P      G KG  G PG  G+PG+ G          KGQRG  G  G 
Sbjct  1040  VKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGL---------KGQRGDRGLPGQ  1090

Query  186   QGQKGDMGKTGQPGFPGINGIQGFPGIAGLPG------------APGLDGCNGTDGSPGL  233
             QG+ G+ G  G  G+PG NGI G     G PG              GLDG NG  G  G 
Sbjct  1091  QGRPGEPGAKGLGGYPGRNGINGLKAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGP  1150

Query  234   PGL----------------------------------------------EGPMGPRGFPG  247
              GL                                              +G MGP GF G
Sbjct  1151  RGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIG  1210

Query  248   LPGDKGEKGEPALTG------------------------IHNKGQKGEPGADGIDGARGM  283
              PG KGE+G+    G                        I    +KG+ G  G+DG  G 
Sbjct  1211  PPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGR  1270

Query  284   PGDIGPPGEPGPKGDMGPIGPPGPYGPK-----GEKGNDGVGFEGAKGDKGFKGEPGPPG  338
             PG  G  G PGP G+ GP G  G  GP+     G +G+  VGF GA G  G  G  GP G
Sbjct  1271  PGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGD--VGFPGAPGHNGRHGLIGPKG  1328

Query  339   PPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGE  398
               G+      +  +    VG  GD GD G +G PG  G +G+ G PG   + G  G PG 
Sbjct  1329  ELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGP  1388

Query  399   KGLPGPPGLRGRDGFAGPPAP  419
             +G  G  G  G DG  G   P
Sbjct  1389  RGPTGDAGWGGIDGMDGLVGP  1409


 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 132/371 (36%), Positives = 159/371 (43%), Gaps = 91/371 (25%)

Query  138  PKCFAEKGSKGA---QGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPG---PS------GP  185
            P  F +KG KGA    G  GL G PG++G  G  G PG +G  GPPG   PS      GP
Sbjct  303  PGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGP  362

Query  186  QGQKGDM---------------------GKTGQPGFPGINGIQGFPGI------------  212
             G +GD+                     G  GQ G PG+NG +G PG             
Sbjct  363  IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFI  422

Query  213  -----------AGLPGAPGLDG-----CNGTDGSPGL---PGLEGPMGPRGFPGLPGDKG  253
                       AGLPG  GL G       G  G PGL   PGLEG  G RG  GLPGDKG
Sbjct  423  GPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKG  482

Query  254  EKGE-----PALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGE----------------  292
              GE              G +G PG DG  G RG+PG+ G  G+                
Sbjct  483  LPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQE  542

Query  293  -----PGPKGDMGPIGPPGPYGPKGEKGNDG-VGFEGAKGDKGFKGEPGPPGPPGNGKPS  346
                 PG  G+ G IG  GP G +G +GN G  G +G  G  G  GEPG  G  G    +
Sbjct  543  GDTGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKA  602

Query  347  LLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPG  406
            +   +   G +G  GD G +GD G  G +G  G  G+ G++   G+ G  G+ G  G  G
Sbjct  603  IEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDG  662

Query  407  LRGRDGFAGPP  417
              GRDG  G P
Sbjct  663  EPGRDGRDGAP  673


 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 135/273 (49%), Gaps = 31/273 (11%)

Query  143  EKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEK---GQRGPPGPSGPQGQKGDMGKTGQPG  199
            E G  G  G  G TG  G++G  G +GS GE+   GQRG  G +G QG+ G+ G+ G+ G
Sbjct  612  EIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDG  671

Query  200  FPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPA  259
             PG N       + G PG  G+ G  G DG  G  G++G   P       G+ GE G   
Sbjct  672  APGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTG  731

Query  260  LTGIHNKGQKGEPGADGIDGARG--------MPGDIGPPGEPGPKGDMGPIGPPGPYGPK  311
              G+  KG KGE GA G+ G  G        +PG +G  G PGP GD G  G PG  G  
Sbjct  732  PKGV--KGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRD  789

Query  312  GEKGND-GVGFEGAKGDKG---FKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKG  367
            GE G D G+G++G +G  G    +GE GPPG  G             GF G  G  G  G
Sbjct  790  GEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSG-----------IKGFPGDVGAPGQYG  838

Query  368  DEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKG  400
              G PGP+G++G+ G  G     G+ GLPG KG
Sbjct  839  LAGRPGPKGVKGEQGPDG---AVGQTGLPGNKG  868


 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 141/432 (33%), Positives = 177/432 (41%), Gaps = 122/432 (28%)

Query  94    DSYNRANESSSYYPGRDRTPYNRTYYERDNFLVVNQRGDSANCTPKCFAEKGSKGAQGEP  153
             DS +R +       GRD +  ++   ER       QRGD        + + G +G  GEP
Sbjct  618   DSGHRGDTGDDGEKGRDGSDGSKG--ERGE---TGQRGD--------YGDAGYQGRDGEP  664

Query  154   GLTGMPGQQG---------FPGGEGSPGEKGQRGPPGPSGPQGQKGD------MGKTGQP  198
             G  G  G  G           G  G  G KG+RG  G +G +G KG+         TG+P
Sbjct  665   GRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEP  724

Query  199   GFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEP  258
             G  G  G +G  G  G  GA GL G  G  G  G   + GP+G +G+PG  GD G++G P
Sbjct  725   GEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEV-IPGPVGAKGYPGPTGDYGQQGAP  783

Query  259   AL----------TGIHNKGQKGEPGADGI---------DGARGMPGDIGPPGE------P  293
              L           GI  KGQ+G PG + I          G +G PGD+G PG+      P
Sbjct  784   GLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRP  843

Query  294   GPKGDMGPIGPPG-----------------------------------PYGPKGEKGNDG  318
             GPKG  G  GP G                                   P+G KG+KG  G
Sbjct  844   GPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVG  903

Query  319   V----GFEGAKGDKGFKGE----------PGPPGPPG----------------NGKPSLL  348
                  G  GAKG  GF G           PG PG PG                NG+   +
Sbjct  904   SLGQNGQNGAKGSIGFSGRRGLLGNLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDI  963

Query  349   QANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLR  408
                 P G  GP G  GD G +G PG  GL G  G  G+   PG PG PG KG+    G++
Sbjct  964   GPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGN---PGFPGRPGAKGVAAYSGIK  1020

Query  409   GRDGFAGPPAPL  420
             G DG +G   P+
Sbjct  1021  GDDGESGLTGPI  1032


 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 136/307 (44%), Gaps = 35/307 (11%)

Query  143  EKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTG------  196
            + G  G+ G  G  G+ G +G  G +G+PG  G +G PGP+G  G+ G +G  G      
Sbjct  544  DTGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAI  603

Query  197  -----QPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGD  251
                 + G  G  G  G  G  G  G  G DG +G+ G  G  G  G  G  G+ G  G+
Sbjct  604  EVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGE  663

Query  252  KGEKGEPALTGIHNKGQK----GEPGADGIDGARGMPGDI---GPPGEPGPKGDMGPIGP  304
             G  G     G +    K    GEPG DGI G RG  GD    G  GEP P       G 
Sbjct  664  PGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGE  723

Query  305  PGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKG  364
            PG  G  G KG  G   +G +G  G +GE G  GP G   P  + A    G+ GP GD G
Sbjct  724  PGEDGYTGPKGVKGA--KGEQGAIGLRGEIGDRGPAGEVIPGPVGAK---GYPGPTGDYG  778

Query  365  DKGDEGPPGPQ---------GLRGDSGTPGDQCRPGE---PGLPGEKGLPGPPGLRGRDG  412
             +G  G PG           G +G  G PG +   GE   PG  G KG PG  G  G+ G
Sbjct  779  QQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYG  838

Query  413  FAGPPAP  419
             AG P P
Sbjct  839  LAGRPGP  845


 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 162/370 (44%), Gaps = 80/370 (22%)

Query  130  RGDSANCTPKCFAEKGSKGAQGEPG------------LTGMPGQQGFPGGEGSPGEKGQR  177
            +GD+   +   ++  G  GA+GEPG            L G  G  G  G EG  G  G++
Sbjct  214  KGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQ  273

Query  178  GPPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSP------  231
            G  G +G  G +G++G  G+ G PG +G  G  G  G+ GAPG  G +G DGSP      
Sbjct  274  GAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGED  333

Query  232  ---GLPGLEGPMGPRGF------PGLPGDKGEKGEPALTG----------------IHNK  266
               G+PG++G  GP G         LPG  G +G+    G                I   
Sbjct  334  GFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLA  393

Query  267  GQKGEPGADGIDG-----ARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV--  319
            GQ G+PG +G  G      RG  GD G  G PGP+G  G  G PG YG  GE G + V  
Sbjct  394  GQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGP  453

Query  320  ----------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPT--------------G  355
                      G EG +GD+G  G PG  G PG G   +    +                G
Sbjct  454  KGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYG  513

Query  356  FVGPAGDKGDKGDE------GPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRG  409
              G  G+KG +GD+      GP GP+G  GD+G PG     G  GL G +G+ G  G  G
Sbjct  514  LRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAGPRGVQGLQGNPG  573

Query  410  RDGFAGPPAP  419
            R G  G P P
Sbjct  574  RAGHKGLPGP  583


 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 89/172 (52%), Gaps = 16/172 (9%)

Query  129   QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ  188
             +RG+S         + G  G QGEPG  G  G+QG+P   G PG+ G+ G PGP GP   
Sbjct  1338  ERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYP---GLPGKNGRVGAPGPRGP---  1391

Query  189   KGDMGKTGQPGFPGINGIQGFPGIA--------GLPGAPGLDGCNGTDGSPGLPGLEGPM  240
              GD G  G  G  G+ G +G PG+         G  G PGLDG  G +G  G PGL G  
Sbjct  1392  TGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQ  1451

Query  241   GPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGE  292
             G RG  G  GD+GE G     G   +GQ+G+ G  G+ GA G+ G  GP GE
Sbjct  1452  GQRGAVGYRGDQGEVGYTGADG--PQGQRGDKGYMGLTGAPGLRGLPGPQGE  1501


 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 124/389 (32%), Positives = 155/389 (40%), Gaps = 99/389 (25%)

Query  122  DNFLVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPG  181
            D+   V +  D+          +G +G QG  G  G  G+ G PG  G  G  G+RG PG
Sbjct  239  DSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPG  298

Query  182  PSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGL------PG  235
              G  G+ GD G  G PG+ G +G+ G PG  G  G  G+ G  G  G PG+        
Sbjct  299  KDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKS  358

Query  236  LEGPMGPRGF------------------------------PGLPGDKG------------  253
            L GP+G +G                               PGL G +G            
Sbjct  359  LPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGD  418

Query  254  --------------EKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDM  299
                          E G P   G+H     GEPG + + G +G PG  G PG  G +GD 
Sbjct  419  YGFIGPPGPQGPPGEAGLPGRYGLH-----GEPGQN-VVGPKGEPGLNGQPGLEGYRGDR  472

Query  300  GPIGPPGPYGPKGEKGN--------DGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQAN  351
            G +G PG  G  GE  N           GF G  GD G+ G  G PG  G     L   +
Sbjct  473  GEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKG-----LRGDD  527

Query  352  TPTGFVGPAGDKGDKGDEGPPG------------PQGLRGDSGTPGDQCRPGEPGLPGEK  399
             P    GP G +G +GD G PG            P+G++G  G PG   R G  GLPG  
Sbjct  528  CPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAGPRGVQGLQGNPG---RAGHKGLPGPA  584

Query  400  GLPGPPGLRGR---DGFAGPPAPLVRKEI  425
            G+PG PG  G    DG A     L + EI
Sbjct  585  GIPGEPGKVGAAGPDGKAIEVGSLRKGEI  613


 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 127/424 (30%), Positives = 150/424 (35%), Gaps = 150/424 (35%)

Query  138  PKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPS--------------  183
            P    + G  G  G  G+ G  G+ G  G  G PG+ G RGPPG S              
Sbjct  104  PGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGI  163

Query  184  ---GPQGQKG---------------DMGKTGQPGFPGINGIQGFPGIAG-----------  214
               G +G +G               D G  G  G+ G+ G +G PG+ G           
Sbjct  164  NSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSEL  223

Query  215  ---LPGAPGL---------------DGCNGTDGSPGLPGLEGPMGPR------GFPGLPG  250
               L G PG                D   G  G  GL G EGP GP       G  GLPG
Sbjct  224  PYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPG  283

Query  251  DKGEKGEPALTG----------IHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMG  300
             +GE G P   G            +KG KG PG  G DG  G PG+ G  G  G  G  G
Sbjct  284  ARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQG  343

Query  301  PIGPPGPY---------GPKGEKGNDG-------------------VGFEGAKGDKGFKG  332
              GPPG Y         GP G +G+ G                   +G  G  GD G  G
Sbjct  344  GAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNG  403

Query  333  EPGPPGPPGNGKPSL-----------------------LQANTPTGFVGPAGDKGDKGDE  369
              GPPG    G+                          L        VGP G+ G  G  
Sbjct  404  SRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQP  463

Query  370  GPPGPQGLRGDSGTPGDQCRPGE----------------PGLPGE------KGLPGPPGL  407
            G  G +G RG+ G PGD+  PGE                 GLPG+      +GLPG  GL
Sbjct  464  GLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGL  523

Query  408  RGRD  411
            RG D
Sbjct  524  RGDD  527


 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 51/99 (52%), Gaps = 2/99 (2%)

Query  324  AKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGT  383
             KG KG  G PGP G PG   P+      P G  GP G+KGD G+ G  G +G RGD G 
Sbjct  40   CKGIKGRMGAPGPIGVPGLEGPA--GDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP  97

Query  384  PGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVR  422
             G+   PG  G  GE G PGP G+ G DG  G   P  R
Sbjct  98   KGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGR  136



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01570.1.1 Collagen

Length=1536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMV5_DROME  unnamed protein product                                 619     0.0   
O18407_DROME  unnamed protein product                                 610     0.0   
CO4A1_DROME  unnamed protein product                                  534     1e-161


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1539 (45%), Positives = 839/1539 (55%), Gaps = 62/1539 (4%)

Query  4     TRHRY-VIFYVFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGN  62
              RH   ++  V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG 
Sbjct  6     LRHLSGLLGVVYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGP  61

Query  63    PGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGL  122
              GD GP G  GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+
Sbjct  62    AGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGI  121

Query  123   DGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQ  182
             DGC+G  G  G +G PG +G RG  G  GQ+G  G+ GEGGINSKGTKG  G  G PG  
Sbjct  122   DGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGV  181

Query  183   GPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPG  242
             GP G  G+RG  G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG   
Sbjct  182   GPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG---  238

Query  243   PIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQ  302
                 D+         + KG KG  G +GD GP G  GE+G  GR G+       G +G  
Sbjct  239   ----DSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEI  288

Query  303   GREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDR  362
             G  G RGK GKDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  
Sbjct  289   GGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPP  348

Query  363   GIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPK  422
             GIYDP+L K  PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP 
Sbjct  349   GIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP  408

Query  423   GISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGV  482
             G S  GEAG  G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G 
Sbjct  409   GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGY  468

Query  483   QGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDC  542
             +GDRG+ G+ G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC
Sbjct  469   RGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDC  528

Query  543   GFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQG  602
               C  G  G +G+ G+    G PG  G  G +G  G RG  G  G PG  G  G  G  G
Sbjct  529   PVCNAGPRGPRGQEGDT---GYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAG  585

Query  603   IEGPPGPPGAPGKLAPLSRVDIARA--VGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQ  660
             I G PG  GA G       V   R   +GD G  G +G  G +G  G  G  G+K   G+
Sbjct  586   IPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSK---GE  642

Query  661   PGRKGEKGPYGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEPGTPGD  720
              G  G++G YG  G +GRDG PGR+G  G+ G  AT PK YL G+ GYDG+ GE G  GD
Sbjct  643   RGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGD  702

Query  721   MGLKGEAGD----TISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGE  776
              G KG  G+     I       GE GY G        G +GE G  G +G  GD GP GE
Sbjct  703   TGFKGVKGEPNPGQIYDNTGEPGEDGYTG---PKGVKGAKGEQGAIGLRGEIGDRGPAGE  759

Query  777   PGISLQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIFFPGP  836
                 + GP G KG PG  GD+G +GA G  G  G PGL G  G KG RG  G+ +   G 
Sbjct  760   ---VIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEV-IQGE  815

Query  837   PGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDMLP  896
              G PGR G KG PGD G  G  G+ G  G KGV G +G  G  G+TGLPG KG+ GD L 
Sbjct  816   IGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLV  875

Query  897   GYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRGQQGDPGPDGIP  956
             G PG  G PG  G +   G KG  G  G+ G +G  G KGS G  G RG  G+ G  G+P
Sbjct  876   GPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLP  935

Query  957   GRPGRVLHPGATGIPGDKGDIGPPGSTGFVGKPGLQGLPGNKGEQGRRGTPGPVGQMGPP  1016
             G PG    PG  G  G++G+IG  G  G +G  G  G  G KG  G  G  G  G  G P
Sbjct  936   GSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLP  995

Query  1017  GAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGES  1076
             G KG  G+ G  G PG  G +A+SG++GD GE G TGP+GYPG PG  G+ GP+GD   +
Sbjct  996   GRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPA  1055

Query  1077  IDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLNG  1136
             +DG  G  G  G  G NGLPGR G KG  G  G  G +G  GEPG KG  G  G  G+NG
Sbjct  1056  LDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGING  1115

Query  1137  THGWPGEPGPRGPPGVKGEPGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIG  1196
               G  G PGP+GP G +GE G+    GL G  G  GD+GPRG  G  G  G +G+ G++G
Sbjct  1116  LKGATGFPGPQGPKGPQGESGV---VGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVG  1172

Query  1197  LP---ENIIVAT--KGDFGEPGMTGLTGEKGWRGDVGWPGRNGTKGLPGAIGPQGEPGFP  1251
             +P   EN+   +  +G  G+ G+ G  GE+G  G +G+ G  G KG  G IG  G+ GF 
Sbjct  1173  IPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFD  1232

Query  1252  GYQGPKGPVGMRGPPGIPGLTDVMLAERGDPGRDGLPGRDGKPGLPGVKGAPGEYGIDGP  1311
             G +G KG  G +GP G PG+T  + AE+GD G  GL GR G+PG  G KGAPG  G +GP
Sbjct  1233  GAEGLKGFQGDQGPRGPPGIT--LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGP  1290

Query  1312  PGPPGAPGLSRKGNP---GKPGYPGRIVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRPI  1368
              G  G  G   +G P   G  G+PG    G  G  GL G  G+ G  G +GE GE G  I
Sbjct  1291  NGAIGHRGPQIQGPPGPQGDVGFPG--APGHNGRHGLIGPKGELGDMGRQGERGESGYAI  1348

Query  1369  PGPRGQPGLIGIAGT---NGAKGETGPPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGT  1425
              G +G  G IG  G    +GAKGE G PG  G  G  G PG    RG  GD G  G+DG 
Sbjct  1349  VGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGP---RGPTGDAGWGGIDGM  1405

Query  1426  PGEKGFQGEPGDTLAYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGN  1485
              G  G +G+PG T +Y++     R G+ G  G +G  G +G  G  GL G+ G  G  G 
Sbjct  1406  DGLVGPKGQPGVTYSYSM----ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGY  1461

Query  1486  PGPQGSLGQPGDAGPDGRPGSPGPVGFQGIPGAPGLPAP  1524
              G QG +G  G  GP G+ G  G +G  G PG  GLP P
Sbjct  1462  RGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGP  1500


 Score = 310 bits (795),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 483/1330 (36%), Positives = 588/1330 (44%), Gaps = 262/1330 (20%)

Query  60    EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
              G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190   RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97    GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
               +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250   TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154   GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
             G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310   GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206   -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                              RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370   GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235   ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                        G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430   PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285   GR-------------------PGIDGYPGIKGV---KGVQGRE---------GWRGKEGK  313
             G                    PG DGY G++G+   KG++G +         G RG+EG 
Sbjct  485   GEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314   DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
              G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545   TGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374   PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
              G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605   VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429   EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
             E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663   EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467   PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
              PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723   EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526   PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRM-----  574
             PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+      
Sbjct  783   PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  575   ----GEKGSRGPDGKMGP---PGNKGLDGK--------------------HGTQGIEGPP  607
                 G KG +GPDG +G    PGNKG  G                     HG +G +G  
Sbjct  843   PGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEV  902

Query  608   GPPGAPGKLAPLSRVDIA---RAVGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRK  664
             G  G  G+      +  +     +G+ GLQG+ G PG  GLPG++G  G +G  G  GR+
Sbjct  903   GSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQ  962

Query  665   ---------GEKGPYGAPGDEGRDGLPGRNGVPGSKGDP------------ATIPKEYLR  703
                      GE GP G  GD+G DG PG NG+PG KG+                    ++
Sbjct  963   GDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIK  1022

Query  704   GDAGYDGLP---GEPGTPGDMGLKGEAGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPG  760
             GD G  GL    G PG PG  G +G  GD+  +   + G KG  G       PG  G  G
Sbjct  1023  GDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG  1082

Query  761   IPGDKGIPGDSGPIGEPGIS-------LQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPG  813
               GD+G+PG  G  GEPG           G  G KG  G PG  GPKG QG +G+ GL G
Sbjct  1083  QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDG  1142

Query  814   LPGQSGGKGDRGSVG------------------------ESIFFPGPPGTPGRPGSKGEP  849
               GQ G +G RG +G                        +  F+ G  G  G  G +GE 
Sbjct  1143  RNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQ  1202

Query  850   GDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEE------GDMLPGYPGTPG  903
             GD GP+G+ G PG  G +G  G  G  G  G  GL G +G++      G  LP   G  G
Sbjct  1203  GDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEG  1262

Query  904   VPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGP--LGPRGQQGDPGPDGIPGRPGR  961
             V G+ G  G  G  G  G  G PG +G  G  G RGP   GP G QGD G  G PG  GR
Sbjct  1263  VAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGR  1322

Query  962   VLHPGATGIPGDKGDIGPPGSTGF--------VGKPGLQGLPGNKGEQGRRGTPGPVGQM  1013
                 G  G  GD G  G  G +G+        +G  G QG PG  G +G +G PG  G+ 
Sbjct  1323  HGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKN  1382

Query  1014  GPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDL  1073
             G  GA G  G  GDAG+ G DG     GL G KG+PG T        PG  GEPG  G  
Sbjct  1383  GRVGAPGPRGPTGDAGWGGIDG---MDGLVGPKGQPGVTYSYSMA-RPGDRGEPGLDGFQ  1438

Query  1074  GESIDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPG  1133
             GE  DG     G+ G  GF G  G  G +G  G +G  G  G QG+ G KGY GL G PG
Sbjct  1439  GEEGDG-----GAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPG  1493

Query  1134  LNGTHGWPGE  1143
             L G  G  GE
Sbjct  1494  LRGLPGPQGE  1503


>O18407_DROME unnamed protein product
Length=1761

 Score = 610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/1530 (45%), Positives = 833/1530 (54%), Gaps = 63/1530 (4%)

Query  12    YVFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGP  71
              V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG  GD GP G 
Sbjct  15    VVYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGR  70

Query  72    PGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGA  131
              GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+DGC+G  G 
Sbjct  71    AGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGM  130

Query  132   PGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGER  191
              G +G PG +G RG  G   Q+G  G+ GEGGINSKGTKG  G  G PG  GP G  G+R
Sbjct  131   QGPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDR  190

Query  192   GPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQK  251
             G  G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG       D+   
Sbjct  191   GSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG-------DSLSG  243

Query  252   PGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKE  311
                   + KG KG  G +GD GP G  GE+G  GR G+       G +G  G  G RGK 
Sbjct  244   VLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEIGGPGERGKP  297

Query  312   GKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDK  371
             GKDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  GIYDP+L K
Sbjct  298   GKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTK  357

Query  372   IEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAG  431
               PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP G S  GEAG
Sbjct  358   SLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAG  417

Query  432   VDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGV  491
               G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G +GDRG+ G+
Sbjct  418   DYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGL  477

Query  492   QGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPG  551
              G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC  C  G  G
Sbjct  478   PGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRG  537

Query  552   VKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPPG  611
              +G+ G+    G PG  G  G +G  G RG  G  G PG  G  G  G  GI G PG  G
Sbjct  538   PRGQEGD---TGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVG  594

Query  612   APGKLAPLSRVDIARA--VGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRKGEKGP  669
             A G       V   R   +GD G  G +G  G +G  G  G  G+K   G+ G  G++G 
Sbjct  595   AAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSK---GERGETGQRGD  651

Query  670   YGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEPGTPGDMGLKGEAGD  729
             YG  G +GRDG PGR+G  G+ G  AT PK YL G+ GYDG+ GE G  GD G KG  G+
Sbjct  652   YGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGE  711

Query  730   ----TISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGEPGISLQGPT  785
                  I       GE GY G        G +GE G  G +G  GD GP GE    + GP 
Sbjct  712   PNPGQIYDNTGEPGEDGYTG---PKGVKGAKGEQGAIGLRGEIGDRGPAGE---VIPGPV  765

Query  786   GFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIFFPGPPGTPGRPGS  845
             G KG PG  GD+G +GA G  G  G PGL G  G KG RG  G+ +   G  G PGR G 
Sbjct  766   GAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEV-IQGEIGPPGRSGI  824

Query  846   KGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDMLPGYPGTPGVP  905
             KG PGD G  G  G+ G  G KGV G +G  G  G+TGLPG KG+ GD L G PG  G P
Sbjct  825   KGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQP  884

Query  906   GMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRGQQGDPGPDGIPGRPGRVLHP  965
             G  G +   G KG  G  G+ G +G  G KGS G  G RG  G+    G+PG PG    P
Sbjct  885   GRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGN--LQGLPGSPGIPGLP  942

Query  966   GATGIPGDKGDIGPPGSTGFVGKPGLQGLPGNKGEQGRRGTPGPVGQMGPPGAKGVIGDY  1025
             G  G  G++G+IG  G  G +G  G  G  G KG  G  G  G  G  G PG KG  G+ 
Sbjct  943   GMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNP  1002

Query  1026  GDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGESIDGEPGYPG  1085
             G  G PG  G +A+SG++GD GE G TGP+GYPG PG+ G+ GP+GD   ++DG  G  G
Sbjct  1003  GFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKG  1062

Query  1086  SNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLNGTHGWPGEPG  1145
               G  G NGLPGR G KG  G  G  G +G  GEPG KG  G  G  G+NG     G PG
Sbjct  1063  EVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPG  1122

Query  1146  PRGPPGVKGEPGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIGLP---ENII  1202
             P+GP G +GE G+    GL G  G  GD+GPRG  G  G  G +G+ G++G+P   EN+ 
Sbjct  1123  PQGPKGPQGESGV---VGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLR  1179

Query  1203  VAT--KGDFGEPGMTGLTGEKGWRGDVGWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPV  1260
               +  +G  G+ G+ G  GE+G  G +G+ G  G KG  G IG  G+ GF G +G KG  
Sbjct  1180  DRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQ  1239

Query  1261  GMRGPPGIPGLTDVMLAERGDPGRDGLPGRDGKPGLPGVKGAPGEYGIDGPPGPPGAPGL  1320
             G +GP G PG+T  + AE+GD G  GL GR G+PG  G KGAPG  G +GP G  G  G 
Sbjct  1240  GDQGPRGPPGIT--LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGP  1297

Query  1321  SRKGNP---GKPGYPGRIVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRPIPGPRGQPGL  1377
               +G P   G  G+PG    G  G  GL G  G+ G  G +GE GE G  I G +G  G 
Sbjct  1298  QIQGPPGPQGDVGFPG--APGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGD  1355

Query  1378  IGIAGT---NGAKGETGPPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGE  1434
             IG  G    +GAKGE G PG  G  G  G PG    RG  GD G  G+DG  G  G +G+
Sbjct  1356  IGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGP---RGPTGDAGWGGIDGMDGLVGPKGQ  1412

Query  1435  PGDTLAYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGNPGPQGSLGQ  1494
             PG T +Y++     R G+ G  G +G  G +G  G  GL G+ G  G  G  G QG +G 
Sbjct  1413  PGVTYSYSM----ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGY  1468

Query  1495  PGDAGPDGRPGSPGPVGFQGIPGAPGLPAP  1524
              G  GP G+ G  G +G  G PG  GLP P
Sbjct  1469  TGADGPQGQRGDKGYMGLTGAPGLRGLPGP  1498


 Score = 305 bits (782),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 481/1328 (36%), Positives = 582/1328 (44%), Gaps = 260/1328 (20%)

Query  60    EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
              G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190   RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97    GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
               +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250   TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154   GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
             G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310   GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206   -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                              RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370   GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235   ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                        G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430   PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285   GR-------------------PGIDGYPGIKGVKGVQGREGW------------RGKEGK  313
             G                    PG DGY G++G+ G +G  G             RG+EG 
Sbjct  485   GEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314   DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
              G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545   TGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374   PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
              G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605   VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429   EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
             E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663   EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467   PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
              PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723   EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526   PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRM-----  574
             PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+      
Sbjct  783   PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  575   ----GEKGSRGPDGKMGP---PGNKGLDG--------------KHGTQGIEGPPGPPGAP  613
                 G KG +GPDG +G    PGNKG  G              ++G Q   G  G  G  
Sbjct  843   PGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEV  902

Query  614   GKLAPLSRVDIARAVGDQG-------LQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRK--  664
             G L    +     ++G  G       LQG+ G PG  GLPG++G  G +G  G  GR+  
Sbjct  903   GSLGQNGQNGAKGSIGFSGRRGLLGNLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD  962

Query  665   -------GEKGPYGAPGDEGRDGLPGRNGVPGSKGDP------------ATIPKEYLRGD  705
                    GE GP G  GD+G DG PG NG+PG KG+                    ++GD
Sbjct  963   IGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGD  1022

Query  706   AGYDGLP---GEPGTPGDMGLKGEAGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIP  762
              G  GL    G PG PG  G +G  GD+  +   + G KG  G       PG  G  G  
Sbjct  1023  DGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQR  1082

Query  763   GDKGIPGDSGPIGEPGIS-------LQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLP  815
             GD+G+PG  G  GEPG           G  G K   G PG  GPKG QG +G+ GL G  
Sbjct  1083  GDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPGPQGPKGPQGESGVVGLDGRN  1142

Query  816   GQSGGKGDRGSVG------------------------ESIFFPGPPGTPGRPGSKGEPGD  851
             GQ G +G RG +G                        +  F+ G  G  G  G +GE GD
Sbjct  1143  GQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGD  1202

Query  852   EGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEE------GDMLPGYPGTPGVP  905
              GP+G+ G PG  G +G  G  G  G  G  GL G +G++      G  LP   G  GV 
Sbjct  1203  MGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA  1262

Query  906   GMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGP--LGPRGQQGDPGPDGIPGRPGRVL  963
             G+ G  G  G  G  G  G PG +G  G  G RGP   GP G QGD G  G PG  GR  
Sbjct  1263  GLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHG  1322

Query  964   HPGATGIPGDKGDIGPPGSTGF--------VGKPGLQGLPGNKGEQGRRGTPGPVGQMGP  1015
               G  G  GD G  G  G +G+        +G  G QG PG  G +G +G PG  G+ G 
Sbjct  1323  LIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGR  1382

Query  1016  PGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGE  1075
              GA G  G  GDAG+ G DG     GL G KG+PG T        PG  GEPG  G  GE
Sbjct  1383  VGAPGPRGPTGDAGWGGIDG---MDGLVGPKGQPGVTYSYSMA-RPGDRGEPGLDGFQGE  1438

Query  1076  SIDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLN  1135
               DG     G+ G  GF G  G  G +G  G +G  G  G QG+ G KGY GL G PGL 
Sbjct  1439  EGDG-----GAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLR  1493

Query  1136  GTHGWPGE  1143
             G  G  GE
Sbjct  1494  GLPGPQGE  1501


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 534 bits (1375),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 665/1573 (42%), Positives = 810/1573 (51%), Gaps = 170/1573 (11%)

Query  25    SHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEW  84
             +  +G  GC  +      G  GLPG  G  G++G  G PG    +GP G  G++G  G +
Sbjct  72    NCTAGYAGCVPKCIAE-KGNRGLPGPLGPTGLKGEMGFPGM---EGPSGDKGQKGDPGPY  127

Query  85    GETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKR  144
             G+ G+KG RG  G  G  G  G+QG  G PG PG  G DGC+G DG PG+ G+ G  G R
Sbjct  128   GQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPR  187

Query  145   GEFGADGQRGLRGDPG-EGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGER  203
             G  G  G +G +G+P  E G  +KG KGE G  G  GL GP+G  GE+G  G  GPYG +
Sbjct  188   GYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAK  247

Query  204   GPRGQIGFPGPRGDPGAENVGPT--GVRGEDGDVGEPGPPGPIIEDTEQKPGNISYSFKG  261
             GPRG+ G    +G+ GA   GP   G  G  G+ GEP    P+      KP   +++  G
Sbjct  248   GPRGEHGL---KGEKGASCYGPMKPGAPGIKGEKGEPASSFPV------KP---THTVMG  295

Query  262   PKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAG  321
             P+G  G +G+ G  G KGE G  G  G+DG    KG KG+ G  G RG++G  G PG  G
Sbjct  296   PRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQ---KGEKGLPGGPGDRGRQGNFGPPGSTG  352

Query  322   VKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEP-------  374
              KGD+G PGL   +G PG PG KG+ G  G  G  G  G  G          P       
Sbjct  353   QKGDRGEPGL---NGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPR  409

Query  375   ---GVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAG  431
                G  GPQG  G  G PG  GYNG+ G  GL GR G  GPPG             GE G
Sbjct  410   GYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGK-----------KGEKG  458

Query  432   VDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGV  491
               G  GP G  G  G PG PG  G KG  G+   G  G  G  G  G+ G++G +G+ G 
Sbjct  459   TAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGF  518

Query  492   QGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPG  551
             +G  G PG  K   G PG PG+ G PG +GD G PG PG+ G  G KG+  G C   R G
Sbjct  519   KGNAGAPGDSK--LGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAG  576

Query  552   VKGEAGEAAINGIPGD------PGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEG  605
              KG+ G + + GIPG       PG  G  GE+G  G +G+ GPPG KG DG+ G  G  G
Sbjct  577   PKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATG  636

Query  606   PPGPPGAPGKLAPLSRVDIARAVGDQGL------QGMKGYPGSEGLPGLVGPPGAKGFPG  659
              PG P     L  LS ++  +  GD+G       +G++G+ G+EGLPG+ GP G  GF  
Sbjct  637   EPGKP----ALCDLSLIEPLK--GDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGF--  688

Query  660   QPGRKGEKGPYGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGY---DGLPGEPG  716
                 KGEKG  GAPG++G  G  GR+G PG       IP + ++G+ G+   DG  G+ G
Sbjct  689   ----KGEKGLSGAPGNDGTPGRAGRDGYPG-------IPGQSIKGEPGFHGRDGAKGDKG  737

Query  717   TPGDMGLKGEAGDTISSEVNM--KGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPI  774
             + G  G KGE G     E+ M  KG KG PG       PG +G PG  G  G+ G++GP 
Sbjct  738   SFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQ  797

Query  775   GEPGISLQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIFFP  834
             G PG+  +GP G  G  G  G+ G  G  G  G  GL G+PG++G  G RG  G  I  P
Sbjct  798   GPPGV--EGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG--ISRP  853

Query  835   GPPGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDM  894
             GP G PG  G +GE GD GP G  G PG DG  G  G +G  GL G +G PG+ GE+GD+
Sbjct  854   GPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDV  913

Query  895   LP----GYPGTPGVPGMPGLKGITGDKG---STGLDGTPGPDGDRGKKGSRGPLGPRGQQ  947
              P    G  G PGVPG+ G++G  G KG   S GL G PG  GDRG  G+ GP G  G  
Sbjct  914   GPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVT  973

Query  948   GDPG---PDGIPGRPGRVLHPGATGIPGDKGDIGPPGSTG---FVGKPGLQGLPGNKGEQ  1001
             G PG   P GIPG  G     GATG+ G+ G +G  G  G    +G  G QGL G  G+Q
Sbjct  974   GAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQ  1033

Query  1002  GRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLP  1061
             G  G PG  G  G PG  G  G  GDA   G+ GE   SGL+GD      TGP G PG P
Sbjct  1034  GLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGD------TGPAGTPGWP  1087

Query  1062  GIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPG  1121
             G  G PG       ++ G  G PG  G  G +G+ GR G  G  G   E G +G  G+PG
Sbjct  1088  GEKGLPG------LAVHGRAGPPGEKGDQGRSGIDGRDGINGEKG---EQGLQGVWGQPG  1138

Query  1122  PKGYAGLAGLPGLNGTHGWP---------GEPGPRGPPGVKGEPGMDGDPGLSGNPGIPG  1172
              KG  G  G+PG  G  G P         G PG RG    KGEPG+      SG PG+ G
Sbjct  1139  EKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGD---KGEPGL------SGLPGLKG  1189

Query  1173  DRGPRGGPGLSGAPGPKGE---PGDIGLPENI--IVATKGDFGEPGMTGLTGEKGWRGDV  1227
             + GP G  G +GAPGPKGE    G  GLP  +  I   KG  GE G TG  GE+G RG  
Sbjct  1190  ETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLT  1249

Query  1228  GWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPVGMRGPPGIPGLTDVMLAERGDPGRDGL  1287
             G  G  G KG  G  GP G  G  G  G KG +G RG  G PG+T  +  E+G PGR G 
Sbjct  1250  GPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVT--IKGEKGLPGRPGR  1307

Query  1288  PGRD---------GKPGLPGVKGAPGEYGIDGPPGPPGAPGLSRKGNPGKPGYPGRIVEG  1338
              GR          G+ GLPG+ G PG  G+ GP GP G+ G   +G  G PG PG+  +G
Sbjct  1308  NGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKG--ERGLAGSPGQPGQ--DG  1363

Query  1339  LPGLPGLPGEDGKPGTPGVRGEPGEPG-------RPIPGPRGQPGLIGIAGTNGAKGETG  1391
              PG PGL G+ G  G  G RG  G  G       R + GP G PGL+      G KG+TG
Sbjct  1364  FPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLV------GQKGDTG  1417

Query  1392  PPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQWTRGRAG  1451
              PG  G +G  G P   G+RGF G  G  G DGTPG  G +GEPG       +   G+ G
Sbjct  1418  YPGLNGNDGPVGAP---GERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPG  1474

Query  1452  EIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGNPGPQGSLGQPGDAGPDGRPGSPGPVG  1511
               GP+G  G PG  GL G +G +G  G+ GL G  G  G  G  GD G  G  G  G +G
Sbjct  1475  RNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIG  1534

Query  1512  FQGIPGAPGLPAP  1524
               G  G PG PAP
Sbjct  1535  LIGQKGEPGAPAP  1547


 Score = 381 bits (978),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 504/1253 (40%), Positives = 600/1253 (48%), Gaps = 189/1253 (15%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGE-----------  89
              +G+ GLPG +G  G +G  G PG  G +GPPG  G++G  G  G  G            
Sbjct  420   LNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPG  479

Query  90    -KGMRGDKGF-----QGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIA--GIPGTS  141
              +G +GD G      QG KG AG+ GYPG     G KG  G  G  GAPG +  G PGT 
Sbjct  480   PEGQKGDAGLPGYGIQGSKGDAGIPGYPG---LKGSKGERGFKGNAGAPGDSKLGRPGTP  536

Query  142   GKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYG  201
             G  G  G  G  G  G PG+ G    G KG+ G        GP+G  G  G PG  G  G
Sbjct  537   GAAGAPGQKGDAGRPGTPGQKG--DMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDG  594

Query  202   ERGPRGQIGFPGPRGDPGAE-NVGPTGVRGEDGDVGEPGPPG----PIIEDTEQKPGNIS  256
              RGP G+ G+PG RG  G     GP G +GEDG  G PG  G    P + D      ++ 
Sbjct  595   ARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDL-----SLI  649

Query  257   YSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGR  316
                KG KG PGA G +G  G KG  G+PG PG  G  G KG KG+ G  G  G  G+ GR
Sbjct  650   EPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGR  709

Query  317   PGDAGVKGD--KGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEP  374
              G  G+ G   KG PG  GRDG+ G+ GS G  G  G PG      D        +K EP
Sbjct  710   DGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCAL--DEIKMPAKGNKGEP  767

Query  375   GVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKG-ISIPGEAGVD  433
             G TG  GP G  G PGE GY G      L+G TG  GPPG+ GP G  G     G  G  
Sbjct  768   GQTGMPGPPGEDGSPGERGYTG------LKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAV  821

Query  434   GTPGPPGQPGVYGPPGIPGLPGPKGQQGVTI---IGPPGQDGVPGQDGFKGVQGDRGDPG  490
             G PG PG+ G+ G PG  G PGP+G+ G++    +GPPG           G+QG++GD G
Sbjct  822   GVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPG---------LNGLQGEKGDRG  872

Query  491   VQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRP  550
               GP G PG            GS G+PG  GD G PG+ GRPG+ G KG+          
Sbjct  873   PTGPIGFPGA----------DGSVGYPGDRGDAGLPGVSGRPGIVGEKGD---------V  913

Query  551   GVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPP  610
             G  G AG A   G+PG  G  GR G KG  G  G +G PGNKG  G  G  G +G  G  
Sbjct  914   GPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVT  973

Query  611   GAPGKLAPLSRVDIARAVGDQGLQGMKG---------------YPGSEGLPGLVGPPGAK  655
             GAPGK  P     ++ A GD+G  G+ G                 G +G  GL G PG +
Sbjct  974   GAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQ  1033

Query  656   GFPGQPGRKGEKGPYGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEP  715
             G  G PG   EKG  G PG +G  GLPG     G KG+P       LRGD G  G PG P
Sbjct  1034  GLDGMPG---EKGNQGFPGLDGPPGLPGDASEKGQKGEPGP---SGLRGDTGPAGTPGWP  1087

Query  716   GTPGDMGLKGEAGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIG  775
             G                       EKG PG           G  G PG+KG  G SG  G
Sbjct  1088  G-----------------------EKGLPGLA-------VHGRAGPPGEKGDQGRSGIDG  1117

Query  776   EPGISLQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQS------------GGKGD  823
               GI+     G KG  G  G WG  G +G+ G  G+PG PG              G  GD
Sbjct  1118  RDGIN-----GEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGD  1172

Query  824   RGSVGESIFFPGPPGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETG  883
             RG  GE       PG  G PG KGE G  G  G+ G PGP G +G+ G  GLP       
Sbjct  1173  RGDKGE-------PGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPAT-----  1220

Query  884   LPGLKGEEGDM----LPGYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRG  939
             +P ++G++G        G  G  G  G+ G  G+ G KG  GL G PG  G  G  G++G
Sbjct  1221  VPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKG  1280

Query  940   PLGPRGQQGDPG-----PDGIPGRPGRVLHPGATGIPGDKGDIGPPGSTGFVGKPGLQGL  994
              +GPRG+ G PG       G+PGRPGR    G  G PG  G+ G PG     G+PGL GL
Sbjct  1281  DIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPG---LAGEPGLVGL  1337

Query  995   PG------NKGEQGRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGE  1048
             PG      +KGE+G  G+PG  GQ G PGA G+ GD G  G+ GE G + F G +GDKG+
Sbjct  1338  PGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGD  1397

Query  1049  PGQTGPMGYPGL---------PGIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRP  1099
              G  GP G PGL         PG+ G  GP+G  GE      G+ G  GRDG +G PG P
Sbjct  1398  RGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGER-----GFTGPKGRDGRDGTPGLP  1452

Query  1100  GNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLNGTHGWPGEPGPRGPPGVKGEPGMD  1159
             G KG  G L   GPKG  G+PG  G  G  G PG  G  G  GE G +G  G+ GE G  
Sbjct  1453  GQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNV  1512

Query  1160  GDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIGLPENI-IVATKGDFGE  1211
             G PG  G+ G PG+RG  G  GL G  G  G P    L     I+ T+    E
Sbjct  1513  GRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSE  1565


 Score = 365 bits (938),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 527/1336 (39%), Positives = 626/1336 (47%), Gaps = 249/1336 (19%)

Query  373   EPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGI-SIPGEAG  431
             E G  G  GP+GP G  GE G+ G  GP G +G+ G+PGP G  G  G +G   + G+AG
Sbjct  87    EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAG  146

Query  432   VDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGV  491
             V         PGV GP G PG PG  G+ G       GQDG+PG +G  G+ G RG  G 
Sbjct  147   V---------PGVQGPAGNPGAPGINGKDGCD-----GQDGIPGLEGLSGMPGPRGYAGQ  192

Query  492   QGPKGIPGQ-----GKPIRGPPGEPGSPGFPGLEGDVGFPGLPGR---------------  531
              G KG  G+     G   +G  GEPG  G  GL G  GFPG  G                
Sbjct  193   LGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGE  252

Query  532   PGLKGPKGNDC-GFCPPGRPGVKGEAGEAA-------INGIPGDPGAPGRMGEKGSRGPD  583
              GLKG KG  C G   PG PG+KGE GE A        + + G  G  G+ GE G  G  
Sbjct  253   HGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRK  312

Query  584   GKMGPPGNKGLDGKHGTQGIEGPPGPPGAPGKLAPLSRVDIARAVGDQGLQGMKGYPGSE  643
             G+ GP G+ GLDG+ G +G+ G PG                     D+G QG  G PGS 
Sbjct  313   GEPGPEGDTGLDGQKGEKGLPGGPG---------------------DRGRQGNFGPPGST  351

Query  644   GLPGLVGPPGAKGFPGQPGRKGEKGPYGAP------------------------------  673
             G  G  G PG  G PG PG+KGE G  GA                               
Sbjct  352   GQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGY  411

Query  674   -GDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEPGTPGDMGLKGEAGDTIS  732
              G  G  GL G +G+PG +G           G  G  GLPG PG  G  G KGE G   +
Sbjct  412   VGAPGPQGLNGVDGLPGPQG---------YNGQKGGAGLPGRPGNEGPPGKKGEKG---T  459

Query  733   SEVNM-KGEKGYPGXXXXXXAPGFEGEPGIPGD--KGIPGDSGPIGEPGIS-LQGPTGFK  788
             + +N  KG  G  G        G +G+ G+PG   +G  GD+G  G PG+   +G  GFK
Sbjct  460   AGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFK  519

Query  789   GRPGRPGDW--------GPKGAQGATGIQGLPGLPGQSGGKGDRGSVG--ESIFFPGPPG  838
             G  G PGD         G  GA G  G  G PG PGQ G  G +G VG   S    GP G
Sbjct  520   GNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKG  579

Query  839   ---TPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGE---TGLPGLKGEEG  892
                T G PG  G+ G  GP G RG PG  G  G+ G  G PG  GE   TGLPG  GE G
Sbjct  580   DKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPG  639

Query  893   -------DMLPGYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRG  945
                     ++    G  G PG PG KG+ G KG+ GL G PGP G+ G KG +G  G  G
Sbjct  640   KPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPG  699

Query  946   QQGDPGP---DGIPGRPGRVL--HPGATGIPGDKGDIGPPGSTGFVGKPGLQGL------  994
               G PG    DG PG PG+ +   PG  G  G KGD G  G +G  G+PG   L      
Sbjct  700   NDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMP  759

Query  995   -PGNKGEQGRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTG  1053
               GNKGE G+ G PGP G+ G PG +G  G  G+ G  G  G     GL G +GE G  G
Sbjct  760   AKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQG  819

Query  1054  PMGYPG---------LPGIPGEPGPLGDLGES----------------------------  1076
              +G PG         +PG  G+PGP G+ G S                            
Sbjct  820   AVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGF  879

Query  1077  --IDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGL  1134
                DG  GYPG  G  G  G+ GRPG  G  G +G +GP G  G   P G  G+ G+ G 
Sbjct  880   PGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAG---PPGVPGIDGVRGR  936

Query  1135  NGTHGWPGEPGPRGPPGVKGE---PGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGE  1191
             +G  G PG PG  G PG KG+   PG DG  G +G  G PG RGP G PG+SGA G KG 
Sbjct  937   DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGA  996

Query  1192  PGDIG----------LPENIIVATKGD---FGEPGMTGLTGEKGWRGDVGWPGRNGTKGL  1238
              G  G               ++  KGD    G PG  GL G  G +G+ G+PG +G  GL
Sbjct  997   TGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGL  1056

Query  1239  PGAI---GPQGEPGFPGYQGPKGPVGMRGPPGIPGLTDVMLA-------ERGDPGRDGLP  1288
             PG     G +GEPG  G +G  GP G  G PG  GL  + +        E+GD GR G+ 
Sbjct  1057  PGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGID  1116

Query  1289  GRDG------KPGLPGVKGAPGEYGIDGPPGPPGAPGLSRKGNPGKP----GYPG-RIVE  1337
             GRDG      + GL GV G PGE G  G PG PGAPG+             GYPG R  +
Sbjct  1117  GRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDK  1176

Query  1338  GLPGLPGLPGEDGKPGTPGVRGEPGEPG-RPIPGPRGQPGLIG----IAGTNGAKGETGP  1392
             G PGL GLPG  G+ G  G++G  G PG +   G RGQPGL      I G  G++GE   
Sbjct  1177  GEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGE---  1233

Query  1393  PGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQWTRGRAGE  1452
                    GY G  G +G+RG    TG  G+ G  G++G QG PG   A  L    G  G+
Sbjct  1234  ------RGYTGEKGEQGERGL---TGPAGVAGAKGDRGLQGPPG---ASGLNGIPGAKGD  1281

Query  1453  IGPRGGEGLPGIDGLPGGKGLKGYPGD---VGLRGNPGPQGSLGQPGDAGPDGRPGSPGP  1509
             IGPRG  G PG+  + G KGL G PG     GL G PG  G  G PG AG  G  G PGP
Sbjct  1282  IGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGP  1340

Query  1510  VGFQGIPGAPGLPAPP  1525
             +G  G  G  GL   P
Sbjct  1341  IGPAGSKGERGLAGSP  1356


 Score = 323 bits (827),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 467/1188 (39%), Positives = 546/1188 (46%), Gaps = 219/1188 (18%)

Query  505   RGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGI  564
             +G  G PG  G  GL+G++GFPG+ G  G KG KG+      PG  G +G+ GE    G+
Sbjct  88    KGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGD------PGPYGQRGDKGERGSPGL  141

Query  565   PGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPPGAPGKLAPL-SRVD  623
              G  G PG  G  G+ G  G  G  G  G DG  G +G+ G PGP G  G+L     + +
Sbjct  142   HGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGE  201

Query  624   IARAVGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRKGEKGPYGAPGDEGRDGL--  681
              A+  GD   +G KG PG  G  GL GP   +GFPG+ G +G+ GPYGA G  G  GL  
Sbjct  202   PAKENGDY-AKGEKGEPGWRGTAGLAGP---QGFPGEKGERGDSGPYGAKGPRGEHGLKG  257

Query  682   -----------PGRNGVPGSKGDPATI----PKEYLRGDAGYDGLPGEPGTPGDMGLKGE  726
                        PG  G+ G KG+PA+     P   + G  G  G  GEPG  G  G  G 
Sbjct  258   EKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGP  317

Query  727   AGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGEPGIS-LQGPT  785
              GDT       KGEKG PG       PG  G  G  G  G  G  G  GEPG++ L G  
Sbjct  318   EGDTGLD--GQKGEKGLPG------GPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNP  369

Query  786   GFKGRPGRPGDWGPK----------------------------GAQGATGIQGLPGLPGQ  817
             G KG PGR G  G                              GA G  G+ G+ GLPG 
Sbjct  370   GQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGP  429

Query  818   SGGKGDRGSVGESIFFPGPPGTPGRPGSKGEPG---------------------------  850
              G  G +G  G     PG PG  G PG KGE G                           
Sbjct  430   QGYNGQKGGAG----LPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKG  485

Query  851   DEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDMLPGYPGTPGVPGMPGL  910
             D G  GY GI G  G  G+ G  GL G  GE G  G  G  GD   G PGTPG  G PG 
Sbjct  486   DAGLPGY-GIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQ  544

Query  911   KGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRGQQGDPGPDGIPGR------PGRVLH  964
             KG  G  G+ G  G  G  GD G K S    GP+G +G  G  GIPG+      PG   +
Sbjct  545   KGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGY  604

Query  965   PGATGIPGDKGDIGPPGSTGFVGKPGLQGLPGN---------------KGEQGRRGTPGP  1009
             PG  G  G  G  GPPG  G  G+ GL G  G                KG++G  G PG 
Sbjct  605   PGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGA  664

Query  1010  VGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGP  1069
              G  G  GA+G+ G  G  G  G  GE   SG  G+ G PG+ G  GYPG+PG       
Sbjct  665   KGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPG-------  717

Query  1070  LGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKGSMG--ALGEVG--PKGFQGEPGPKGY  1125
                  +SI GEPG+ G +G  G  G  GR G KG  G  AL E+    KG +GEPG  G 
Sbjct  718   -----QSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGM  772

Query  1126  AG---LAGLPGLNGTHGWPGEPGPRGPPGVKGEPGMDGDPGLSGN------PGIPGDRGP  1176
              G     G PG  G  G  G  GP+GPPGV+G  G++G  G  GN      PG PG  G 
Sbjct  773   PGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGL  832

Query  1177  RGGPGLSGAPGPKGEPGDIGLPENIIVATKGDFGEPGMTGLTGEKGWRG-----------  1225
             RG PG +G PGP+GEPG         ++  G  G PG+ GL GEKG RG           
Sbjct  833   RGIPGRNGQPGPRGEPG---------ISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGAD  883

Query  1226  -DVGWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPVGMRGPPGIPGLTDV-----MLAER  1279
               VG+PG  G  GLPG  G  G  G  G  GP GP G+ GPPG+PG+  V        E 
Sbjct  884   GSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEP  943

Query  1280  GDPGRDGLPGRDGKPGLPGVKGAPGEYGIDGPPG---PPGAPGLS-RKGNPGKPGYPGR-  1334
             G PG  G+PG  G  G PG  G  G  G+ G PG   P G PG+S  KG+ G  G  G  
Sbjct  944   GSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGND  1003

Query  1335  ---------IVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRP-IPGPRGQPGLIGIAGTN  1384
                         GL G+ G  G  G PG  G+ G PGE G    PG  G PGL G A   
Sbjct  1004  GPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEK  1063

Query  1385  GAKGETGPPG---DTGVEGYPGTPGAKG--------------DRGFIGDTGLPGMDGTPG  1427
             G KGE GP G   DTG  G PG PG KG              ++G  G +G+ G DG  G
Sbjct  1064  GQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGING  1123

Query  1428  EKGFQGEPGDTLAYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLK------GYPGDVG  1481
             EKG QG         LQ   G+ GE G  G  G+PG  G+ G  G        GYPGD G
Sbjct  1124  EKGEQG---------LQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRG  1174

Query  1482  LRGNPGPQGSLGQPGDAGP---DGRPGSPGPVGFQGIPGAPGLPAPPP  1526
              +G PG  G  G  G+ GP    G  G+PGP G +GI G PGLPA  P
Sbjct  1175  DKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVP  1222


 Score = 279 bits (713),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 364/964 (38%), Positives = 466/964 (48%), Gaps = 143/964 (15%)

Query  38    TCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKG  97
              C+   I  L G+KG  G  GA+G  G  G +G PG PG +G   E+G  GEKG+ G  G
Sbjct  643   LCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKG---EFGFKGEKGLSGAPG  699

Query  98    FQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADG------  151
               G  GRAG  GYPG PG    KG  G +G DGA G  G  G SG++GE G+        
Sbjct  700   NDGTPGRAGRDGYPGIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKM  758

Query  152   -QRGLRGDPGEGGI----NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPR  206
               +G +G+PG+ G+       G+ GE G  G+ G  GP+GP G  GP G  GP GE+G +
Sbjct  759   PAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQ  818

Query  207   GQIGFPG------------------PRGDPGAEN---VGPTGVRGEDGDVGEPGPPGPII  245
             G +G PG                  PRG+PG      +GP G+ G  G+ G+ GP GPI 
Sbjct  819   GAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPI-  877

Query  246   EDTEQKPGNISY-SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGR  304
                    G++ Y   +G  G+PG  G  G  G KG+ G  G  G+ G PG+ G+ GV+GR
Sbjct  878   -GFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGR  936

Query  305   EGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGI  364
             +G +G+ G  G  G  G KGD+GAPG  G  G  G  G+ G  G  G+PG+ G +GD+G 
Sbjct  937   DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGA  996

Query  365   YDPTLDKIEPG---------VTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGI  415
                T +    G         + G +G  G  G PG+ G +G PG  G QG  G  GPPG+
Sbjct  997   TGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGL  1056

Query  416   VGPIGPKGISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTI---IGPPGQDG  472
              G           E G  G PGP G  G  GP G PG PG KG  G+ +    GPPG+ G
Sbjct  1057  PGDAS--------EKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKG  1108

Query  473   VPGQ---DGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPG--------------  515
               G+   DG  G+ G++G+ G+QG  G PG+ K   G PG PG+PG              
Sbjct  1109  DQGRSGIDGRDGINGEKGEQGLQGVWGQPGE-KGSVGAPGIPGAPGMDGLPGAAGAPGAV  1167

Query  516   -FPGLEGDVGFPGLPGRPGLKGPKG--NDCGFC----PPGRPGVKGEAGE-AAINGIPGD  567
              +PG  GD G PGL G PGLKG  G     GF     P G  G++G+ G  A +  I GD
Sbjct  1168  GYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGD  1227

Query  568   PGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPPGAPGKLAPLSRVDIARA  627
              G+ G  G  G +G  G+ G  G  G+ G  G +G++GPPG  G  G         I  A
Sbjct  1228  KGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNG---------IPGA  1278

Query  628   VGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRKGEKGPYGAPGDEGRDGLPGRNGV  687
              GD G +G  GYPG       V   G KG PG+PGR G +G  GAPG  G  GLPG  G 
Sbjct  1279  KGDIGPRGEIGYPG-------VTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGE  1331

Query  688   PGSKGDPATIPKEYLRGDAGY---------DGLPGEPGTPGDMGLKGEAGDT-ISSEVNM  737
             PG  G P  I     +G+ G          DG PG PG  GD G +G  G+  ++     
Sbjct  1332  PGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQ  1391

Query  738   KGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGEPGIS-LQGPTGFKGRPGRPG-  795
             KG+KG  G       PG  G+ G  G  G+ G+ GP+G PG     GP G  GR G PG 
Sbjct  1392  KGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGL  1451

Query  796   -----------------------DWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIF  832
                                      GPKG  G  G +GL G+ G+ G KG+RG +GE+  
Sbjct  1452  PGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGET--  1509

Query  833   FPGPPGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEG  892
                  G  GRPG KG+ G+ G  GY G  G  G+KG  G      L   TG+   +  + 
Sbjct  1510  -----GNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQS  1564

Query  893   DMLP  896
             + +P
Sbjct  1565  ETVP  1568


 Score = 230 bits (587),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 315/791 (40%), Positives = 385/791 (49%), Gaps = 105/791 (13%)

Query  821   KGDRGSVGESIFFPGPPGTPGRPGSKGEPGDEGPVG---YRGIPGPDGRKGVAGPKGLPG  877
             KG+RG        PGP G  G  G  G PG EGP G    +G PGP G++G  G +G PG
Sbjct  88    KGNRG-------LPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPG  140

Query  878   LTGETGLPGLKGEEGDMLPGYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGS  937
             L G+ G+PG++G  G+     PG PG+ G  G  G  G  G  GL G PGP G  G+ GS
Sbjct  141   LHGQAGVPGVQGPAGN-----PGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGS  195

Query  938   RGPLG-PRGQQGD--PGPDGIPGRPGRVLHPGATGIPGDKGDIGPPGSTGFVGKPGLQGL  994
             +G  G P  + GD   G  G PG  G     G  G PG+KG+ G  G  G  G  G  GL
Sbjct  196   KGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGL  255

Query  995   PGNKGEQG----RRGTPGPVGQMGPPGA-------KGVIGDYGDAGYPGEDGESAFSGLQ  1043
              G KG       + G PG  G+ G P +         V+G  GD G  GE G     G  
Sbjct  256   KGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEP  315

Query  1044  GDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKG  1103
             G +G+ G  G  G  GLPG PG+ G  G+ G    G  G  G  G  G NGLPG PG KG
Sbjct  316   GPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPP--GSTGQKGDRGEPGLNGLPGNPGQKG  373

Query  1104  SMGALGEVGPKG-------------------------FQGEPGPKGYAGLAGLPGLNGTH  1138
               G  G  G  G                         + G PGP+G  G+ GLPG  G +
Sbjct  374   EPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYN  433

Query  1139  G------WPGEPGPRGPPGVKGEPGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEP  1192
             G       PG PG  GPPG KGE          G  G+ G +G  G  G  G PGP+G+ 
Sbjct  434   GQKGGAGLPGRPGNEGPPGKKGE---------KGTAGLNGPKGSIGPIGHPGPPGPEGQK  484

Query  1193  GDIGLPENIIVATKGDFG---EPGMTGLTGEKGWRGDVGWPG-----RNGTKGLPGAIGP  1244
             GD GLP   I  +KGD G    PG+ G  GE+G++G+ G PG     R GT G  GA G 
Sbjct  485   GDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQ  544

Query  1245  QGEPGFPGYQGPKGPVGMRGPPGIPGLTDVMLAERGDPGRDGLPG---RDGKPGLPGVKG  1301
             +G+ G PG  G KG +G++G  G    +      +GD G  GLPG   +DG  G PG +G
Sbjct  545   KGDAGRPGTPGQKGDMGIKGDVGGK-CSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERG  603

Query  1302  APGEYG---IDGPPGPPGAPGLS-RKGNPGKPGYPGR-------IVEGLPGLPGLPGEDG  1350
              PGE G   I+G  GPPG  G   R G PG  G PG+       ++E L G  G PG  G
Sbjct  604   YPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPG  663

Query  1351  KPGTPGVRGEPGEPGRPIPGPRGQPGLIGIAGTNGAKGETGPPGDTGVEGYPGTPGA--K  1408
               G  G +G  G PG  IPGP+G+ G  G  G +GA G  G PG  G +GYPG PG   K
Sbjct  664   AKGVQGFKGAEGLPG--IPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIK  721

Query  1409  GDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQW-TRGRAGEIGPRGGEGLPGIDGL  1467
             G+ GF G  G  G  G+ G  G +GEPG      ++   +G  GE G  G  G PG DG 
Sbjct  722   GEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGS  781

Query  1468  PGGKGLKGYPGDVGLRGNPGPQGSLG------QPGDAGPDGRPGSPGPVGFQGIPGAPGL  1521
             PG +G  G  G+ G +G PG +G  G      + G+ G  G PG+PG  G +GIPG  G 
Sbjct  782   PGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQ  841

Query  1522  PAPPPPPPPSR  1532
             P P   P  SR
Sbjct  842   PGPRGEPGISR  852


 Score = 153 bits (386),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 241/645 (37%), Positives = 290/645 (45%), Gaps = 148/645 (23%)

Query  985   FVGKPGLQGLPGNKGEQGRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQG  1044
              + + G +GLPG  G  G +G  G  G  GP G KG  GD G  G  G+ GE    GL G
Sbjct  84    CIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHG  143

Query  1045  DKGEPGQTGPMGYPGLPGIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKGS  1104
               G PG  GP G PG PGI G+ G         DG+ G PG    +G +G+PG  G  G 
Sbjct  144   QAGVPGVQGPAGNPGAPGINGKDG--------CDGQDGIPG---LEGLSGMPGPRGYAGQ  192

Query  1105  MGALGEVG---------PKGFQGEPGPKGYAGLAGLPGLNGTHGWPGEPGPRGPPGVKGE  1155
             +G+ GE G          KG +GEPG +G AGLAG  G  G  G  G+ GP G  G +GE
Sbjct  193   LGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGE  252

Query  1156  PGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIGL-----PENIIVATKGDFG  1210
              G+ G+ G S             GP   GAPG KGE G+        P + ++  +GD G
Sbjct  253   HGLKGEKGASCY-----------GPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMG  301

Query  1211  ---EPGMTGLTGEKGWRGDVGWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPVGMRGPPG  1267
                EPG+ G  GE G  GD G  G+ G KGLPG  G +G  G  G  G  G  G RG PG
Sbjct  302   QKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPG  361

Query  1268  IPGLTDVMLAERGDPGRDGLPGRDGKPGLPG-------------------------VKGA  1302
             + GL        G+PG+ G PGR G  G PG                           GA
Sbjct  362   LNGLP-------GNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGA  414

Query  1303  PGEYGIDGPPGPPGAPGLSRKGNPGKPGYPGRIVEGLPGLPGLPGEDGKPGTPGV-----  1357
             PG  G++G  G PG  G +  G  G  G PGR     PG  G PG+ G+ GT G+     
Sbjct  415   PGPQGLNGVDGLPGPQGYN--GQKGGAGLPGR-----PGNEGPPGKKGEKGTAGLNGPKG  467

Query  1358  ----------------RGEPGEPGRPIPGPRGQ------PGLIGIAGTNGAKGETGPPGD  1395
                             +G+ G PG  I G +G       PGL G  G  G KG  G PGD
Sbjct  468   SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGD  527

Query  1396  TGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQWTRGRAGEIGP  1455
             + + G PGTPGA G  G  GD G PG   TPG+KG  G  GD      + +  RAG  G 
Sbjct  528   SKL-GRPGTPGAAGAPGQKGDAGRPG---TPGQKGDMGIKGDVGG---KCSSCRAGPKGD  580

Query  1456  RGGEGLPGIDGLPGGKG---LKGYPGDVGLRGNPGPQGSLGQPGDAGPDGRPGSPGPVG-  1511
             +G  GLPGI G  G +G    +GYPG+   RG+ G  G  G PG+ G DGR G PG  G 
Sbjct  581   KGTSGLPGIPGKDGARGPPGERGYPGE---RGHDGINGQTGPPGEKGEDGRTGLPGATGE  637

Query  1512  --------------------------F---QGIPGAPGLPAPPPP  1527
                                           QG  GA GLP  P P
Sbjct  638   PGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGP  682


 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 98/210 (47%), Gaps = 25/210 (12%)

Query  1320  LSRKGNPGKPGYPGRIVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRPIPGPRGQPGLIG  1379
             ++ KGN G PG  G    GL G  G PG +G  G  G +G+PG        P GQ G  G
Sbjct  85    IAEKGNRGLPGPLGPT--GLKGEMGFPGMEGPSGDKGQKGDPG--------PYGQRGDKG  134

Query  1380  IAGTNGAKGETGPPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTL  1439
               G+ G  G+ G PG  G  G PG PG  G  G  G  G+PG++G        G PG   
Sbjct  135   ERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEG------LSGMPG---  185

Query  1440  AYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGNPGPQGSLGQPGDAG  1499
                    RG AG++G +G +G P  +     KG KG PG  G  G  GPQG  G+ G+ G
Sbjct  186   ------PRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERG  239

Query  1500  PDGRPGSPGPVGFQGIPGAPGLPAPPPPPP  1529
               G  G+ GP G  G+ G  G     P  P
Sbjct  240   DSGPYGAKGPRGEHGLKGEKGASCYGPMKP  269



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01580.1.1 Collagen

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMV5_DROME  unnamed protein product                                 253     2e-72
O18407_DROME  unnamed protein product                                 250     2e-71
CO4A1_DROME  unnamed protein product                                  184     6e-49


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 253 bits (647),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 271/590 (46%), Positives = 332/590 (56%), Gaps = 18/590 (3%)

Query  4    TRHRY-VIFYVFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGN  62
             RH   ++  V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG 
Sbjct  6    LRHLSGLLGVVYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGP  61

Query  63   PGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGL  122
             GD GP G  GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+
Sbjct  62   AGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGI  121

Query  123  DGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQ  182
            DGC+G  G  G +G PG +G RG  G  GQ+G  G+ GEGGINSKGTKG  G  G PG  
Sbjct  122  DGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGV  181

Query  183  GPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPG  242
            GP G  G+RG  G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG   
Sbjct  182  GPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG---  238

Query  243  PIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQ  302
                D+         + KG KG  G +GD GP G  GE+G  GR G+       G +G  
Sbjct  239  ----DSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEI  288

Query  303  GREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDR  362
            G  G RGK GKDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  
Sbjct  289  GGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPP  348

Query  363  GIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPK  422
            GIYDP+L K  PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP 
Sbjct  349  GIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP  408

Query  423  GISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGV  482
            G S  GEAG  G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G 
Sbjct  409  GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGY  468

Query  483  QGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDC  542
            +GDRG+ G+ G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC
Sbjct  469  RGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDC  528

Query  543  GFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMDRLETK  592
              C  G  G +G+ G+    G  G+ GA G  G +G +G  G   R   K
Sbjct  529  PVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHK  578


 Score = 171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 232/594 (39%), Positives = 282/594 (47%), Gaps = 115/594 (19%)

Query  42    DGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGP  101
             +G+ GLPGEKG+RG         D  P    GP G  G  G+ G  G  G RG  G  GP
Sbjct  512   NGLRGLPGEKGLRG---------DDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGP  562

Query  102   KGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQ--------R  153
             +G  GLQG PG  G+   KGL         PG AGIPG  GK G  G DG+        +
Sbjct  563   RGVQGLQGNPGRAGH---KGL---------PGPAGIPGEPGKVGAAGPDGKAIEVGSLRK  610

Query  154   GLRGDPGEGGIN-SKGTKGESGVYGIPGLQGPRGPMGER---GPPGYQGPYGERGPRGQI  209
             G  GD G+ G     G  GE G  G  G +G RG  G+R   G  GYQG  GE G  G+ 
Sbjct  611   GEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRD  670

Query  210   GFPGPR---------GDPGAENVGPTGVRGEDGDVGEPGPPGP----IIEDTEQKPGNIS  256
             G PG           G+PG + +   G RG+DGD G  G  G      I D   +PG   
Sbjct  671   GAPGRNATTPKVYLIGEPGYDGI--KGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDG  728

Query  257   YSFKGPKGMPGARGDRGPYGLKGERG--------VPGRPGIDGYPGIKGVKGVQGREGWR  308
             Y+  GPKG+ GA+G++G  GL+GE G        +PG  G  GYPG  G  G QG  G  
Sbjct  729   YT--GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLP  786

Query  309   GKEGKDGRPGDAGVKGDKGAPG---LAGRDGSPGEPGSK---GDEGLPGLPGLQGPEGDR  362
             G++G+ G  G  G KG +G PG   + G  G PG  G K   GD G PG  GL G  G +
Sbjct  787   GRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPK  846

Query  363   GIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGY-----------------NGKPGPPGLQG  405
             G+          G  GP G +G  G PG  G                  NG+  P G +G
Sbjct  847   GV---------KGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKG  897

Query  406   RTGEPGPPGIVGPIGPKG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTI  464
             + GE G  G  G  G KG I   G  G+ G  G  G PG    PGIPGLPG        +
Sbjct  898   QKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGS---PGIPGLPG--------M  946

Query  465   IGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVG  524
             IG  G+ G  G +G +G  G RG  G  GPKG+ G      GP G PG+ G PG +G+ G
Sbjct  947   IGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGD----DGPDGYPGANGLPGRKGETG  1002

Query  525   FPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKG  578
              PG PGRPG KG              G+KG+ GE+ + G  G PGAPG  G++G
Sbjct  1003  NPGFPGRPGAKGVAAYS---------GIKGDDGESGLTGPIGYPGAPGAKGQRG  1047


 Score = 165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 244/651 (37%), Positives = 298/651 (46%), Gaps = 135/651 (21%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G  G PG  G  G +GA G PG    DG PG  G  G  G+ G  G++ ++G+    GP 
Sbjct  766   GAKGYPGPTGDYGQQGAPGLPGR---DGEPGLDGGIGYKGQRGVPGQEVIQGEI---GPP  819

Query  103   GRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEF------  147
             GR+G++G+PG           G PGPKG+ G  G DGA G  G+PG  G+RG+F      
Sbjct  820   GRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPG  879

Query  148   --------------GADGQRGLRGDPGEGGIN-SKGTKGESGVYGIPGLQGPRGPMGERG  192
                           GA GQ+G  G  G+ G N +KG+ G SG  G+ G  G +G  G  G
Sbjct  880   PKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPG  939

Query  193   PPGYQGPYGERGPRGQIGFPGPRGDPGAE----NVGPTGVRGEDGDVGEPGPPGPIIEDT  248
              PG  G  GE G RG+IG+ G +GD G        GP G+ G+DG  G PG  G  +   
Sbjct  940   IPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANG--LPGR  997

Query  249   EQKPGNISY----SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKG-----VK  299
             + + GN  +      KG     G +GD G  GL G  G PG PG  G  G  G     + 
Sbjct  998   KGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALD  1057

Query  300   GVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPE  359
             GV GR+G  G  G +G PG  G+KG +G  GL G+ G PGEPG+KG  G PG  G+ G +
Sbjct  1058  GVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLK  1117

Query  360   GDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGK----------------------  397
             G  G          PG  GP+GP G  G  G DG NG+                      
Sbjct  1118  GATGF---------PGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDE  1168

Query  398   ---------------------PGPPGLQGRTGEP---GPPGIVGPIGPKG----ISIPGE  429
                                   G  GLQG  GE    GP G +GP G KG    I   G+
Sbjct  1169  GEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ  1228

Query  430   AGVDGTPGPPGQPGVYGPPGIPG--LPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRG  487
              G DG  G  G  G  GP G PG  LP  KG +GV      G DG  G+ G  G +G  G
Sbjct  1229  LGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA-----GLDGRAGRPGHFGQKGAPG  1283

Query  488   DPGVQGPKGIPGQGKP-IRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCP  546
              PG  GP G  G   P I+GPPG  G  GFPG       PG  GR GL GPKG       
Sbjct  1284  PPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGA------PGHNGRHGLIGPKGE---LGD  1334

Query  547   PGRPGVKGEAGEAAIN--------GIPGDPGAPGRMGEKGSRGPDGKMDRL  589
              GR G +GE+G A +         G  G+PG  G  GE+G  G  GK  R+
Sbjct  1335  MGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRV  1385


 Score = 159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 248/681 (36%), Positives = 310/681 (46%), Gaps = 130/681 (19%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQG  100
               G +G PG  G++G  G  G PG  G  G PGP G +G  G  G  G+ G+ G+KG +G
Sbjct  812   IQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG  871

Query  101   --------PKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQ  152
                     PKG+ G  G   P G  G KG  G  G +G  G  G  G SG+RG  G  G 
Sbjct  872   DFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGL  931

Query  153   RGLRGDPGE----GGINSKGTKGESGVYGIPGLQGPRGPMGERGPPG---------YQGP  199
             +GL G PG     G I   G +GE G  G  G  GPRGP GE GP G         Y G 
Sbjct  932   QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGA  991

Query  200   YGERGPRGQIGFPGPRGDPGAENVGP-TGVRGEDGD------VGEPGPPG----------  242
              G  G +G+ G PG  G PGA+ V   +G++G+DG+      +G PG PG          
Sbjct  992   NGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGD  1051

Query  243   --PIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKG  300
               P ++    + G +     GP G+PG  G +G    +G+RG+PG+ G  G PG KG+ G
Sbjct  1052  SQPALDGVAGRKGEVGSP--GPNGLPGRHGLKG---QRGDRGLPGQQGRPGEPGAKGLGG  1106

Query  301   VQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGL-----------  349
               GR G  G +G  G PG  G KG +G  G+ G DG  G+ G +G  GL           
Sbjct  1107  YPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQG  1166

Query  350   ----PGLPGLQGPEGDRGIY-----DPTL--DKIEPGVTGPQGPIGPRGEPGEDGYNGKP  398
                  G+PG      DR  Y     D  L  ++ E G  GP G IGP G  GE G  G  
Sbjct  1167  DEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYA  1226

Query  399   GPPGLQGRTGEPGPPGIVGPIGPKGISIPGE------AGVDGTPGPPGQPGVYGPPGIPG  452
             G  G  G  G  G  G  GP GP GI++P E      AG+DG  G PG  G  G PG PG
Sbjct  1227  GQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPG  1286

Query  453   LPGPKG---QQGVTIIGPPGQDG------VPGQDGFKGV---QGDRGDPGVQGPKGIPGQ  500
               GP G    +G  I GPPG  G       PG +G  G+   +G+ GD G QG +G  G 
Sbjct  1287  ENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGY  1346

Query  501   GKPIR----GPPGEPGSPGFPGLEGDVGFPGLPGR------PGLKGPKGN---------D  541
                 R    G  G  G PG+ G +G+ G+PGLPG+      PG +GP G+         D
Sbjct  1347  AIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMD  1406

Query  542   CGFCPPGRPGV-----------KGEAGEAAINGIPGDPGAPGRMG---------------  575
                 P G+PGV           +GE G     G  GD GAPG +G               
Sbjct  1407  GLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQG  1466

Query  576   EKGSRGPDGKMDRLETKDWMG  596
             E G  G DG   +   K +MG
Sbjct  1467  EVGYTGADGPQGQRGDKGYMG  1487


 Score = 157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 237/636 (37%), Positives = 298/636 (47%), Gaps = 123/636 (19%)

Query  43    GIVGLPGEKGVRGIEG--------AEGNPG---DTGPDGPPGPPGKEGIMGEWGETGEKG  91
             G +GL GE G RG  G        A+G PG   D G  G PG PG++G  G  G  G KG
Sbjct  743   GAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKG  802

Query  92    MRG------DKGFQGPKGRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAG  136
              RG       +G  GP GR+G++G+PG           G PGPKG+ G  G DGA G  G
Sbjct  803   QRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG  862

Query  137   IPGTSGKRGEF--------------------GADGQRGLRGDPGEGGIN-SKGTKGESGV  175
             +PG  G+RG+F                    GA GQ+G  G  G+ G N +KG+ G SG 
Sbjct  863   LPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGR  922

Query  176   YGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAE----NVGPTGVRGE  231
              G+ G  G +G  G  G PG  G  GE G RG+IG+ G +GD G        GP G+ G+
Sbjct  923   RGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGD  982

Query  232   DGDVGEPGPPGPIIEDTEQKPGNISY----SFKGPKGMPGARGDRGPYGLKGERGVPGRP  287
             DG  G PG  G  +   + + GN  +      KG     G +GD G  GL G  G PG P
Sbjct  983   DGPDGYPGANG--LPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAP  1040

Query  288   GIDGYPGIKG-----VKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPG  342
             G  G  G  G     + GV GR+G  G  G +G PG  G+KG +G  GL G+ G PGEPG
Sbjct  1041  GAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPG  1100

Query  343   SKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPG  402
             +KG  G PG  G+ G +G              G  GPQGP GP+GE G  G +G+     
Sbjct  1101  AKGLGGYPGRNGINGLKG------------ATGFPGPQGPKGPQGESGVVGLDGR-----  1143

Query  403   LQGRTGEPGPPGIVGPIGPKG-------ISIPGE-------------AGVDGTPGPPGQP  442
               G+ G+ GP G++G  G +G       + IPG               G  G  G  G+ 
Sbjct  1144  -NGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQ  1202

Query  443   GVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGK  502
             G  GP G  G PG KG++G   IG  GQ G  G +G KG QGD      QGP+G PG   
Sbjct  1203  GDMGPIGFIGPPGAKGERG--DIGYAGQLGFDGAEGLKGFQGD------QGPRGPPGITL  1254

Query  503   PIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAIN  562
             P      E G  G  GL+G  G PG  G+ G  GP         PG  G  G  G     
Sbjct  1255  PA-----EKGDEGVAGLDGRAGRPGHFGQKGAPGP---------PGENGPNGAIGHRGPQ  1300

Query  563   GIPGDPGAPGRMGEKGSRGPDGKMDRLETKDWMGNM  598
              I G PG  G +G  G+ G +G+   +  K  +G+M
Sbjct  1301  -IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDM  1335


 Score = 151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 219/588 (37%), Positives = 270/588 (46%), Gaps = 80/588 (14%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G+ G+ GE G RG  G  G  GD GP GP G  G +G+ G+ G  G  G  G  G +G  
Sbjct  942   GLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGET  1001

Query  103   GRAGLQGYPGPPG---YPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFG--------ADG  151
             G  G  G PG  G   Y G KG DG +G  G  G  G PG  G+RG  G          G
Sbjct  1002  GNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAG  1061

Query  152   QRGLRGDPGEGGI-NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIG  210
             ++G  G PG  G+    G KG+ G  G+PG QG  G  G +G  GY G  G  G +G  G
Sbjct  1062  RKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATG  1121

Query  211   FPGPRGDPGAE-NVGPTGVRGEDGDVGEPGPPGPI--------------------IEDTE  249
             FPGP+G  G +   G  G+ G +G +G+ GP G I                    +E+  
Sbjct  1122  FPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLR  1181

Query  250   QKPGNISYSFKGPKGMPGARG---DRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREG  306
              +  +    F G +G+ G RG   D GP G  G  G  G  G  GY G  G  G +G +G
Sbjct  1182  DR--SFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKG  1239

Query  307   WRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYD  366
             ++G +G  G PG   +  +KG  G+AG DG  G PG  G +G PG PG  GP G  G   
Sbjct  1240  FQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRG  1298

Query  367   PTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGL---QGRTGEPGPPG--IVGPIGP  421
             P +     G  GPQG +G  G PG +G +G  GP G     GR GE G  G  IVG  G 
Sbjct  1299  PQIQ----GPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGD  1354

Query  422   KG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFK  480
              G I   GE G DG  G  G PG+ G  G  G PGP+G        P G  G  G DG  
Sbjct  1355  IGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRG--------PTGDAGWGGIDGMD  1406

Query  481   GVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGL------EGDVGFPGLPGRPGL  534
             G+ G +G PGV     +             PG  G PGL      EGD G PGL G  G 
Sbjct  1407  GLVGPKGQPGVTYSYSMA-----------RPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQ  1455

Query  535   KGPKGN-----DCGFC-PPGRPGVKGEAGEAAINGIPGDPGAPGRMGE  576
             +G  G      + G+    G  G +G+ G   + G PG  G PG  GE
Sbjct  1456  RGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1503


 Score = 151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 213/579 (37%), Positives = 251/579 (43%), Gaps = 107/579 (18%)

Query  55   GIEGAEGNPGDTGPDGPPGPPGKEGIMGEW---------------GETGEKGMRGD--KG  97
            G+ G  G+PG  G  GPPG   + G  G++               G  G  G+ G+  + 
Sbjct  391  GLAGQSGDPGLNGSRGPPGRS-ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN  449

Query  98   FQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPG----------------IAGIPGTS  141
              GPKG  GL G PG  GY G +G  G  G  G PG                  G+PG  
Sbjct  450  VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDD  509

Query  142  GKRGEFGADGQRGLRGDPG-EGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPY  200
            G  G  G  G++GLRGD         +G +G+ G  G PG  G RG +G  GP G QG  
Sbjct  510  GYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQ  569

Query  201  GERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISYSFK  260
            G  G  G  G PGP G PG           E G VG  GP G  IE    + G I     
Sbjct  570  GNPGRAGHKGLPGPAGIPG-----------EPGKVGAAGPDGKAIEVGSLRKGEI-----  613

Query  261  GPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDA  320
                     GD G  G +G+ G  G  G DG  G KG          RG+ G+ G  GDA
Sbjct  614  ---------GDTGDSGHRGDTGDDGEKGRDGSDGSKGE---------RGETGQRGDYGDA  655

Query  321  GVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQ  380
            G +G  G PG  GRDG+PG   +     L G PG  G +G+RG    T  K   G   P 
Sbjct  656  GYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPG  715

Query  381  GPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPG  440
                  GEPGEDGY G  G  G +G  G  G  G +G  GP G  IPG  G  G PGP G
Sbjct  716  QIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTG  775

Query  441  QPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ  500
                YG  G PGL              PG+DG PG DG  G +G RG PG +  +G    
Sbjct  776  D---YGQQGAPGL--------------PGRDGEPGLDGGIGYKGQRGVPGQEVIQGEI--  816

Query  501  GKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGN---DCGFCPPGRPGVKGEAG  557
                 GPPG  G  GFPG  G  G  GL GRPG KG KG    D      G PG KG+ G
Sbjct  817  -----GPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG  871

Query  558  EAAI-----------NGIPGDPGAPGRMGEKGSRGPDGK  585
            +  +           NG     GA G+ GE GS G +G+
Sbjct  872  DFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQ  910


 Score = 147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 220/609 (36%), Positives = 264/609 (43%), Gaps = 133/609 (22%)

Query  50    EKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQG  109
              KG  G  G  G+ GDTG DG  G  G +G  GE GETG++G  GD G+QG  G  G  G
Sbjct  609   RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDG  668

Query  110   YPGPPGY------------PGPKGLDGCNGTDGAPGIAGIPG---------TSGKRGEFG  148
               G PG             PG  G+ G  G DG  G  G+ G          +G+ GE G
Sbjct  669   RDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDG  728

Query  149   ADGQRGLRGDPGEGG-------INSKGTKGES--GVYGIPGLQGPRGPMGERGPPGYQGP  199
               G +G++G  GE G       I  +G  GE   G  G  G  GP G  G++G PG  G 
Sbjct  729   YTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGR  788

Query  200   YGERGPRGQIGFPGPRGDPGAENV-------GPTGVRGEDGDVGEPGP------PGPIIE  246
              GE G  G IG+ G RG PG E +       G +G++G  GDVG PG       PGP   
Sbjct  789   DGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGV  848

Query  247   DTEQKPGNISYSFKGPKGMPGARGDRG--------------------PYGLKGERGVPGR  286
               EQ P        G  G+PG +G RG                    P+G KG++G  G 
Sbjct  849   KGEQGPDGAV----GQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGS  904

Query  287   PGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAGV---------KGDKGAPGLAGRDGS  337
              G +G  G KG  G  GR G  G  G  G PG  G+          G++G  G  GR G 
Sbjct  905   LGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD  964

Query  338   PGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGK  397
              G  G  G+ G  GL G  GP                                 DGY   
Sbjct  965   IGPRGPNGEFGPKGLSGDDGP---------------------------------DGY---  988

Query  398   PGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPK  457
             PG  GL GR GE G PG  G  G KG+     A   G  G  G+ G+ GP G PG PG K
Sbjct  989   PGANGLPGRKGETGNPGFPGRPGAKGV-----AAYSGIKGDDGESGLTGPIGYPGAPGAK  1043

Query  458   GQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFP  517
             GQ+G      P  DGV G+ G  G  G  G PG  G KG  G     RG PG+ G PG P
Sbjct  1044  GQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGD----RGLPGQQGRPGEP  1099

Query  518   GLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEK  577
             G +G  G+PG  G  GLKG  G       PG  G KG  GE+ + G+       GR G+ 
Sbjct  1100  GAKGLGGYPGRNGINGLKGATGF------PGPQGPKGPQGESGVVGL------DGRNGQI  1147

Query  578   GSRGPDGKM  586
             G +GP G +
Sbjct  1148  GDQGPRGLI  1156


 Score = 137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 238/665 (36%), Positives = 291/665 (44%), Gaps = 147/665 (22%)

Query  60   EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
             G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190  RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97   GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
              +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250  TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154  GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
            G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310  GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206  -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                             RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370  GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235  ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                       G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430  PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285  GR-------------------PGIDGYPGIKGV---KGVQGRE---------GWRGKEGK  313
            G                    PG DGY G++G+   KG++G +         G RG+EG 
Sbjct  485  GEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314  DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
             G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545  TGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374  PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
             G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605  VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429  EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
            E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663  EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467  PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
             PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723  EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526  PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRMGEKGS  579
            PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+ G  G 
Sbjct  783  PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  580  RGPDG  584
             GP G
Sbjct  843  PGPKG  847


>O18407_DROME unnamed protein product
Length=1761

 Score = 250 bits (638),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 268/580 (46%), Positives = 327/580 (56%), Gaps = 17/580 (3%)

Query  13   VFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPP  72
            V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG  GD GP G  
Sbjct  16   VYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRA  71

Query  73   GPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAP  132
            GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+DGC+G  G  
Sbjct  72   GPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQ  131

Query  133  GIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERG  192
            G +G PG +G RG  G   Q+G  G+ GEGGINSKGTKG  G  G PG  GP G  G+RG
Sbjct  132  GPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRG  191

Query  193  PPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKP  252
              G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG       D+    
Sbjct  192  SKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG-------DSLSGV  244

Query  253  GNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEG  312
                 + KG KG  G +GD GP G  GE+G  GR G+       G +G  G  G RGK G
Sbjct  245  LKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEIGGPGERGKPG  298

Query  313  KDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKI  372
            KDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  GIYDP+L K 
Sbjct  299  KDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKS  358

Query  373  EPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGV  432
             PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP G S  GEAG 
Sbjct  359  LPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGD  418

Query  433  DGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQ  492
             G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G +GDRG+ G+ 
Sbjct  419  YGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLP  478

Query  493  GPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGV  552
            G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC  C  G  G 
Sbjct  479  GDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGP  538

Query  553  KGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMDRLETK  592
            +G+ G+    G  G+ GA G  G +G +G  G   R   K
Sbjct  539  RGQEGDTGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHK  578


 Score = 166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 228/593 (38%), Positives = 278/593 (47%), Gaps = 117/593 (20%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G+ GLPGEKG+RG         D  P    GP G  G  G+ G  G  G RG  G  GP+
Sbjct  513   GLRGLPGEKGLRG---------DDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAGPR  563

Query  103   GRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQ--------RG  154
             G  GLQG PG  G+             G PG AGIPG  GK G  G DG+        +G
Sbjct  564   GVQGLQGNPGRAGH------------KGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKG  611

Query  155   LRGDPGEGGIN-SKGTKGESGVYGIPGLQGPRGPMGER---GPPGYQGPYGERGPRGQIG  210
               GD G+ G     G  GE G  G  G +G RG  G+R   G  GYQG  GE G  G+ G
Sbjct  612   EIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDG  671

Query  211   FPGPR---------GDPGAENVGPTGVRGEDGDVGEPGPPGP----IIEDTEQKPGNISY  257
              PG           G+PG + +   G RG+DGD G  G  G      I D   +PG   Y
Sbjct  672   APGRNATTPKVYLIGEPGYDGI--KGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGY  729

Query  258   SFKGPKGMPGARGDRGPYGLKGERG--------VPGRPGIDGYPGIKGVKGVQGREGWRG  309
             +  GPKG+ GA+G++G  GL+GE G        +PG  G  GYPG  G  G QG  G  G
Sbjct  730   T--GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPG  787

Query  310   KEGKDGRPGDAGVKGDKGAPG---LAGRDGSPGEPGSK---GDEGLPGLPGLQGPEGDRG  363
             ++G+ G  G  G KG +G PG   + G  G PG  G K   GD G PG  GL G  G +G
Sbjct  788   RDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKG  847

Query  364   IYDPTLDKIEPGVTGPQGPIGPRGEPGEDGY-----------------NGKPGPPGLQGR  406
             +          G  GP G +G  G PG  G                  NG+  P G +G+
Sbjct  848   V---------KGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQ  898

Query  407   TGEPGPPGIVGPIGPKG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTII  465
              GE G  G  G  G KG I   G  G+ G        G+ G PGIPGLPG        +I
Sbjct  899   KGEVGSLGQNGQNGAKGSIGFSGRRGLLGN-----LQGLPGSPGIPGLPG--------MI  945

Query  466   GPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGF  525
             G  G+ G  G +G +G  G RG  G  GPKG+ G      GP G PG+ G PG +G+ G 
Sbjct  946   GEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGD----DGPDGYPGANGLPGRKGETGN  1001

Query  526   PGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKG  578
             PG PGRPG KG              G+KG+ GE+ + G  G PGAPG  G++G
Sbjct  1002  PGFPGRPGAKGVAAYS---------GIKGDDGESGLTGPIGYPGAPGVKGQRG  1045


 Score = 163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 248/663 (37%), Positives = 296/663 (45%), Gaps = 161/663 (24%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G  G PG  G  G +GA G PG    DG PG  G  G  G+ G  G++ ++G+    GP 
Sbjct  766   GAKGYPGPTGDYGQQGAPGLPGR---DGEPGLDGGIGYKGQRGVPGQEVIQGEI---GPP  819

Query  103   GRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEF------  147
             GR+G++G+PG           G PGPKG+ G  G DGA G  G+PG  G+RG+F      
Sbjct  820   GRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPG  879

Query  148   --------------GADGQRGLRGDPGEGGIN-SKGTKGESGVY-------------GIP  179
                           GA GQ+G  G  G+ G N +KG+ G SG               GIP
Sbjct  880   PKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNLQGLPGSPGIP  939

Query  180   GLQGPRGPMGERGPPGY---QGPYGERGPRGQIGFPGPRGDPGAENV-GPTGVRGEDGDV  235
             GL G  G +GERG  GY   QG  G RGP G+ G  G  GD G +   G  G+ G  G+ 
Sbjct  940   GLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGET  999

Query  236   GEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGI  295
             G PG PG        +PG      KG     G +GD G  GL G  G PG PG+ G  G 
Sbjct  1000  GNPGFPG--------RPGA-----KGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGP  1046

Query  296   KG-----VKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLP  350
              G     + GV GR+G  G  G +G PG  G+KG +G  GL G+ G PGEPG+KG  G P
Sbjct  1047  VGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYP  1106

Query  351   GLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDG-----------------  393
             G  G+ G             K   G  GPQGP GP+GE G  G                 
Sbjct  1107  GRNGINGL------------KAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLI  1154

Query  394   -----------------------------YNGKPGPPGLQGRTGEP---GPPGIVGPIGP  421
                                          Y G  G  GLQG  GE    GP G +GP G 
Sbjct  1155  GEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGA  1214

Query  422   KG----ISIPGEAGVDGTPGPPGQPGVYGPPGIPG--LPGPKGQQGVTIIGPPGQDGVPG  475
             KG    I   G+ G DG  G  G  G  GP G PG  LP  KG +GV      G DG  G
Sbjct  1215  KGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA-----GLDGRAG  1269

Query  476   QDGFKGVQGDRGDPGVQGPKGIPGQGKP-IRGPPGEPGSPGFPGLEGDVGFPGLPGRPGL  534
             + G  G +G  G PG  GP G  G   P I+GPPG  G  GFPG       PG  GR GL
Sbjct  1270  RPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGA------PGHNGRHGL  1323

Query  535   KGPKGNDCGFCPPGRPGVKGEAGEAAIN--------GIPGDPGAPGRMGEKGSRGPDGKM  586
              GPKG        GR G +GE+G A +         G  G+PG  G  GE+G  G  GK 
Sbjct  1324  IGPKGE---LGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKN  1380

Query  587   DRL  589
              R+
Sbjct  1381  GRV  1383


 Score = 157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 261/743 (35%), Positives = 325/743 (44%), Gaps = 189/743 (25%)

Query  43    GIVGLPGEKGVRGIEG--------AEGNPG---DTGPDGPPGPPGKEGIMGEWGETGEKG  91
             G +GL GE G RG  G        A+G PG   D G  G PG PG++G  G  G  G KG
Sbjct  743   GAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKG  802

Query  92    MRG------DKGFQGPKGRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAG  136
              RG       +G  GP GR+G++G+PG           G PGPKG+ G  G DGA G  G
Sbjct  803   QRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG  862

Query  137   IPGTSGKRGEF--------------------GADGQRGLRGDPGEGGIN-SKGTKGESGV  175
             +PG  G+RG+F                    GA GQ+G  G  G+ G N +KG+ G SG 
Sbjct  863   LPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGR  922

Query  176   YG-------------IPGLQGPRGPMGERGPPGY---------QGPYGERGPRGQIGFPG  213
              G             IPGL G  G +GERG  GY         +GP GE GP+G  G  G
Sbjct  923   RGLLGNLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDG  982

Query  214   PRGDPGAENV----------------------GPTGVRGEDGDVGEPGPPG----PIIED  247
             P G PGA  +                        +G++G+DG+ G  GP G    P ++ 
Sbjct  983   PDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKG  1042

Query  248   TEQKPGNISYSFKGPKGMPGARGDRGPYGL---------KGERGVPGRPGIDGYPGIKGV  298
                  G+   +  G  G  G  G  GP GL         +G+RG+PG+ G  G PG KG+
Sbjct  1043  QRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGL  1102

Query  299   KGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGL---------  349
              G  GR G  G +   G PG  G KG +G  G+ G DG  G+ G +G  GL         
Sbjct  1103  GGYPGRNGINGLKAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGE  1162

Query  350   ------PGLPGLQGPEGDRGIY-----DPTL--DKIEPGVTGPQGPIGPRGEPGEDGYNG  396
                    G+PG      DR  Y     D  L  ++ E G  GP G IGP G  GE G  G
Sbjct  1163  QGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIG  1222

Query  397   KPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGE------AGVDGTPGPPGQPGVYGPPGI  450
               G  G  G  G  G  G  GP GP GI++P E      AG+DG  G PG  G  G PG 
Sbjct  1223  YAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGP  1282

Query  451   PGLPGPKG---QQGVTIIGPPGQDG------VPGQDGFKGV---QGDRGDPGVQGPKGIP  498
             PG  GP G    +G  I GPPG  G       PG +G  G+   +G+ GD G QG +G  
Sbjct  1283  PGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGES  1342

Query  499   GQGKPIR----GPPGEPGSPGFPGLEGDVGFPGLPGR------PGLKGPKGN--------  540
             G     R    G  G  G PG+ G +G+ G+PGLPG+      PG +GP G+        
Sbjct  1343  GYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDG  1402

Query  541   -DCGFCPPGRPGV-----------KGEAGEAAINGIPGDPGAPGRMG-------------  575
              D    P G+PGV           +GE G     G  GD GAPG +G             
Sbjct  1403  MDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGD  1462

Query  576   --EKGSRGPDGKMDRLETKDWMG  596
               E G  G DG   +   K +MG
Sbjct  1463  QGEVGYTGADGPQGQRGDKGYMG  1485


 Score = 154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 222/593 (37%), Positives = 274/593 (46%), Gaps = 80/593 (13%)

Query  44    IVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGD--------  95
             + GLPG  G+ G+ G  G  G+ G  G  G  G  G  G  GE G KG+ GD        
Sbjct  929   LQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPG  988

Query  96    -KGFQGPKGRAGLQGYPGPPG------YPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEF-  147
               G  G KG  G  G+PG PG      Y G KG DG +G  G  G  G PG  G+RG   
Sbjct  989   ANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVG  1048

Query  148   -------GADGQRGLRGDPGEGGI-NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGP  199
                    G  G++G  G PG  G+    G KG+ G  G+PG QG  G  G +G  GY G 
Sbjct  1049  DSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGR  1108

Query  200   YGERGPRGQIGFPGPRGDPGAE-NVGPTGVRGEDGDVGEPGPPGPI--------------  244
              G  G +   GFPGP+G  G +   G  G+ G +G +G+ GP G I              
Sbjct  1109  NGINGLKAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGE  1168

Query  245   ------IEDTEQKPGNISYSFKGPKGMPGAR---GDRGPYGLKGERGVPGRPGIDGYPGI  295
                   +E+   +  +    F G +G+ G R   GD GP G  G  G  G  G  GY G 
Sbjct  1169  VGIPGRLENLRDR--SFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ  1226

Query  296   KGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGL  355
              G  G +G +G++G +G  G PG   +  +KG  G+AG DG  G PG  G +G PG PG 
Sbjct  1227  LGFDGAEGLKGFQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGE  1285

Query  356   QGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGL---QGRTGEPGP  412
              GP G  G   P +     G  GPQG +G  G PG +G +G  GP G     GR GE G 
Sbjct  1286  NGPNGAIGHRGPQIQ----GPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGE  1341

Query  413   PG--IVGPIGPKG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPG  469
              G  IVG  G  G I   GE G DG  G  G PG+ G  G  G PGP+        GP G
Sbjct  1342  SGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPR--------GPTG  1393

Query  470   QDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLP  529
               G  G DG  G+ G +G PGV     +    +P  G  GEPG  GF G EGD G PGL 
Sbjct  1394  DAGWGGIDGMDGLVGPKGQPGVTYSYSMA---RP--GDRGEPGLDGFQGEEGDGGAPGLI  1448

Query  530   GRPGLKGPKGN-----DCGFC-PPGRPGVKGEAGEAAINGIPGDPGAPGRMGE  576
             G  G +G  G      + G+    G  G +G+ G   + G PG  G PG  GE
Sbjct  1449  GFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1501


 Score = 152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 226/588 (38%), Positives = 267/588 (45%), Gaps = 86/588 (15%)

Query  54   RGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGP  113
            RG  G  G  GD G +G  GPPG+     E GE G+ G  G  G QGP G AGL G  G 
Sbjct  387  RGPIGLAGQSGDPGLNGSRGPPGRS----ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGL  442

Query  114  PGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEG-----------  162
             G PG        G  G PG+ G PG  G RG+ G  G  G +G PGEG           
Sbjct  443  HGEPGQN----VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQG  498

Query  163  GINSKGTKGESGVYGIPGL---------------QGPRGPMGERGPPGYQGPYGERGPRG  207
                +G  G+ G YG+ GL                GPRGP G+ G  GY G +G RG   
Sbjct  499  PPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRG---  555

Query  208  QIGFPGPRGDPGAENV----------GPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISY  257
             IG  GPRG  G +            GP G+ GE G VG  GP G  IE    + G I  
Sbjct  556  AIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEI--  613

Query  258  SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRP  317
                        GD G  G +G+ G  G  G DG  G KG          RG+ G+ G  
Sbjct  614  ------------GDTGDSGHRGDTGDDGEKGRDGSDGSKGE---------RGETGQRGDY  652

Query  318  GDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVT  377
            GDAG +G  G PG  GRDG+PG   +     L G PG  G +G+RG    T  K   G  
Sbjct  653  GDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEP  712

Query  378  GPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPG  437
             P       GEPGEDGY G  G  G +G  G  G  G +G  GP G  IPG  G  G PG
Sbjct  713  NPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPG  772

Query  438  PPGQPGVYGPPGIPGLPGPKGQQGVT-IIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKG  496
            P G    YG  G PGLPG  G+ G+   IG  GQ GVPGQ+    +QG+ G PG  G KG
Sbjct  773  PTGD---YGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQE---VIQGEIGPPGRSGIKG  826

Query  497  IPGQ-GKP----IRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPG  551
             PG  G P    + G PG  G  G  G +G VG  GLPG  G +G    D    PPG  G
Sbjct  827  FPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG----DFLVGPPGPKG  882

Query  552  VKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMDRLETKDWMGNME  599
              G  G  A +G  G  G  G +G+ G  G  G +     +  +GN++
Sbjct  883  QPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNLQ  930


 Score = 137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 237/665 (36%), Positives = 288/665 (43%), Gaps = 147/665 (22%)

Query  60   EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
             G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190  RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97   GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
              +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250  TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154  GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
            G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310  GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206  -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                             RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370  GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235  ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                       G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430  PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285  GR-------------------PGIDGYPGIKGVKGVQGREGW------------RGKEGK  313
            G                    PG DGY G++G+ G +G  G             RG+EG 
Sbjct  485  GEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314  DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
             G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545  TGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374  PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
             G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605  VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429  EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
            E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663  EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467  PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
             PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723  EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526  PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRMGEKGS  579
            PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+ G  G 
Sbjct  783  PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  580  RGPDG  584
             GP G
Sbjct  843  PGPKG  847


 Score = 115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 216/501 (43%), Gaps = 127/501 (25%)

Query  43    GIVGLPGEKGV---RGIEGAEGNPGDTGPDGPPGPPG--------------KEGIMGEWG  85
             G  G PG KGV    GI+G +G  G TGP G PG PG               +G+ G  G
Sbjct  1003  GFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKG  1062

Query  86    ETGE------------KGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPG  133
             E G             KG RGD+G  G +GR G  G  G  GYPG  G++G     G PG
Sbjct  1063  EVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPG  1122

Query  134   IAGIPGTSGKRGEFGADGQRGLRGDPGEGGI-----------------------NSKGTK  170
               G  G  G+ G  G DG+ G  GD G  G+                       N +   
Sbjct  1123  PQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRS  1182

Query  171   GESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRG  230
                G  G  GLQG RG  G+ GP G+ GP G +G RG IG+ G  G  GAE     G++G
Sbjct  1183  FYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAE-----GLKG  1237

Query  231   EDGDVGEPGPPGPIIEDTEQKPGNISYSFK-------GPKGMPGARGDRGPYGLKGERG-  282
               GD G  GPPG  +   +   G      +       G KG PG  G+ GP G  G RG 
Sbjct  1238  FQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGP  1297

Query  283   -------------VPGRPGIDGYPGI---KGVKGVQGREGWRGKEGK-------------  313
                           PG PG +G  G+   KG  G  GR+G RG+ G              
Sbjct  1298  QIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIG  1357

Query  314   -DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEG------LPGLPGLQGPEGDRGIY-  365
               G PG  G KG++G PGL G++G  G PG +G  G      + G+ GL GP+G  G+  
Sbjct  1358  FQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTY  1417

Query  366   -----------DPTLDKIE--------PGVTGPQ---GPIGPRGEPGEDGYNGKPGPPGL  403
                        +P LD  +        PG+ G Q   G +G RG+ GE GY G  GP   
Sbjct  1418  SYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGP---  1474

Query  404   QGRTGEPGPPGIVGPIGPKGI  424
             QG+ G+ G  G+ G  G +G+
Sbjct  1475  QGQRGDKGYMGLTGAPGLRGL  1495


 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 72/154 (47%), Gaps = 20/154 (13%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQG  100
              DG  G  G  G+ G  G  G PG  GP G  G          WG     G+ G  G  G
Sbjct  1364  WDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAG----------WG-----GIDGMDGLVG  1408

Query  101   PKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPG  160
             PKG+ G+  Y      PG +G  G +G  G  G  G PG  G +G+ GA G RG +G+ G
Sbjct  1409  PKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVG  1467

Query  161   EGGIN----SKGTKGESGVYGIPGLQGPRGPMGE  190
               G +     +G KG  G+ G PGL+G  GP GE
Sbjct  1468  YTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1501


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 184 bits (466),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 248/660 (38%), Positives = 315/660 (48%), Gaps = 134/660 (20%)

Query  42    DGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKG---------M  92
             DG  G PGE+G  G  G +G  G TGP G  G  G+ G+ G  GE G+           +
Sbjct  593   DGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPL  652

Query  93    RGDKGF---------QGPKGRAGLQGYPGPP---GYPGPKGLDGCNGTDGAPGIA-----  135
             +GDKG+         QG KG  GL G PGP    G+ G KGL G  G DG PG A     
Sbjct  653   KGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGY  712

Query  136   -GIPGTS-----------GKRGEFGADGQRGLRGDPGEGGIN-----SKGTKGESGVYGI  178
              GIPG S           G +G+ G+ G+ G +G+PG   ++     +KG KGE G  G+
Sbjct  713   PGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGM  772

Query  179   P------------------GLQGPRGPMGERGPPGYQGPYGERGPRGQIGF---------  211
             P                  G  GP+GP G  GP G  GP GE+G +G +G          
Sbjct  773   PGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGL  832

Query  212   ---------PGPRGDPGAEN---VGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISY-S  258
                      PGPRG+PG      +GP G+ G  G+ G+ GP GPI        G++ Y  
Sbjct  833   RGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPI--GFPGADGSVGYPG  890

Query  259   FKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPG  318
              +G  G+PG  G  G  G KG+ G  G  G+ G PG+ G+ GV+GR+G +G+ G  G  G
Sbjct  891   DRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVG  950

Query  319   DAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDK-------  371
               G KGD+GAPG  G  G  G  G+ G  G  G+PG+ G +GD+G    T +        
Sbjct  951   MPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRG  1010

Query  372   --IEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGE  429
                 PG+ G +G  G  G PG+ G +G PG  G QG  G  GPPG+ G           E
Sbjct  1011  PPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDA--------SE  1062

Query  430   AGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTI---IGPPGQDGVPGQ---DGFKGVQ  483
              G  G PGP G  G  GP G PG PG KG  G+ +    GPPG+ G  G+   DG  G+ 
Sbjct  1063  KGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGIN  1122

Query  484   GDRGDPGVQGPKGIPGQGKPIRGPPGEPGSP---------------GFPGLEGDVGFPGL  528
             G++G+ G+QG  G PG+ K   G PG PG+P               G+PG  GD G PGL
Sbjct  1123  GEKGEQGLQGVWGQPGE-KGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGL  1181

Query  529   PGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRM----GEKGSRGPDG  584
              G PGLKG  G      P G  G  G  G     GI G PG P  +    G+KGS+G  G
Sbjct  1182  SGLPGLKGETG------PVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERG  1235


 Score = 183 bits (465),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 237/619 (38%), Positives = 291/619 (47%), Gaps = 99/619 (16%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQG  100
              DG VG PG++G  G+ G  G PG  G  G  GP G  G+ G  G  G  G+RG  G +G
Sbjct  882   ADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKG  941

Query  101   PKGRAGLQGYPG------PPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADG---  151
               G  GL G PG       PG  GPKG  G  G  G  G AGIPG SG +G+ GA G   
Sbjct  942   EPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTG  1001

Query  152   ---------------------QRGLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRG  186
                                   +GL G PG+ G++     KG +G  G+ G PGL G   
Sbjct  1002  NDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDAS  1061

Query  187   PMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIE  246
               G++G PG  G  G+ GP G  G+PG +G PG    G  G  GE GD G  G  G    
Sbjct  1062  EKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGI  1121

Query  247   DTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGID----------------  290
             + E          KG +G+ G  G  G  G  G  G+PG PG+D                
Sbjct  1122  NGE----------KGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPG  1171

Query  291   -----GYPGIKGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGL-------------A  332
                  G PG+ G+ G++G  G  G +G  G PG  G +G +G PGL              
Sbjct  1172  DRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQ  1231

Query  333   GRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGE-  391
             G  G  GE G +G+ GL G  G+ G +GDRG+  P       G+ G +G IGPRGE G  
Sbjct  1232  GERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYP  1291

Query  392   ----DGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPGQPGVYGP  447
                  G  G PG PG  GR G  G PG++G  G  G++  GE G+ G PGP G  G  G 
Sbjct  1292  GVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA--GEPGLVGLPGPIGPAGSKGE  1349

Query  448   PGIPGLPGPKGQQGVT-------IIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ  500
              G+ G PG  GQ G           GP G  G  G +GF+G +GD+GD G+QGP G+PG 
Sbjct  1350  RGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGL  1409

Query  501   GKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAA  560
                     G+ G  G+PGL G+ G  G PG  G  GPKG D     PG PG KGE G   
Sbjct  1410  -------VGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLP  1462

Query  561   INGIPGDPGAPGRMGEKGS  579
               G  G+PG PGR G KG 
Sbjct  1463  PPGPKGEPGQPGRNGPKGE  1481


 Score = 181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 252/694 (36%), Positives = 310/694 (45%), Gaps = 167/694 (24%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGE-----------  89
              +G+ GLPG +G  G +G  G PG  G +GPPG  G++G  G  G  G            
Sbjct  420   LNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPG  479

Query  90    -KGMRGDKGF-----QGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDG--------APGIA  135
              +G +GD G      QG KG AG+ GYPG  G  G +G  G  G  G         PG A
Sbjct  480   PEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAA  539

Query  136   GIPGTSGKRGEFGADGQRG---LRGDPGEGGINS-----KGTKGESGVYGIPGLQGPRGP  187
             G PG  G  G  G  GQ+G   ++GD G G  +S     KG KG SG+ GIPG  G RGP
Sbjct  540   GAPGQKGDAGRPGTPGQKGDMGIKGDVG-GKCSSCRAGPKGDKGTSGLPGIPGKDGARGP  598

Query  188   MGERGPPGYQG---------PYGERGPRGQIGFPGPRGDPGAENVGPTG-VRGEDGDVGE  237
              GERG PG +G         P GE+G  G+ G PG  G+PG   +     +    GD G 
Sbjct  599   PGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGY  658

Query  238   PGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGV---------PGRPG  288
             PG PG                FKG +G+PG  G +G +G KGE+G+         PGR G
Sbjct  659   PGAPG----------AKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAG  708

Query  289   IDGYPGI-----KGVKGVQGREGWRGKEGKDGRPGDAG-------------VKGDKGAPG  330
              DGYPGI     KG  G  GR+G +G +G  GR G+ G              KG+KG PG
Sbjct  709   RDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPG  768

Query  331   LAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPG  390
               G  G PGE GS G+ G  GL G  GP+G  G+  P       G  G QG +G  G PG
Sbjct  769   QTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPG  828

Query  391   EDGYNGKPG--------------------PPGLQGRTGEPGPPGIVGPIGPKG----ISI  426
             +DG  G PG                    PPGL G  GE G  G  GPIG  G    +  
Sbjct  829   KDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGY  888

Query  427   PGEAGVDGTPGPPGQPG---------------VYGPPGIPGLPGPKGQQGVT-------I  464
             PG+ G  G PG  G+PG               V GPPG+PG+ G +G+ G         +
Sbjct  889   PGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGL  948

Query  465   IGPPGQDG---VPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPG---  518
             +G PG  G    PG DG KG  G  G PG +GP GIPG    + G  G+ G+ G  G   
Sbjct  949   VGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPG----VSGAKGDKGATGLTGNDG  1004

Query  519   ---------------LEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAING  563
                            ++GD G  G PG+ GL G             PG KG  G   ++G
Sbjct  1005  PVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDG------------MPGEKGNQGFPGLDG  1052

Query  564   ---IPGDPGAPGRMGEKGSRGPDGKMDRLETKDW  594
                +PGD    G+ GE G  G  G      T  W
Sbjct  1053  PPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGW  1086


 Score = 180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 243/643 (38%), Positives = 305/643 (47%), Gaps = 113/643 (18%)

Query  38    TCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKG  97
              C+   I  L G+KG  G  GA+G  G  G +G PG PG +G   E+G  GEKG+ G  G
Sbjct  643   LCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKG---EFGFKGEKGLSGAPG  699

Query  98    FQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADG------  151
               G  GRAG  GYPG PG    KG  G +G DGA G  G  G SG++GE G+        
Sbjct  700   NDGTPGRAGRDGYPGIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKM  758

Query  152   -QRGLRGDPGEGGI----NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPR  206
               +G +G+PG+ G+       G+ GE G  G+ G  GP+GP G  GP G  GP GE+G +
Sbjct  759   PAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQ  818

Query  207   GQIGFPG------------------PRGDPGAEN---VGPTGVRGEDGDVGEPGPPGPI-  244
             G +G PG                  PRG+PG      +GP G+ G  G+ G+ GP GPI 
Sbjct  819   GAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIG  878

Query  245   ------------------IEDTEQKPGNISYS----------FKGPKGMPGARGDRGPYG  276
                               +     +PG +               GP G+PG  G RG  G
Sbjct  879   FPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDG  938

Query  277   LKGE------RGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPG  330
              KGE       G+PG  G  G PG  G KG  G  G  GK G  G PG +G KGDKGA G
Sbjct  939   AKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATG  998

Query  331   LAGRDGSPGEP---------GSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQG  381
             L G DG  G           G KGD+GL G PG QG +G  G      +K   G  G  G
Sbjct  999   LTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPG------EKGNQGFPGLDG  1052

Query  382   PIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPGQ  441
             P G  G+  E G  G+PGP GL+G TG  G PG  G  G  G+++ G AG  G  G  G+
Sbjct  1053  PPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGR  1112

Query  442   PGVYGPPGIPGLPGPKGQQGVT-------IIGPPGQDGVPGQD------------GFKGV  482
              G+ G  GI G  G +G QGV         +G PG  G PG D            G+ G 
Sbjct  1113  SGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGD  1172

Query  483   QGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGR-PGLKGPKGND  541
             +GD+G+PG+ G  G+ G+  P+ G  G  G+PG  G  G  G PGLP   P ++G KG+ 
Sbjct  1173  RGDKGEPGLSGLPGLKGETGPV-GLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQ  1231

Query  542   CGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDG  584
                   G  G  GE GE    G+ G  G  G  G++G +GP G
Sbjct  1232  ------GERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPG  1268


 Score = 178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 220/558 (39%), Positives = 276/558 (49%), Gaps = 88/558 (16%)

Query  42    DGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGP  101
              G+ G PG++G+ G+ G +GN G  G DGPPG PG     G+ GE G  G+RGD G  G 
Sbjct  1024  QGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGT  1083

Query  102   KGRAGLQGYPGPPGY-----PGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLR  156
              G  G +G PG   +     PG KG  G +G DG  GI G  G  G +G +G  G++G  
Sbjct  1084  PGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSV  1143

Query  157   GDPGEGGI-------------------NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ  197
             G PG  G                      +G KGE G+ G+PGL+G  GP+G +G  G  
Sbjct  1144  GAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAP  1203

Query  198   GPYGERGPRGQIGFPGP----RGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPG  253
             GP GERG RGQ G P      RGD G++  G  G  GE G+ GE G              
Sbjct  1204  GPKGERGIRGQPGLPATVPDIRGDKGSQ--GERGYTGEKGEQGERG--------------  1247

Query  254   NISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGW-----R  308
                    GP G+ GA+GDRG       +G PG  G++G PG KG  G +G  G+     +
Sbjct  1248  -----LTGPAGVAGAKGDRG------LQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIK  1296

Query  309   GKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIY---  365
             G++G  GRPG  G +G  GAPGL G  G PG  G  G  GLPG  G  G +G+RG+    
Sbjct  1297  GEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSP  1356

Query  366   -DPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGI  424
               P  D   PG  G +G  GP+G  GE G NG  G  G +G  G  GP G+ G +G KG 
Sbjct  1357  GQPGQDGF-PGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGD  1415

Query  425   S-IPGEAGVDGTPGPPGQPGVYGPPG------IPGLPGPKGQQGVTII------------  465
             +  PG  G DG  G PG+ G  GP G       PGLPG KG+ G+               
Sbjct  1416  TGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGR  1475

Query  466   -GPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ-GKPIRGPPGEPGSPGFPGLEGDV  523
              GP G+ G PG+ G  G+QG+RG+ G +G  G  G  G+P  GP G+ G PG  G EG +
Sbjct  1476  NGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRP--GPKGDRGEPGERGYEGAI  1533

Query  524   GFPGLPGRPGLKGPKGND  541
             G  G  G PG   P   D
Sbjct  1534  GLIGQKGEPGAPAPAALD  1551


 Score = 178 bits (451),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 245/659 (37%), Positives = 303/659 (46%), Gaps = 133/659 (20%)

Query  25   SHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEW  84
            +  +G  GC  +      G  GLPG  G  G++G  G PG    +GP G  G++G  G +
Sbjct  72   NCTAGYAGCVPKCIAE-KGNRGLPGPLGPTGLKGEMGFPGM---EGPSGDKGQKGDPGPY  127

Query  85   GETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKR  144
            G+ G+KG RG  G  G  G  G+QG  G PG PG  G DGC+G DG PG+ G+ G  G R
Sbjct  128  GQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPR  187

Query  145  GEFGADGQRGLRGDPG-EGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGER  203
            G  G  G +G +G+P  E G  +KG KGE G  G  GL GP+G  GE+G  G  GPYG +
Sbjct  188  GYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAK  247

Query  204  GPRGQIGFPGPRGDPGAENVGPT--GVRGEDGDVGEPGPPGPIIEDTEQKPGNISYSFKG  261
            GPRG+ G    +G+ GA   GP   G  G  G+ GEP    P+      KP   +++  G
Sbjct  248  GPRGEHGL---KGEKGASCYGPMKPGAPGIKGEKGEPASSFPV------KP---THTVMG  295

Query  262  PKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAG  321
            P+G  G +G+ G  G KGE G  G  G+DG    KG KG+ G  G RG++G  G PG  G
Sbjct  296  PRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQ---KGEKGLPGGPGDRGRQGNFGPPGSTG  352

Query  322  VKGDKGAPGLAGRDGSPGE-----------------------------------------  340
             KGD+G PGL G  G+PG+                                         
Sbjct  353  QKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYV  412

Query  341  --PGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKP  398
              PG +G  G+ GLPG QG  G +G          PG  G +GP G +GE G  G NG  
Sbjct  413  GAPGPQGLNGVDGLPGPQGYNGQKG------GAGLPGRPGNEGPPGKKGEKGTAGLNG--  464

Query  399  GPPGLQGRTGE-----------------------------PGPPGIVGPIGPKGIS----  425
             P G  G  G                              PG PG+ G  G +G      
Sbjct  465  -PKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAG  523

Query  426  IPGEA--GVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGV----------TIIGPPGQD--  471
             PG++  G  GTPG  G PG  G  G PG PG KG  G+             GP G    
Sbjct  524  APGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGT  583

Query  472  ----GVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPG  527
                G+PG+DG +G  G+RG PG +G  GI GQ     GPPGE G  G  GL G  G PG
Sbjct  584  SGLPGIPGKDGARGPPGERGYPGERGHDGINGQ----TGPPGEKGEDGRTGLPGATGEPG  639

Query  528  LPGRPGLK--GPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDG  584
             P    L    P   D G+  PG PG KG  G     G+PG PG  G  G KG +G  G
Sbjct  640  KPALCDLSLIEPLKGDKGY--PGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSG  696


 Score = 174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 236/609 (39%), Positives = 292/609 (48%), Gaps = 86/609 (14%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G+ GL GEKG RG  G  G PG    DG  G PG  G  G  G +G  G+ G+KG  GP 
Sbjct  860   GLNGLQGEKGDRGPTGPIGFPG---ADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPI  916

Query  103   GRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEG  162
             G AG+ G PG PG  G +G DG  G  G+PG+ G+PG  G RG  G DG +G  G  G  
Sbjct  917   GPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAP  976

Query  163   GIN-------SKGTKGESGVYGIPG---------------LQGPRGPMGERGPPGYQGPY  200
             G           G KG+ G  G+ G               L G +G  G  G PG QG  
Sbjct  977   GKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLD  1036

Query  201   GERGPRGQIGFPGPRGDPGAE----------NVGPTGVRGEDGDVGEPGPPGPIIEDTEQ  250
             G  G +G  GFPG  G PG              GP+G+RG+ G  G PG PG        
Sbjct  1037  GMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPG--------  1088

Query  251   KPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGK  310
             + G    +  G  G PG +GD      +G  G+ GR GI+G  G +G++GV G+ G +G 
Sbjct  1089  EKGLPGLAVHGRAGPPGEKGD------QGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGS  1142

Query  311   EGKDGRPGDAGV------------------KGDKGAPGLAGRDGSPGEPGSKGDEGLPGL  352
              G  G PG  G+                  +GDKG PGL+G  G  GE G  G +G  G 
Sbjct  1143  VGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGA  1202

Query  353   PGLQGPEGDRGIY-DPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPG  411
             PG   P+G+RGI   P L    P + G +G  G RG  GE G  G+ G  G  G  G  G
Sbjct  1203  PG---PKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKG  1259

Query  412   PPGIVGPIGPKGIS-IPGEAGVDGTPGPPGQPGVY--GPPGIPGLPGPKGQQGVTIIGPP  468
               G+ GP G  G++ IPG  G  G  G  G PGV   G  G+PG PG  G+QG  +IG P
Sbjct  1260  DRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQG--LIGAP  1317

Query  469   GQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPG---LEGDVGF  525
             G  G  G  G  G  G  G PG  GP G  G+ + + G PG+PG  GFPG   L+GD G 
Sbjct  1318  GLIGERGLPGLAGEPGLVGLPGPIGPAGSKGE-RGLAGSPGQPGQDGFPGAPGLKGDTGP  1376

Query  526   PGLPGRPGL------KGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGS  579
              G  G  GL      KG KG+     P G PG+ G+ G+    G+ G+ G  G  GE+G 
Sbjct  1377  QGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGF  1436

Query  580   RGPDGKMDR  588
              GP G+  R
Sbjct  1437  TGPKGRDGR  1445


 Score = 168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 240/630 (38%), Positives = 296/630 (47%), Gaps = 108/630 (17%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDT-----------------GPDGPPGPPGKEGIMGEWG  85
             G  GL G KG RG +G  G PGD+                 G  G PG PG++G MG  G
Sbjct  505   GYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKG  564

Query  86    ETGEKGMRGDKGFQGPKGRAGLQGYPG------PPG---YPGPKGLDGCNGTDGAPG---  133
             + G K      G +G KG +GL G PG      PPG   YPG +G DG NG  G PG   
Sbjct  565   DVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKG  624

Query  134   ---IAGIPGTSGKRGEFGA---------DGQRGLRGDPGEGGINSKGTKGESGVYGIPGL  181
                  G+PG +G+ G+             G +G  G PG  G+  +G KG  G+ GIPG 
Sbjct  625   EDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGV--QGFKGAEGLPGIPGP  682

Query  182   QGPRGPMGERGPPGYQGPYGERGPRGQIGFPG-----PRGDPGAE-NVGPTGVRGEDGDV  235
             +G  G  GE+G  G  G  G  G  G+ G+PG      +G+PG     G  G +G  G  
Sbjct  683   KGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRS  742

Query  236   GEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGI  295
             GE G PG    D  + P   +    G  GMPG  G+ G  G +G  G+ G  G  G PG+
Sbjct  743   GEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGV  802

Query  296   KGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSK--GDEGLPGLP  353
             +G +G+ G  G +G +G  G PG+ G  G +G PG  G+ G  GEPG    G  G PGL 
Sbjct  803   EGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLN  862

Query  354   GLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGY---NGKPGPPGLQGRTGEP  410
             GLQG +GDR               GP GPIG  G  G  GY    G  G PG+ GR G  
Sbjct  863   GLQGEKGDR---------------GPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIV  907

Query  411   GPPGIVGPIGPKGIS-------IPGEAGVDGTPGPPGQPGVYGPP------GIPGLPGPK  457
             G  G VGPIGP G++       I G  G DG  G PG PG+ G P      G PG  GPK
Sbjct  908   GEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPK  967

Query  458   GQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPK---------------GIPGQGK  502
             G  GVT  G PG+ G  G  G  G +GD+G  G+ G                 GI G  +
Sbjct  968   GFAGVT--GAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGD-Q  1024

Query  503   PIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAIN  562
              + G PG+ G  G PG +G+ GFPGL G PGL G          PG  G++G+ G A   
Sbjct  1025  GLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTP  1084

Query  563   GIPGDPGAPGRM--------GEKGSRGPDG  584
             G PG+ G PG          GEKG +G  G
Sbjct  1085  GWPGEKGLPGLAVHGRAGPPGEKGDQGRSG  1114


 Score = 119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 206/446 (46%), Gaps = 88/446 (20%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIM---------------GEWG  85
              DG  G+ GEKG +G++G  G PG+ G  G PG PG  G+                G+ G
Sbjct  1115  IDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRG  1174

Query  86    ETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGT-DGAPGIAGIPGTSGKR  144
             + GE G+ G  G +G  G  GLQG+ G PG  G +G+ G  G     P I G  G+ G+R
Sbjct  1175  DKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGER  1234

Query  145   GEFGADGQRGLRGDPGEGGIN-SKGTKG------ESGVYGIPGLQGPRGPMGERGPPGY-  196
             G  G  G++G RG  G  G+  +KG +G       SG+ GIPG +G  GP GE G PG  
Sbjct  1235  GYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVT  1294

Query  197   ----------------QGPYGERGPRGQIGFPGPRGDPGAEN----VGPTGVRGEDGDVG  236
                             QG  G  G  G+ G PG  G+PG       +GP G +GE G  G
Sbjct  1295  IKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAG  1354

Query  237   EPGPPGP--------IIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPG  288
              PG PG         +  DT  +         G +G  G +GDRG  G  G  G+ G+ G
Sbjct  1355  SPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKG  1414

Query  289   IDGYPGIKGVKG---VQGREGWRGKEGKDGRPGDAGVKGDKGAPGLA-------------  332
               GYPG+ G  G     G  G+ G +G+DGR G  G+ G KG PG+              
Sbjct  1415  DTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPG  1474

Query  333   -----GRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRG  387
                  G  G PGE       GL G+ G +G +G+RG+        E G  G  GP G RG
Sbjct  1475  RNGPKGEPGRPGE------RGLIGIQGERGEKGERGLIG------ETGNVGRPGPKGDRG  1522

Query  388   EPGEDGYNGKPGPPGLQGRTGEPGPP  413
             EPGE GY G     GL G+ GEPG P
Sbjct  1523  EPGERGYEGA---IGLIGQKGEPGAP  1545


 Score = 112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 186/519 (36%), Positives = 229/519 (44%), Gaps = 117/519 (23%)

Query  152  QRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIGF  211
            ++G RG PG   +   G KGE    G PG++GP G  G++G PG   PYG+RG +G+ G 
Sbjct  87   EKGNRGLPGP--LGPTGLKGE---MGFPGMEGPSGDKGQKGDPG---PYGQRGDKGERGS  138

Query  212  PGPRGDPG-------AENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISYSFKGPKG  264
            PG  G  G       A N G  G+ G+DG  G+ G PG                 +G  G
Sbjct  139  PGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPG----------------LEGLSG  182

Query  265  MPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAGVKG  324
            MPG RG  G  G KGE+G P +   D Y      KG +G  GWRG  G  G  G  G KG
Sbjct  183  MPGPRGYAGQLGSKGEKGEPAKENGD-Y-----AKGEKGEPGWRGTAGLAGPQGFPGEKG  236

Query  325  DKGAPGLAGRDGSPGEPGSKGDEGL-------PGLPGLQGPEGDRGIYDPTLDKIEPGVT  377
            ++G  G  G  G  GE G KG++G        PG PG++G +G+     P   K    V 
Sbjct  237  ERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPV--KPTHTVM  294

Query  378  GPQGPIGPRGEPGEDGYNGKPGP---PGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDG  434
            GP+G +G +GEPG  G  G+PGP    GL G+ GE G PG  G  G +G   P   G  G
Sbjct  295  GPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGP--PGSTG  352

Query  435  TPGPPGQPGVYGPPGIPGLPGPKGQQGVT-----------------------------II  465
              G  G+PG+ G PG PG  G  G+ G T                              +
Sbjct  353  QKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYV  412

Query  466  GPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGL------  519
            G PG  G+ G DG  G QG  G  G  G  G PG      GPPG+ G  G  GL      
Sbjct  413  GAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGN----EGPPGKKGEKGTAGLNGPKGS  468

Query  520  ---------------EGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGI  564
                           +GD G PG     G++G KG D G   PG PG+KG  GE    G 
Sbjct  469  IGPIGHPGPPGPEGQKGDAGLPGY----GIQGSKG-DAGI--PGYPGLKGSKGERGFKGN  521

Query  565  PGDPG-----APGRMGEKGSRGPDGKMDRLETKDWMGNM  598
             G PG      PG  G  G+ G  G   R  T    G+M
Sbjct  522  AGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDM  560


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 135/303 (45%), Gaps = 49/303 (16%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDT--GPDGPPGPPGKEGIMGEWGETGEKGMRGDKGF  98
               G+ G+PG KG  G  G  G PG T  G  G PG PG+ G  G  G  G  G RG  G 
Sbjct  1269  ASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGL  1328

Query  99    QGPKGRAGLQGYPGPPGYPGPKGLDGC------NGTDGAPGIAGIPGTSGKRGEFGADGQ  152
              G  G  GL G  GP G  G +GL G       +G  GAPG+ G  G  G +GE G +G 
Sbjct  1329  AGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGF  1388

Query  153   RGLRGDPGEGGINSK----GTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQ  208
              G +GD G+ G+       G  G+ G  G PGL G  GP+G  G  G+ GP G  G  G 
Sbjct  1389  EGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGT  1448

Query  209   IGFPGPRGDPGAE-------------------------NVGPTGVRGEDGDVGEPGPPGP  243
              G PG +G+PG                             G  G++GE G+ GE G    
Sbjct  1449  PGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERG----  1504

Query  244   IIEDTEQKPGNISY-SFKGPKGMPGARGDRGPYGL---KGERGVPGRPGIDGYPGIKGVK  299
             +I +T    GN+     KG +G PG RG  G  GL   KGE G P    +D   GI   +
Sbjct  1505  LIGET----GNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITR  1560

Query  300   GVQ  302
               Q
Sbjct  1561  HSQ  1563


 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 69/135 (51%), Gaps = 23/135 (17%)

Query  464  IIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ-GKP----IRGPPGEPGSPGF--  516
             I   G  G+PG  G  G++G+ G PG++GP G  GQ G P     RG  GE GSPG   
Sbjct  84   CIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHG  143

Query  517  ----PGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPG  572
                PG++G  G PG PG  G  G  G D      G PG++G      ++G+PG  G  G
Sbjct  144  QAGVPGVQGPAGNPGAPGINGKDGCDGQD------GIPGLEG------LSGMPGPRGYAG  191

Query  573  RMGEKGSRGPDGKMD  587
            ++G KG +G   K +
Sbjct  192  QLGSKGEKGEPAKEN  206



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


Query= Dcitr00g01590.1.1 Collagen

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMV5_DROME  unnamed protein product                                 263     2e-79
O18407_DROME  unnamed protein product                                 263     2e-79
CO4A1_DROME  unnamed protein product                                  257     4e-77


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 151/211 (72%), Gaps = 1/211 (0%)

Query  3     PECPRYTSKLWSGYSLLHISGDNKAHTQDLGSPGSCLPRFSTMPFLFCSLTQTCDYASRG  62
             P+CP  T+ LW GYSL      ++A  QDLG  GSC+ RF+TMP++ C +T  C +A   
Sbjct  1528  PQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNN  1587

Query  63    DNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEEL  122
             D+S WLS+ EPM  TM PI   DL KY+SRC VCE+TTR IA+HSQS++IP CPGGWEE+
Sbjct  1588  DDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEM  1647

Query  123   WVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGVGSCNYYSTASSFWLATLD  182
             W G+S+ M T    GG GQ+L+SPGSCL++FR  P I+CHG G CNYY   +SFWL  ++
Sbjct  1648  WTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHGHGRCNYYDALASFWLTVIE  1707

Query  183   DRDQWRKPRPQTLKANDLKTRISRCAVCLRR  213
             ++DQ+ +PR QTLKA D  ++ISRC VC RR
Sbjct  1708  EQDQFVQPRQQTLKA-DFTSKISRCTVCRRR  1737


 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 67/156 (43%), Gaps = 16/156 (10%)

Query  59    ASRGDNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGG  118
               RGD  Y   +  P L+ + P P  +           +S     A HSQSV +P CP  
Sbjct  1478  GQRGDKGYMGLTGAPGLRGL-PGPQGEPA---PAPPAPKSRGFIFARHSQSVHVPQCPAN  1533

Query  119   WEELWVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGVGSCNY-YSTASSFW  177
                LW G+S   +  A S   GQ L   GSC+  F   P++ C     C++  +   S W
Sbjct  1534  TNLLWEGYSLSGNVAA-SRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLW  1592

Query  178   LATLDDRDQWRKPRPQTL---KANDLKTRISRCAVC  210
             L+T +       P P T+   +  DL   ISRC VC
Sbjct  1593  LSTAE-------PMPMTMTPIQGRDLMKYISRCVVC  1621


>O18407_DROME unnamed protein product
Length=1761

 Score = 263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 151/211 (72%), Gaps = 1/211 (0%)

Query  3     PECPRYTSKLWSGYSLLHISGDNKAHTQDLGSPGSCLPRFSTMPFLFCSLTQTCDYASRG  62
             P+CP  T+ LW GYSL      ++A  QDLG  GSC+ RF+TMP++ C +T  C +A   
Sbjct  1526  PQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNN  1585

Query  63    DNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEEL  122
             D+S WLS+ EPM  TM PI   DL KY+SRC VCE+TTR IA+HSQS++IP CPGGWEE+
Sbjct  1586  DDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEM  1645

Query  123   WVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGVGSCNYYSTASSFWLATLD  182
             W G+S+ M T    GG GQ+L+SPGSCL++FR  P I+CHG G CNYY   +SFWL  ++
Sbjct  1646  WTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHGHGRCNYYDALASFWLTVIE  1705

Query  183   DRDQWRKPRPQTLKANDLKTRISRCAVCLRR  213
             ++DQ+ +PR QTLKA D  ++ISRC VC RR
Sbjct  1706  EQDQFVQPRQQTLKA-DFTSKISRCTVCRRR  1735


 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 67/156 (43%), Gaps = 16/156 (10%)

Query  59    ASRGDNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGG  118
               RGD  Y   +  P L+ + P P  +           +S     A HSQSV +P CP  
Sbjct  1476  GQRGDKGYMGLTGAPGLRGL-PGPQGEPA---PAPPAPKSRGFIFARHSQSVHVPQCPAN  1531

Query  119   WEELWVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGVGSCNY-YSTASSFW  177
                LW G+S   +  A S   GQ L   GSC+  F   P++ C     C++  +   S W
Sbjct  1532  TNLLWEGYSLSGNVAA-SRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLW  1590

Query  178   LATLDDRDQWRKPRPQTL---KANDLKTRISRCAVC  210
             L+T +       P P T+   +  DL   ISRC VC
Sbjct  1591  LSTAE-------PMPMTMTPIQGRDLMKYISRCVVC  1619


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 157/214 (73%), Gaps = 3/214 (1%)

Query  3     PECPRYTSKLWSGYSLLHISGDNKAHTQDLGSPGSCLPRFSTMPFLFCSLTQTCDYASRG  62
             P C    ++LW+GYSLL++ G++ AH QDLGSPGSC+PRFST+P L C     C+YASR 
Sbjct  1568  PACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRN  1627

Query  63    DNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEEL  122
             D ++WL++   +   M P+ + ++++Y+SRC VCE+    IA+HSQ++ +P CP GWE L
Sbjct  1628  DKTFWLTTNAAI--PMMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGL  1685

Query  123   WVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGV-GSCNYYSTASSFWLATL  181
             W+G+SFLMHT  G+GGGGQ+L SPGSCL+DFR TPFI+C+G  G+C++Y T +SFW+  L
Sbjct  1686  WIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNL  1745

Query  182   DDRDQWRKPRPQTLKANDLKTRISRCAVCLRRKS  215
             +    + +P+ QT+KA + ++ +SRC VC++  S
Sbjct  1746  ESSQPFERPQQQTIKAGERQSHVSRCQVCMKNSS  1779


 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 51/117 (44%), Gaps = 24/117 (21%)

Query  103   IAIHSQSVTIPSCPGGWEELWVGFSFL-------MHTDAGSGGGGQSLISPGSCLQDFRP  155
             I  HSQS T+P+C  G  ELW G+S L        H         Q L SPGSC+  F  
Sbjct  1558  ITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHN--------QDLGSPGSCVPRFST  1609

Query  156   TPFIQCHGVGSCNYYS-TASSFWLATLDDRDQWRKPRPQTLKAN-DLKTRISRCAVC  210
              P + C     CNY S    +FWL T           P     N +++  ISRC VC
Sbjct  1610  LPVLSCGQNNVCNYASRNDKTFWLTT-------NAAIPMMPVENIEIRQYISRCVVC  1659



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1701806117


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g01600.1.1 Collagen

Length=87
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O18407_DROME  unnamed protein product                                 94.7    2e-24
Q9VMV5_DROME  unnamed protein product                                 94.7    2e-24
CO4A1_DROME  unnamed protein product                                  80.5    2e-19


>O18407_DROME unnamed protein product
Length=1761

 Score = 94.7 bits (234),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)

Query  1     MLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEELWVGFSFLMQQM  60
             M  TM PI   DL KY+SRC VCE+TTR IA+HSQS++IP CPGGWEE+W G+S+ M  +
Sbjct  1597  MPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTL  1656


 Score = 33.5 bits (75),  Expect = 0.007, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  31    AIHSQSVTIPSCPGGWEELWVGFSF  55
             A HSQSV +P CP     LW G+S 
Sbjct  1517  ARHSQSVHVPQCPANTNLLWEGYSL  1541


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 94.7 bits (234),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)

Query  1     MLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEELWVGFSFLMQQM  60
             M  TM PI   DL KY+SRC VCE+TTR IA+HSQS++IP CPGGWEE+W G+S+ M  +
Sbjct  1599  MPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTL  1658


 Score = 33.5 bits (75),  Expect = 0.007, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  31    AIHSQSVTIPSCPGGWEELWVGFSF  55
             A HSQSV +P CP     LW G+S 
Sbjct  1519  ARHSQSVHVPQCPANTNLLWEGYSL  1543


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 80.5 bits (197),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)

Query  5     MEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEELWVGFSFLMQQMLLN  63
             M P+ + ++++Y+SRC VCE+    IA+HSQ++ +P CP GWE LW+G+SFLM   + N
Sbjct  1641  MMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGN  1699


 Score = 38.5 bits (88),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  30    IAIHSQSVTIPSCPGGWEELWVGFSFL  56
             I  HSQS T+P+C  G  ELW G+S L
Sbjct  1558  ITRHSQSETVPACSAGHTELWTGYSLL  1584



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01610.1.1 SelT-like

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SELT_DROME  unnamed protein product                                   199     4e-65
AGO3_BOMMO  unnamed protein product                                   27.3    6.2  


>SELT_DROME unnamed protein product
Length=198

 Score = 199 bits (505),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 120/167 (72%), Gaps = 2/167 (1%)

Query  29   SSSEKQIPLTKVGLASNIGPTLKFFYCYSCGYRKAFEEYQMVLTQKYPIITVLGDNFDPP  88
            +  EK+IP+TK G   NI PT+ F YCYSCGYRKAFE+Y  +L +KYP I V G N+DPP
Sbjct  25   AEGEKEIPVTKFG--QNIAPTMTFLYCYSCGYRKAFEDYVGLLGEKYPQIQVNGGNYDPP  82

Query  89   FLHLVFAKFLSVAKILLIATIIGGLNPFQFIGCNLPRWFEWCQANKFYACMMIFFCCNAI  148
             L+   +K +   KI++I +++  ++PF F+G N P W+   QANK YACMMIFF  N +
Sbjct  83   GLNYYLSKMIFALKIIIIVSVVSAVSPFTFLGLNTPSWWSHMQANKIYACMMIFFLGNML  142

Query  149  ESTLISTGAFEILFNDMPIWSKLETGRIPQPNELFQIIDSHLGFGKK  195
            E+ LIS+GAFEI  ND+P+WSKL+TGR P P  LFQIID+HL F +K
Sbjct  143  EAQLISSGAFEITLNDVPVWSKLQTGRFPSPEVLFQIIDNHLQFTEK  189


>AGO3_BOMMO unnamed protein product
Length=926

 Score = 27.3 bits (59),  Expect = 6.2, Method: Composition-based stats.
 Identities = 14/43 (33%), Positives = 21/43 (49%), Gaps = 6/43 (14%)

Query  60   YRKAFEEYQMVLTQKYPI------ITVLGDNFDPPFLHLVFAK  96
            YR    + Q+ L Q+Y I       T+LG N+ P   ++V  K
Sbjct  765  YRDGVGDGQLKLLQQYEIPQMKICFTILGSNYQPTLTYVVVQK  807



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01620.1.1 Transmembrane

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NDN5_DROME  unnamed protein product                                 101     5e-22
A0A0U1QT59_DROME  unnamed protein product                             100     8e-22
DGT6_DROME  unnamed protein product                                   40.0    0.004


>M9NDN5_DROME unnamed protein product
Length=1932

 Score = 101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  32   SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  76
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  129  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  183

Query  77   --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  118
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  184  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  240

Query  119  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  178
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  241  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  279

Query  179  YENSSRWASPEIDLDTALGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  235
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  280  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  335

Query  236  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  295
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  336  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  395

Query  296  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  353
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  396  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  451

Query  354  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  409
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  452  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  508

Query  410  VFMFSLYSRLNCPRK  424
              MFS   ++N   K
Sbjct  509  SLMFSFIYKINSKEK  523


 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  435   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  485
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1130  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1189

Query  486   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  545
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1190  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1249

Query  546   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  604
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1250  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1309

Query  605   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  655
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1310  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1360


>A0A0U1QT59_DROME unnamed protein product
Length=2036

 Score = 100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  32   SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  76
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  233  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  287

Query  77   --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  118
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  288  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  344

Query  119  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  178
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  345  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  383

Query  179  YENSSRWASPEIDLDTALGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  235
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  384  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  439

Query  236  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  295
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  440  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  499

Query  296  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  353
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  500  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  555

Query  354  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  409
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  556  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  612

Query  410  VFMFSLYSRLNCPRK  424
              MFS   ++N   K
Sbjct  613  SLMFSFIYKINSKEK  627


 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  435   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  485
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1234  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1293

Query  486   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  545
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1294  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1353

Query  546   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  604
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1354  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1413

Query  605   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  655
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1414  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1464


>DGT6_DROME unnamed protein product
Length=654

 Score = 40.0 bits (92),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 35/65 (54%), Gaps = 0/65 (0%)

Query  371  NRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLTVFMFSLYSRLNCPRKYNECAS  430
            NRI G I E++   ++YN  N    T L+ L + L+   V + +L  +LN P K ++ ++
Sbjct  306  NRISGTIAEQLDANDHYNESNAFVTTDLQALRVELSQSEVQLNNLLKKLNEPSKKDKGSA  365

Query  431  AACNT  435
             A  +
Sbjct  366  NASGS  370



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01630.1.1 ATP

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTEF5_DROME  unnamed protein product                                  174     4e-48
SMG1_DROME  unnamed protein product                                   31.2    1.4  
Q8SYP8_DROME  unnamed protein product                                 31.2    1.5  


>MTEF5_DROME unnamed protein product
Length=560

 Score = 174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 243/501 (49%), Gaps = 14/501 (3%)

Query  29   NSELIKKMLGYDDTNWNN--EENSFLNKYDRNNILDSYKLLKKFGYSDADIKSELRTLCL  86
            N+  + K LG    +W    E++  L    R ++L SY  LK   YS  DI ++   +  
Sbjct  55   NASYLSKTLGSSYRSWAAALEKHPELKTLKRKDLLSSYDTLKSLDYSVDDIIAKPMIIYY  114

Query  87   KPQTITSRYRMFIDYCFQKDLISPTLLRHFVKTMSLNIYQIKHKGYID---KYKDVLGHV  143
               T+ +R+ +  +  F    ++   L  +V  ++  I  +K   YI    K  + L   
Sbjct  115  GATTLANRHSVLQECGFHN--VTVQTLAKYVTVVNKPIEVLKAHNYIPFDVKVAERLAGY  172

Query  144  NK--KLNISVQSL-SEKMPLKRVHCEFSVHHLMSVLNISHEEAKYKFKRYPNLKSRSFKC  200
             K  KL + ++ L SE + LK +       +L   L +   + +  ++ Y  ++ +SF+ 
Sbjct  173  FKDIKLPVDLRELESETLTLKSLRQSLINAYLRERLQMDDNDLQKLWRVYTRIRHKSFRA  232

Query  201  IQENVHVLTKKVGFTHERIKKNAFLLHADKENLLSLLKKYPKLGSVDMKQIIQAYPILVL  260
            +Q+ + +LTK+  F+ ER++KN+FLL+++ +N+  +L++ P + S D+++I    P +++
Sbjct  233  VQDTIELLTKEFNFSAERLRKNSFLLYSEADNVRRILREVPTIDSQDIREIGFRRPKILM  292

Query  261  SPIRNIESVIKCVQKFGYTLEHLSKAPMILILKPSTVEQRLTQIHTEEWLQPYSGLPRTL  320
            S   +++  ++ V  FG + + + +   +L L P TV +RL  +   E  Q     PR L
Sbjct  293  STCDSLKQTLQHVHAFGISEDAVLRCLEVLTLGPDTVLERLRDLQEIEEFQVLGTNPRIL  352

Query  321  MLVLTLPSLEKRRAVLQDLNMKCISINVLACTKILFNAYVKHGRDKLNSEDAYLYLSNKL  380
             LV        R   L  L ++C S+++L+C    F  + + G D+    D  +YLSN L
Sbjct  353  RLVHYQNKARLRLDYLNQLRVRCASLHILSCGSEAFAKFARDGSDRTKGRDIVVYLSNVL  412

Query  381  NVPFEKITQKLQSHPYKRYVSIQQIHNSLTFLLG-KFSEDNIYNNLQLVLYPVTVIEAAL  439
                + +   L  HP   ++ +  +   L +L   KF  + I+ N+ L+LYP+  IE  +
Sbjct  413  GKDVQVLRNLLSRHPNWCHIPLLHVKQCLEYLRSKKFKLNEIFANIHLLLYPIKRIEEKM  472

Query  440  EKLTSGSDTSLDTTPCHDANGNIKEELILPLTLYVIEKQTNFTGYGIWEEEEDGEVEHNA  499
              L S         P  + +     E IL L LY+IE + +FTG GIW E+    VE+  
Sbjct  473  LLLQSPDAQEDLQLPVANFDSLSNNE-ILTLILYLIESEFHFTGDGIWTEQHTHHVENFN  531

Query  500  NL--DSPVSMLPIRKKKRKPS  518
            NL  D P S+  + K   KP+
Sbjct  532  NLLPDFPESLNKVYKYGVKPA  552


>SMG1_DROME unnamed protein product
Length=3218

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 33/69 (48%), Gaps = 7/69 (10%)

Query  272  CVQK-FGYTLEHLSKAPMILILKPSTVEQRLTQIHT---EEWLQPYSGLPRTLMLV---L  324
            C+Q    Y LE L K P +LIL   T  Q+L  + T     + Q Y+ LP  L L     
Sbjct  713  CIQTVLDYGLERLEKYPKLLILYRDTALQQLQMLSTNYHAPYFQIYAQLPLHLTLTGGES  772

Query  325  TLPSLEKRR  333
            ++P +  RR
Sbjct  773  SMPGMASRR  781


>Q8SYP8_DROME unnamed protein product
Length=591

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 35/79 (44%), Gaps = 14/79 (18%)

Query  460  GNIKEELILPL-------TLYVIEKQTNFTGYG-------IWEEEEDGEVEHNANLDSPV  505
            G  +EEL +PL       T  V E +T+FTGY        +++ E    V    +   P 
Sbjct  464  GKQEEELPIPLAPLLADDTKGVNEDETHFTGYKTARSGSILYDTERRNRVTRRTDNKLPT  523

Query  506  SMLPIRKKKRKPSFRNLRR  524
            + L I+  K KP    LRR
Sbjct  524  NTLDIKSDKAKPHGNVLRR  542



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01640.1.1 Protein

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8P6_DROME  unnamed protein product                                 30.8    1.7  
SYFA_DROME  unnamed protein product                                   30.0    2.3  
Q15K24_DROME  unnamed protein product                                 29.3    5.5  


>Q0E8P6_DROME unnamed protein product
Length=4236

 Score = 30.8 bits (68),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 38/84 (45%), Gaps = 12/84 (14%)

Query  202   RASIIQHQAAHSGNIGDIAAKDGSQET-CVNLTASLLGLVVLKLCTEKTFLTWLLFIIFT  260
             R  +I  QA H G  G+     G+ +T CV    ++LG +VL    ++   T  + +I T
Sbjct  1640  RCYLILTQAMHMGLGGNPFGPAGTGKTECVKALGAMLGRLVLVFNCDENVDTESMSLILT  1699

Query  261   GLHIYSNYRAVRCLE---FNTFNR  281
             GL         RC     F+ FNR
Sbjct  1700  GL--------ARCGAWGCFDEFNR  1715


>SYFA_DROME unnamed protein product
Length=498

 Score = 30.0 bits (66),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  58   KIKIFFYQAFLPQGFPDTVSNDYIEYQLWD  87
            K++  F Q FL  GF +  +N+Y+E   W+
Sbjct  228  KVRTEFRQIFLEMGFSEMPTNNYVESSFWN  257


>Q15K24_DROME unnamed protein product
Length=1842

 Score = 29.3 bits (64),  Expect = 5.5, Method: Composition-based stats.
 Identities = 20/67 (30%), Positives = 32/67 (48%), Gaps = 2/67 (3%)

Query  351  KKSKPSNAVSVLLNINADVKATLKAYCYAVFHDVKKNVSPSLSLFQKEIKYE--NDEEEF  408
            K+ K S  V V + I  +VK   +        DV K +  ++ + Q+EIK E     +E 
Sbjct  348  KEVKDSQPVKVDIQIEEEVKTPNQVIGEVKVEDVNKEIKETVQVSQQEIKKEVKVSHQET  407

Query  409  KQTYFEE  415
            K+T+  E
Sbjct  408  KETFKSE  414



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01650.1.1 peroxisome

Length=321
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 52.8    1e-07
Q9Y090_DROME  unnamed protein product                                 52.8    1e-07
E1JIP9_DROME  unnamed protein product                                 32.0    0.48 


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 52.8 bits (125),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 52.8 bits (125),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


>E1JIP9_DROME unnamed protein product
Length=2776

 Score = 32.0 bits (71),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 4/51 (8%)

Query  274   ESQTDLEFCSQIDELEDVRSYDNDASIISTK----NENVSDANTNHCNTKT  320
             E+Q +LE C  I  L D+R+ DN +  +S K     E +S ++T+    KT
Sbjct  1278  EAQINLEKCGDISYLRDLRNSDNGSEALSAKIQKAREALSQSDTSGGMAKT  1328



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01660.1.1 Root

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SYFA_DROME  unnamed protein product                                   31.6    0.14 
Q7K4B2_DROME  unnamed protein product                                 25.8    9.6  


>SYFA_DROME unnamed protein product
Length=498

 Score = 31.6 bits (70),  Expect = 0.14, Method: Composition-based stats.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  58   KIKIFFYQAFLPQGFPDTVSNDYIEYQLWD  87
            K++  F Q FL  GF +  +N+Y+E   W+
Sbjct  228  KVRTEFRQIFLEMGFSEMPTNNYVESSFWN  257


>Q7K4B2_DROME unnamed protein product
Length=419

 Score = 25.8 bits (55),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query  3   ATHSSNVKHTLHCNE--SYGTSNLKNSWKIVTDETNKVSFIANLNDDKS  49
            TH+ + KH +  +E   YG SNL +   +  D+ ++V+ +A  NDD++
Sbjct  22  GTHTGSFKHLVPASEKTPYGQSNLSDLCAL--DKDSRVTSLAFGNDDQT  68



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01670.1.1 ATPase

Length=973
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y090_DROME  unnamed protein product                                 330     7e-98
Q9VUC7_DROME  unnamed protein product                                 330     7e-98
TERA_DROME  unnamed protein product                                   261     2e-74


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 330 bits (846),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 196/569 (34%), Positives = 308/569 (54%), Gaps = 42/569 (7%)

Query  376  IRVELIPSSVKYCLYDNKIQREVQISYEEYVPVKQKVVQSEGGVLTSNLGAISTEKPF-L  434
            + V ++P   +YC+ D +  +E +I   + V    ++++ E    T     +S +    L
Sbjct  393  VTVGILPEHFRYCVVDAQFLKESKIYAADLVRPVGEIIKEE----TPPTSPLSVQDLIQL  448

Query  435  NHLNQTLNTLVSQIR----ISVRSSYLYRDNILVTGAEGSGKTTFCKTLQEALQNAGPDS  490
               ++ ++ +V ++R    +S  +S + + N+L+ GA G+GKT   + + + L    PD 
Sbjct  449  PEYDKIVDQVVQELRMNLCLSADNSVMRQCNVLLAGASGTGKTVLVERILDQLSRK-PDY  507

Query  491  IHCQVVDCKQMKSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATT  550
             H +     + K +    ++K LR++ +      P+ V+L+++++L     E        
Sbjct  508  CHFEFFHGSRSKGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGE  566

Query  551  LCNKLCSLFVSLVHEFQLNSSIVMVGVTSSRDII----KNTKAGLVFSHCYSLPPLELDN  606
              N++      L+ ++  N++I ++   +    +     + +   VF     LP LE  +
Sbjct  567  YYNRMADTVYQLIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERAD  626

Query  607  RNLLLETLIQYKLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLE  665
            R ++L  L        H N+  D+D+ K S   EGY   D+   V++A+F+         
Sbjct  627  REIILRELCS------HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-----  675

Query  666  DNDASTPDTLKTNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKS  718
                + P      L + + L E+ +      L+GI SN          ++    + GL+S
Sbjct  676  --SKTQP------LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLES  727

Query  719  AKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKG  778
               +L E L+WPS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KG
Sbjct  728  VVGVLEEVLMWPSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKG  787

Query  779  PELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTE  838
            PEL +K+IG+SEE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTE
Sbjct  788  PELLAKYIGQSEENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTE  847

Query  839  LDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLN  898
            LDGVEGL+GV V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+
Sbjct  848  LDGVEGLQGVTVIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLD  907

Query  899  SDVNLTEIAQCTERFTGADLLGLLCSAQM  927
              V+    A  T  +TGAD+  +L SA M
Sbjct  908  ECVDFDWFAGKTANYTGADIQSILTSANM  936


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 11/211 (5%)

Query  745  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  799
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  800  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  856
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  857  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTEIAQCTERF  913
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L + +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  914  TGADLLGLLCSAQMLRQEYDEEKLKMNNDTL  944
               DL+  +  A        + +  + ND L
Sbjct  657  RKCDLVQFVERAIFYAYRISKTQPLLTNDQL  687


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 330 bits (846),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 196/569 (34%), Positives = 308/569 (54%), Gaps = 42/569 (7%)

Query  376  IRVELIPSSVKYCLYDNKIQREVQISYEEYVPVKQKVVQSEGGVLTSNLGAISTEKPF-L  434
            + V ++P   +YC+ D +  +E +I   + V    ++++ E    T     +S +    L
Sbjct  393  VTVGILPEHFRYCVVDAQFLKESKIYAADLVRPVGEIIKEE----TPPTSPLSVQDLIQL  448

Query  435  NHLNQTLNTLVSQIR----ISVRSSYLYRDNILVTGAEGSGKTTFCKTLQEALQNAGPDS  490
               ++ ++ +V ++R    +S  +S + + N+L+ GA G+GKT   + + + L    PD 
Sbjct  449  PEYDKIVDQVVQELRMNLCLSADNSVMRQCNVLLAGASGTGKTVLVERILDQLSRK-PDY  507

Query  491  IHCQVVDCKQMKSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATT  550
             H +     + K +    ++K LR++ +      P+ V+L+++++L     E        
Sbjct  508  CHFEFFHGSRSKGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGE  566

Query  551  LCNKLCSLFVSLVHEFQLNSSIVMVGVTSSRDII----KNTKAGLVFSHCYSLPPLELDN  606
              N++      L+ ++  N++I ++   +    +     + +   VF     LP LE  +
Sbjct  567  YYNRMADTVYQLIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERAD  626

Query  607  RNLLLETLIQYKLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLE  665
            R ++L  L        H N+  D+D+ K S   EGY   D+   V++A+F+         
Sbjct  627  REIILRELCS------HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-----  675

Query  666  DNDASTPDTLKTNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKS  718
                + P      L + + L E+ +      L+GI SN          ++    + GL+S
Sbjct  676  --SKTQP------LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLES  727

Query  719  AKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKG  778
               +L E L+WPS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KG
Sbjct  728  VVGVLEEVLMWPSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKG  787

Query  779  PELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTE  838
            PEL +K+IG+SEE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTE
Sbjct  788  PELLAKYIGQSEENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTE  847

Query  839  LDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLN  898
            LDGVEGL+GV V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+
Sbjct  848  LDGVEGLQGVTVIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLD  907

Query  899  SDVNLTEIAQCTERFTGADLLGLLCSAQM  927
              V+    A  T  +TGAD+  +L SA M
Sbjct  908  ECVDFDWFAGKTANYTGADIQSILTSANM  936


 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 11/211 (5%)

Query  745  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  799
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  800  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  856
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  857  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTEIAQCTERF  913
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L + +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  914  TGADLLGLLCSAQMLRQEYDEEKLKMNNDTL  944
               DL+  +  A        + +  + ND L
Sbjct  657  RKCDLVQFVERAIFYAYRISKTQPLLTNDQL  687


>TERA_DROME unnamed protein product
Length=801

 Score = 261 bits (666),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 184/619 (30%), Positives = 314/619 (51%), Gaps = 59/619 (10%)

Query  346  FLVKFFHASYYPI-LNHNAILSLSVRSMTIPIRVELIPSSVK-YCLYDNKIQREVQISYE  403
            +L  +F  +Y PI +  N I+  ++R    PI  +++ +  + YC+   +      + + 
Sbjct  131  YLKPYFLEAYRPIHMGDNFIVRAAMR----PIEFKVVLTDPEPYCIVAPET-----VIFC  181

Query  404  EYVPVKQKVVQSEGGVLTSNLGAISTEKPFLNHLNQTLNTLVSQIRISVRSSYLYR----  459
            +  P+K++  +        +L A+  +   +    + L  +   + + +R   L++    
Sbjct  182  DGDPIKREEEEE-------SLNAVGYDD--IGGCRKQLAQIKEMVELPLRHPSLFKAIGV  232

Query  460  ---DNILVTGAEGSGKTTFCKTLQEALQNAGPDSIHCQVVDCKQMKSKIPNVVEKYLRDV  516
                 IL+ G  G+GKT   + +      A        +++  ++ SK+    E  LR  
Sbjct  233  KPPRGILMYGPPGTGKTLIARAV------ANETGAFFFLINGPEIMSKLAGESESNLRKA  286

Query  517  LSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVSLVHEFQLNSSIVMVG  576
               A    P+ + +D+I+ +        D     +  ++ S  ++L+   + +S ++++ 
Sbjct  287  FEEAEKNSPAIIFIDEIDAIAP----KRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMA  342

Query  577  VTSSRDIIKNTKAGLVFSHCYSLPPLELDNRNLLLETL-IQYKLKREHYNMNDIDINKVS  635
             T+  + I    A   F        + + +    LE L I  K  + H   +D+D+ +++
Sbjct  343  ATNRPNSID--PALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMKLH---DDVDLEQIA  397

Query  636  KQCEGYTVQDMCDVVDKALFHYLHTKVDLED--NDASTPDTLKTNLFSTEDLEEAFKSHV  693
             +  G+   D+  +  +A    +  K+DL D  +D    + L +   + E+   A     
Sbjct  398  AESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSS  457

Query  694  PLALKGISSNAVEKIN--FSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKPQSGILLY  751
            P AL+      VE  N  ++++GGL+S K+ L E + +P  +PD F +  ++P  G+L Y
Sbjct  458  PSALR---ETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFY  514

Query  752  GAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGESEEGVRNIFNRARSIQPCILFFD  811
            G PG GKTLLA AI+ EC   FIS+KGPEL + + GESE  VR+IF++ARS  PC+LFFD
Sbjct  515  GPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFD  574

Query  812  EFDSLAAKRG---NDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPG  868
            E DS+A  RG    D+ G  DRV+NQ+LTE+DG+   + V+++GAT+RPDIIDPA+LRPG
Sbjct  575  ELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPG  634

Query  869  RLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTEIAQCTERFTGADLLGL------L  922
            RL   ++  +PD K RE IL    +K  L  +V+LT IA+ T+ F+GADL  +      L
Sbjct  635  RLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKL  694

Query  923  CSAQMLRQEYDEEKLKMNN  941
               Q +  E   EK +  N
Sbjct  695  AIRQAIEAEIRREKERAEN  713



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01680.1.1 General

Length=1975
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTL3A_DROME  unnamed protein product                                  31.6    5.5  
NIPB_DROME  unnamed protein product                                   31.2    6.8  


>TTL3A_DROME unnamed protein product
Length=992

 Score = 31.6 bits (70),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 36/75 (48%), Gaps = 12/75 (16%)

Query  1759  WEKQVAAFIESKMELGATSEDIRVKYGATLK----VKSILDSLVDKRVVIRTGTILPTYV  1814
             WE    AF+    +L   +ED R+++    +    VKS L SLVDK  V       P Y 
Sbjct  359   WEHDWDAFLFQHQQL--VNEDGRIQHDGGQRLEPMVKSCL-SLVDKMKVH-----WPQYS  410

Query  1815  HNKYCRLWLVKTTNK  1829
              + Y  +W+VK  NK
Sbjct  411   LDGYQNMWIVKPANK  425


>NIPB_DROME unnamed protein product
Length=2077

 Score = 31.2 bits (69),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query  1570  IHESFIQFNVLATGCVHNIVQVDSGCFTVLSALLGENNITLDIQVPNTLLLLDPKIEKIN  1629
             ++E  I     A  C+ NIV+VD          +G N   LD  +      +D  + K  
Sbjct  1138  VNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGVNQKFLDTAISVREAAVD-LVGKFV  1196

Query  1630  KSNKDIVDRYYQLV  1643
              SN+D++D+YY ++
Sbjct  1197  LSNQDLIDQYYDML  1210



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01690.1.1 Propionyl-CoA

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCCB_DROME  unnamed protein product                                   82.0    2e-18
DDB1_DROME  unnamed protein product                                   29.6    0.92 


>MCCB_DROME unnamed protein product
Length=578

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 87/186 (47%), Gaps = 16/186 (9%)

Query  4    HSSCLCRFSGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSK  63
            H+  +   +G +   +A+K A FI+ C    IP+V   ++ GF+ G   E  GI ++G+K
Sbjct  380  HTVGIVGNNGVLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAK  439

Query  64   LLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYR  123
            ++ A A + VPK TVI   +YG     M  +       Y WP + I+VMG   A  ++ +
Sbjct  440  MVTAVACANVPKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAANVMAQ  499

Query  124  KEKDK-----SNYEVEYNDKFRSPVA-----------AAKKGYIDDIIEPRTTRMRIAQD  167
              +D+       +  E   K ++P+            +  + + D II+P  TR  +   
Sbjct  500  ITEDQRKRAGKEFSEEEAQKLKAPIVEMFEAEGSPYYSTARLWDDGIIDPANTRQILGLS  559

Query  168  LKFLLN  173
            LK  LN
Sbjct  560  LKAALN  565


>DDB1_DROME unnamed protein product
Length=1140

 Score = 29.6 bits (65),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 25/52 (48%), Gaps = 4/52 (8%)

Query  46    FLPGLAQEHLG----IIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSE  93
              LP LA+ HLG    + RHGS ++    E T P    +      GA  ++++
Sbjct  992   LLPELARFHLGDTVNVFRHGSLVMQNVGERTTPINGCVLYGTCNGAIGIVTQ  1043



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01700.1.1 THAP

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJ27_DROME  unnamed protein product                                 38.9    0.004
CUE_DROME  unnamed protein product                                    29.3    5.1  


>Q9VJ27_DROME unnamed protein product
Length=762

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 39/81 (48%), Gaps = 16/81 (20%)

Query  1   MPT-CYAYNCNHD-SRKETCRFFRFP-QDQVLWKKWNEACRREKP--PSKWSVLCSCHFV  55
           MP  C   NC+H      +  F RFP + + L +KW E  +R     PSKWS LCS HF 
Sbjct  1   MPAHCAVINCSHKYVHAGSISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFG  60

Query  56  D------GNSKT-----VPSI  65
           D       N KT     VPSI
Sbjct  61  DEDFNCSNNRKTLKKNAVPSI  81


>CUE_DROME unnamed protein product
Length=644

 Score = 29.3 bits (64),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  266  SKEKNKALSPACFATFPNARIVLDCTEINIAVPSLLKSQKEVY  308
            SK++N+A S  C A F  AR   + TEI      LLK + E+Y
Sbjct  450  SKDENEAPSCECPAKFGGARCEQNSTEICSLFCRLLKHEPEMY  492



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01710.1.1 Major

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQH6_DROME  unnamed protein product                                 202     2e-59
Q9VU17_DROME  unnamed protein product                                 204     3e-59
TRET1_POLVA  unnamed protein product                                  202     5e-59


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/435 (29%), Positives = 218/435 (50%), Gaps = 30/435 (7%)

Query  73   ESPDLILSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLA  132
            E  D  +  +Q SW+GS + L      I  G+ +  IGRK  M+ +  PF LGW +L  A
Sbjct  48   EGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWA  107

Query  133  ETVSIIMLGTVCMGLSVG--CCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLI  190
              VS++      +G++ G  C  AP+  Y GEI++  +RG+L  F       G+  ++ +
Sbjct  108  VNVSMLYASRFILGIAGGAFCVTAPM--YTGEIAQKEIRGTLGSFFQLMITIGILFVYAV  165

Query  191  YALTDWRTTVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVR  250
             A        +I  I P++   +  F+PESPT+LVSK R E A +S++W+RG  K++   
Sbjct  166  GAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRG--KEYDYE  223

Query  251  VEFEQLVKDTNSATLYVADSEYTTDQRKSSQLSKLLNYLVRPEIVRPFIMIMILFFITII  310
             E  +L +               TD+   +    +   L RP   +   + M L F   +
Sbjct  224  PELAELRE---------------TDRETKANKVNVWAALNRPVTRKALAISMGLMFFQQV  268

Query  311  ASLQPMRPFLVEIFRTFGLPMKSEWVLVLTGILSITGSFVSTITVNKLGKR--------G  362
              +  +  +   IF      +++EW  +L GI+ +  +FVST+ V+KLG+R         
Sbjct  269  CGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGIS  328

Query  363  MTLWSTGINTFFTLMLSICAMNLQWPGWIPLTIFCTCFWVSGYGMLPLPWMLLSEVFPLQ  422
            M + +T I  +F L     A  +   GW+P+   C    +   G  P+PW+++ E+F   
Sbjct  329  MAISTTAIGVYFFLQKQDAAQVVSL-GWLPVASLCLFIIMFSIGYGPVPWLMMGELFATD  387

Query  423  VRGIASGITAASSSVVNFISTKTYINLTSWFGLHGTLFIYTLVSFLGFIYIYFYVPETED  482
            ++G A  +   S+ ++ F+ TKT++NL    G+ GT +++  ++ +G I++YF VPET+ 
Sbjct  388  IKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKG  447

Query  483  RTLQEILDFFAENKS  497
            ++L EI    A N+S
Sbjct  448  KSLNEIQQELAGNRS  462


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/435 (29%), Positives = 218/435 (50%), Gaps = 30/435 (7%)

Query  73   ESPDLILSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLA  132
            E  D  +  +Q SW+GS + L      I  G+ +  IGRK  M+ +  PF LGW +L  A
Sbjct  116  EGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWA  175

Query  133  ETVSIIMLGTVCMGLSVG--CCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLI  190
              VS++      +G++ G  C  AP+  Y GEI++  +RG+L  F       G+  ++ +
Sbjct  176  VNVSMLYASRFILGIAGGAFCVTAPM--YTGEIAQKEIRGTLGSFFQLMITIGILFVYAV  233

Query  191  YALTDWRTTVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVR  250
             A        +I  I P++   +  F+PESPT+LVSK R E A +S++W+RG  K++   
Sbjct  234  GAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRG--KEYDYE  291

Query  251  VEFEQLVKDTNSATLYVADSEYTTDQRKSSQLSKLLNYLVRPEIVRPFIMIMILFFITII  310
             E  +L +               TD+   +    +   L RP   +   + M L F   +
Sbjct  292  PELAELRE---------------TDRETKANKVNVWAALNRPVTRKALAISMGLMFFQQV  336

Query  311  ASLQPMRPFLVEIFRTFGLPMKSEWVLVLTGILSITGSFVSTITVNKLGKR--------G  362
              +  +  +   IF      +++EW  +L GI+ +  +FVST+ V+KLG+R         
Sbjct  337  CGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGIS  396

Query  363  MTLWSTGINTFFTLMLSICAMNLQWPGWIPLTIFCTCFWVSGYGMLPLPWMLLSEVFPLQ  422
            M + +T I  +F L     A  +   GW+P+   C    +   G  P+PW+++ E+F   
Sbjct  397  MAISTTAIGVYFFLQKQDAAQVVSL-GWLPVASLCLFIIMFSIGYGPVPWLMMGELFATD  455

Query  423  VRGIASGITAASSSVVNFISTKTYINLTSWFGLHGTLFIYTLVSFLGFIYIYFYVPETED  482
            ++G A  +   S+ ++ F+ TKT++NL    G+ GT +++  ++ +G I++YF VPET+ 
Sbjct  456  IKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKG  515

Query  483  RTLQEILDFFAENKS  497
            ++L EI    A N+S
Sbjct  516  KSLNEIQQELAGNRS  530


>TRET1_POLVA unnamed protein product
Length=504

 Score = 202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 123/454 (27%), Positives = 235/454 (52%), Gaps = 33/454 (7%)

Query  48   GMAFGMPTVVVGVLDHKVASNQTKLESPDLI---LSDEQSSWLGSILFLFHPFGSIISGY  104
             +A  M ++VVG      +     +++  +    ++++++SW+G I+ L    G I  G 
Sbjct  47   AIAVSMGSMVVGFASAYTSPALVSMQNTTITSFKVTEQEASWVGGIMPLAGLAGGIAGGP  106

Query  105  FLEYIGRKRLMILVGFPFFLGWILLYLAETVSIIMLGTVCMGLSVGCCEAPIISYIGEIS  164
            F+EY+GRK  ++    PF + W+L+  A ++ +++ G    G  VG     +  Y+GE  
Sbjct  107  FIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYLGETV  166

Query  165  EPRMRGSLSLFAGAACNFGVFIIFLIYALTDWRTTVLISAIFPILTMIMIAFIPESPTWL  224
            +P +RG+L L   A  N G+ I F+     +W     I +I PI  M++   IPE+P W 
Sbjct  167  QPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPETPRWF  226

Query  225  VSKGRLEEAERSLRWVRGWSKKHKVRVEFEQLVKDTNSATLYVADSEYTTDQRKSSQLSK  284
            V++GR E A ++L+W+RG  KK  V  E + +VK    A            +R +SQ + 
Sbjct  227  VTRGREERARKALQWLRG--KKADVEPELKGIVKSHCEA------------ERHASQ-NA  271

Query  285  LLNYLVRPEIVRPFIMIMILFFITIIASLQPMRPFLVEIFRTFGLPMKSEWVLVLTGILS  344
            + + + R  + +P ++ + L F   ++ +  +  + V IF+  G  +      ++ G+++
Sbjct  272  IFDLMKRSNL-KPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVN  330

Query  345  ITGSFVSTITVNKLGKR--------GMTLWSTGINTFFTLMLSICAMNLQWPGWIPLTIF  396
               +F +T+ +++LG++         M +    + TFF    S    ++   GW+PL  F
Sbjct  331  FGATFFATVLIDRLGRKILLYISEVAMVITLLTLGTFFYYKNS--GNDVSNIGWLPLASF  388

Query  397  CTCFWVSGY--GMLPLPWMLLSEVFPLQVRGIASGITAASSSVVNFISTKTYINLTSWFG  454
                +V G+  G+ P+PW++L E+ P ++RG A+ +    +    FI TKT+ ++ +  G
Sbjct  389  --VIYVIGFSSGVGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADIVAAIG  446

Query  455  LHGTLFIYTLVSFLGFIYIYFYVPETEDRTLQEI  488
             HG  + + ++  +G  ++ F+VPET+ ++L+EI
Sbjct  447  NHGAFWFFGVICLIGLFFVIFFVPETQGKSLEEI  480



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01720.1.1 Major

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_BOMMO  unnamed protein product                                  122     6e-32
TRET1_POLVA  unnamed protein product                                  116     6e-30
TRET1_APILI  unnamed protein product                                  112     2e-28


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 122 bits (305),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 98/178 (55%), Gaps = 4/178 (2%)

Query  77   LILSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLAETVS  136
            L ++ E+ +W+G ++ L    G I+ G  +EY+GRK+ ++    PF +GW+L+  A  V 
Sbjct  83   LDITKEEITWVGGLMPLAALVGGIVGGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVV  142

Query  137  IIMLGTVCMGLSVGCCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLIYALTDW  196
            ++  G V  G+ VG        YIGE  +P +RG+L L   A  N G+ + FL+ +  DW
Sbjct  143  MVFAGRVICGVCVGIVSLAFPVYIGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDW  202

Query  197  RTTVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVRVEFE  254
                   A  P+   +++   PE+P W VSK R++EA +SLRW+RG      V +E E
Sbjct  203  SNLAFFGAAIPVPFFLLMILTPETPRWYVSKARVQEARKSLRWLRG----KNVNIEKE  256


>TRET1_POLVA unnamed protein product
Length=504

 Score = 116 bits (291),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 99/176 (56%), Gaps = 2/176 (1%)

Query  79   LSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLAETVSII  138
            ++++++SW+G I+ L    G I  G F+EY+GRK  ++    PF + W+L+  A ++ ++
Sbjct  81   VTEQEASWVGGIMPLAGLAGGIAGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMV  140

Query  139  MLGTVCMGLSVGCCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLIYALTDWRT  198
            + G    G  VG     +  Y+GE  +P +RG+L L   A  N G+ I F+     +W  
Sbjct  141  LAGRALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSG  200

Query  199  TVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVRVEFE  254
               I +I PI  M++   IPE+P W V++GR E A ++L+W+RG  KK  V  E +
Sbjct  201  LAFIGSILPIPFMVLTLLIPETPRWFVTRGREERARKALQWLRG--KKADVEPELK  254


>TRET1_APILI unnamed protein product
Length=502

 Score = 112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 93/161 (58%), Gaps = 0/161 (0%)

Query  82   EQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLAETVSIIMLG  141
            + + W+GSI+ L    G II G  +EYIGR+  ++    PF  GW+ + LA  V++I++G
Sbjct  83   DMAMWIGSIMPLSALIGGIIGGPCIEYIGRRNTILSTALPFLAGWLFIALATNVAMILVG  142

Query  142  TVCMGLSVGCCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLIYALTDWRTTVL  201
                G  VG     +  Y+GE  +P +RGSL L      N G+ + F       WR   L
Sbjct  143  RSICGFCVGVASLSLPVYLGESIQPEVRGSLGLLPTVFGNSGILMCFTAGMYLAWRNLAL  202

Query  202  ISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRG  242
            + A  PI+ +I++  IPE+P W +SKG+++EA +SL+W+RG
Sbjct  203  LGACIPIIFLILMFLIPETPRWYISKGKIKEARKSLQWLRG  243



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01730.1.1 Dipeptidase

Length=394
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCG1_DROME  unnamed protein product                                 31.2    0.90 
M9PCU4_DROME  unnamed protein product                                 31.2    0.91 
M9PCA2_DROME  unnamed protein product                                 31.2    0.92 


>M9PCG1_DROME unnamed protein product
Length=496

 Score = 31.2 bits (69),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 28/40 (70%), Gaps = 4/40 (10%)

Query  216  VQTMQAALDTSKAPVVFSHSSARALCNSSRNVPDHILAKL  255
            +Q++++ L+TS++PV +S++ ARA      N+P+HI   L
Sbjct  50   LQSIRSKLNTSQSPVTWSYNFARAYA----NLPEHIRVPL  85


>M9PCU4_DROME unnamed protein product
Length=489

 Score = 31.2 bits (69),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 28/40 (70%), Gaps = 4/40 (10%)

Query  216  VQTMQAALDTSKAPVVFSHSSARALCNSSRNVPDHILAKL  255
            +Q++++ L+TS++PV +S++ ARA      N+P+HI   L
Sbjct  50   LQSIRSKLNTSQSPVTWSYNFARAYA----NLPEHIRVPL  85


>M9PCA2_DROME unnamed protein product
Length=473

 Score = 31.2 bits (69),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 28/40 (70%), Gaps = 4/40 (10%)

Query  216  VQTMQAALDTSKAPVVFSHSSARALCNSSRNVPDHILAKL  255
            +Q++++ L+TS++PV +S++ ARA      N+P+HI   L
Sbjct  50   LQSIRSKLNTSQSPVTWSYNFARAYA----NLPEHIRVPL  85



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01740.1.1 Phosphoglycerate

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PGK_DROME  unnamed protein product                                    647     0.0  


>PGK_DROME unnamed protein product
Length=415

 Score = 647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/414 (76%), Positives = 357/414 (86%), Gaps = 0/414 (0%)

Query  1    MALNKLSVDLLNLAGKRVLMRVDFNVPMKEGKITNNQRIVAALDTIKYALDKGAKSVVLM  60
            MA NKLS++ L+LAGKRVLMRVDFNVP+KEGKIT+NQRIVAALD+IK AL K AKSVVLM
Sbjct  1    MAFNKLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKSVVLM  60

Query  61   SHLGRPDGSKNLKYSLKPVAEELKTLLKKDITFLDDCVGPKVEEACADPPAGSIILLENL  120
            SHLGRPDG+KN+KY+L PVA ELKTLL +D+ FL DCVG +VE AC DP  GS+ILLEN+
Sbjct  61   SHLGRPDGNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGSEVEAACKDPAPGSVILLENV  120

Query  121  RFYVEEEGKGVNAAGEKVKASAEDVKKFRESLRKLGDIYVNDAFGTAHRAHSSMLGEGFE  180
            RFYVEEEGKG++A+G KVKA    VK+FR SL KLGD+YVNDAFGTAHRAHSSM+G+GFE
Sbjct  121  RFYVEEEGKGLDASGGKVKADPAKVKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFE  180

Query  181  QRASGFLLKKELDYFSKALDNPEKPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMSY  240
            QRA+G LL KEL YFS+ALD P  PFLAILGGAKVADKIQLIENLLDKVNEMIIGGGM++
Sbjct  181  QRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAF  240

Query  241  TFLKELKGMNIGGSLYDPEGAKIVKKLVEKAEKNNVKLHFPVDFITADKFAEDAKTGEAT  300
            TFLK L  M IGGSL+D EG+KIV+KLVEKA+KNNV+LH PVDF+  DKFAE+A   EAT
Sbjct  241  TFLKVLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAVSEAT  300

Query  301  VESGVPDGWMGLDIGPKSRELFKEPIARAKVIVWNGPSGVFEFENFAKGTKGIMDAVVDV  360
            VE+G+PDG MGLD+GPK+RELF  PIARAK+IVWNGP GVFEF NFA GTK IMD VV  
Sbjct  301  VEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVAA  360

Query  361  TTKGAITIIGGGDTATCAAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN  414
            T  G ++IIGGGDTA+C AKWNTE  VSHVSTGGGASLELLEGK LPGV AL++
Sbjct  361  TKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTS  414



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01750.1.1 Aspartate--tRNA

Length=464
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K0E6_DROME  unnamed protein product                                 67.4    4e-12
Q9XYM1_DROME  unnamed protein product                                 65.5    2e-11
Q8SXM8_DROME  unnamed protein product                                 61.6    4e-10


>Q7K0E6_DROME unnamed protein product
Length=531

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 66/128 (52%), Gaps = 24/128 (19%)

Query  315  FWVVD-FPLFLPSDSGTLESAHHPF-TQPHPEDEHLLSSNPLEVRGLHYDLVLNGNEIGG  372
            F+++D FPL           A  PF T P P       +NP  V    YD+ + G EI  
Sbjct  418  FYILDKFPL-----------AIRPFYTMPDP-------NNP--VYSNSYDMFMRGEEILS  457

Query  373  GSIRIHSSE-LQESILHFLNIETSSLQHMIQAFKYGCPPHGGIALGIDRLMSILCGTQSI  431
            G+ RIH  E L E   H   I+TS +   I++F+YGCPPH G  +G++R++ +  G  +I
Sbjct  458  GAQRIHDPEYLIERAKHH-GIDTSKIAAYIESFRYGCPPHAGGGIGMERVVMLYLGLDNI  516

Query  432  RDVIAFPK  439
            R    FP+
Sbjct  517  RKTSMFPR  524


 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 5/129 (4%)

Query  4    LLFQAKEDLRLKHRYLDFRFPEMQHNLRFRSKFLMRTREFLATHRDFVEVETPTLF-KRT  62
            L  +  +D RL +R LD R P  Q   R  +      R+ L T + F E+ TP +    +
Sbjct  200  LNIRVNQDTRLDNRVLDLRTPANQAIFRLEAGVCRLFRDIL-TEQGFTEIHTPKIISAAS  258

Query  63   PGGAREFVVPTHEPNKFYSLVQSPQQLKQLLMVGSVDRYFQIARCYRDESTRPDRQ-PEF  121
             GGA  F V   + + +  L QSPQ  KQ+ +    D+ + +   +R E +   R   EF
Sbjct  259  EGGANVFTVSYFKDSAY--LAQSPQLYKQMAIAADFDKVYTVGAVFRAEDSNTHRHLTEF  316

Query  122  TQLDIELSF  130
              LD+E++F
Sbjct  317  VGLDLEMAF  325


>Q9XYM1_DROME unnamed protein product
Length=531

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (51%), Gaps = 24/128 (19%)

Query  315  FWVVD-FPLFLPSDSGTLESAHHPF-TQPHPEDEHLLSSNPLEVRGLHYDLVLNGNEIGG  372
            F+++D FPL           A  PF T P P       +NP  V    YD+ + G EI  
Sbjct  418  FYILDKFPL-----------AIRPFYTMPDP-------NNP--VYSNSYDMFMRGEEILS  457

Query  373  GSIRIHSSE-LQESILHFLNIETSSLQHMIQAFKYGCPPHGGIALGIDRLMSILCGTQSI  431
            G+ RIH  E L E   H   I+TS +   I++F+YGCPPH G  +G++R++ +  G  +I
Sbjct  458  GAQRIHDPEYLIERAKHH-GIDTSKIAAYIESFRYGCPPHAGGGIGMERVVMLYLGLDNI  516

Query  432  RDVIAFPK  439
            R     P+
Sbjct  517  RKTSMLPR  524


 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 5/129 (4%)

Query  4    LLFQAKEDLRLKHRYLDFRFPEMQHNLRFRSKFLMRTREFLATHRDFVEVETPTLFKR-T  62
            L  +  +D RL +R LD R P  Q   R  +      R+ L T + F E+ TP +    +
Sbjct  200  LNIRVNQDTRLDNRVLDLRTPANQAIFRLEAGVCRLFRDIL-TEQGFTEIHTPKIISAAS  258

Query  63   PGGAREFVVPTHEPNKFYSLVQSPQQLKQLLMVGSVDRYFQIARCYRDESTRPDRQ-PEF  121
             GGA  F V   + + +  L QSPQ  KQ+ +    D+ + +   +R E +   R   EF
Sbjct  259  EGGANVFTVSYFKDSAY--LAQSPQLYKQMAIAADFDKVYTVGAVFRAEDSNTHRHLTEF  316

Query  122  TQLDIELSF  130
              LD+E++F
Sbjct  317  VGLDLEMAF  325


>Q8SXM8_DROME unnamed protein product
Length=574

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 5/138 (4%)

Query  10   EDLRLKHRYLDFRFPE-MQHNLRFRSKFLMRTREFLATHRDFVEVETPTLFKRTPGGARE  68
            ++ R + RYLD      ++   + R+K +   R+FL     F+E+ETP +     GGA  
Sbjct  206  KETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFL-DRLGFLEIETP-MMNMIAGGATA  263

Query  69   FVVPTHEPNKFYSLVQ--SPQQLKQLLMVGSVDRYFQIARCYRDESTRPDRQPEFTQLDI  126
                TH  +    L    +P+   ++L+VG +DR ++I R +R+E       PEFT  + 
Sbjct  264  KPFVTHHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEF  323

Query  127  ELSFTTRDDVMRLIEELL  144
             +++    D+M + E+L+
Sbjct  324  YMAYADYADIMDITEQLV  341


 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 0/41 (0%)

Query  398  QHMIQAFKYGCPPHGGIALGIDRLMSILCGTQSIRDVIAFP  438
            ++   + +YG PP GG  +GIDRL   L  + +I++V+ FP
Sbjct  514  ENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIKEVLLFP  554



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01760.1.1 Unknown

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PG82_DROME  unnamed protein product                                 30.4    2.7  
Q9VPB0_DROME  unnamed protein product                                 30.0    2.9  
O44382_DROME  unnamed protein product                                 28.5    9.1  


>M9PG82_DROME unnamed protein product
Length=924

 Score = 30.4 bits (67),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 8/66 (12%)

Query  421  VHSDIHNVISKLFIFNKRLRQENVLNSRSCYIKIRKCYNLNQYLLCKNFEQLN----QIY  476
            V S++H   S+LF+  +RL    +L S S   KI K  N+N+  L K  +Q++    ++Y
Sbjct  821  VSSEVH---SRLFLMGERLFATELLESNSFVDKICKARNVNEMALAK-AKQISTSSAEMY  876

Query  477  KCLKEV  482
            + LK++
Sbjct  877  RTLKKL  882


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 30.0 bits (66),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 8/66 (12%)

Query  421  VHSDIHNVISKLFIFNKRLRQENVLNSRSCYIKIRKCYNLNQYLLCKNFEQLN----QIY  476
            V S++H   S+LF+  +RL    +L S S   KI K  N+N+  L K  +Q++    ++Y
Sbjct  823  VSSEVH---SRLFLMGERLFATELLESNSFVDKICKARNVNEMALAK-AKQISTSSAEMY  878

Query  477  KCLKEV  482
            + LK++
Sbjct  879  RTLKKL  884


>O44382_DROME unnamed protein product
Length=510

 Score = 28.5 bits (62),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 16/60 (27%), Positives = 27/60 (45%), Gaps = 7/60 (12%)

Query  307  IAYQDAYNIARFDKDKKAVIFKLIHIQDDRPI-IWNTVLSEYFSQLNGFSRDVLSLHVND  365
            + ++ A N+  FD+        ++    DR I +W+T   E+   LNG  R +  L   D
Sbjct  330  VGHRAAVNVVDFDEKY------IVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRD  383



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01770.1.1 Pogo

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NK80_DROME  unnamed protein product                                 32.7    0.68 
Q7YU32_DROME  unnamed protein product                                 32.3    0.90 
Q7KT70_DROME  unnamed protein product                                 32.3    0.91 


>Q9NK80_DROME unnamed protein product
Length=956

 Score = 32.7 bits (73),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query  127  GIDWYYGFMQRHPTLSLRTPEGCSLSRATSFNRN-------TCQQ--FFVNLKNVLSRYP  177
            G DWY G+ ++      +TPE  +L RA  FNRN       T Q+  FFV     LS Y 
Sbjct  442  GDDWYEGWREKDWRFLTKTPE--TLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYY  499

Query  178  EFADG  182
            E  DG
Sbjct  500  EL-DG  503


>Q7YU32_DROME unnamed protein product
Length=956

 Score = 32.3 bits (72),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query  127  GIDWYYGFMQRHPTLSLRTPEGCSLSRATSFNRN-------TCQQ--FFVNLKNVLSRYP  177
            G DWY G+ ++      +TPE  +L RA  FNRN       T Q+  FFV     LS Y 
Sbjct  442  GDDWYEGWREKDWRFLTQTPE--TLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYY  499

Query  178  EFADG  182
            E  DG
Sbjct  500  EL-DG  503


>Q7KT70_DROME unnamed protein product
Length=956

 Score = 32.3 bits (72),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query  127  GIDWYYGFMQRHPTLSLRTPEGCSLSRATSFNRN-------TCQQ--FFVNLKNVLSRYP  177
            G DWY G+ ++      +TPE  +L RA  FNRN       T Q+  FFV     LS Y 
Sbjct  442  GDDWYEGWREKDWRFLTQTPE--TLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYY  499

Query  178  EFADG  182
            E  DG
Sbjct  500  EL-DG  503



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01780.1.1 SprT-like

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXU6_DROME  unnamed protein product                                 124     6e-33
Q56H90_DROME  unnamed protein product                                 28.1    2.8  
Q2PE13_DROME  unnamed protein product                                 28.1    2.8  


>Q9VXU6_DROME unnamed protein product
Length=724

 Score = 124 bits (310),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 112/202 (55%), Gaps = 27/202 (13%)

Query  8    DPDFFLALTLQKKFNEEYKKEKDAKGSSSNL-------FESLTTKSSQDTIPSPVRKKPN  60
            D D+  AL LQ + N E  +   A  +S++         ++L  +  +D          +
Sbjct  3    DADYLFALNLQNQLNAESDQSYTAADASNDRDYQLARRIQNLINEGDED---GASELDSS  59

Query  61   ISSIHKPNTEPSSSVMKPTSSSSLASRSSNNQRPS-----------SQTMSLNDSQWEVI  109
            I  ++  + +P S+ M+  S      R +  ++P            ++TM+L D +WE++
Sbjct  60   IQFVYPKSNQPKSTKME-NSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELV  118

Query  110  DPTPDIHGLFVAFAKRFFQDRLGSVEVKWSKRMTSCAGVCRFKGRRDRSGRGIGEVTISL  169
            DPTPDI+ +F+ F ++FFQ+RLG+V ++WSK+M SCAG+C  +G      R + +VTI L
Sbjct  119  DPTPDIYAMFIRFDEKFFQERLGAVSLEWSKKMYSCAGICYQRG-----NRFVKQVTIRL  173

Query  170  SEPLLKLRPRSDLVNTLLVSNI  191
            SEPLLKLRPR DLV TLL   I
Sbjct  174  SEPLLKLRPRKDLVETLLHEMI  195


>Q56H90_DROME unnamed protein product
Length=381

 Score = 28.1 bits (61),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 6/44 (14%)

Query  56   RKKPNISSIHKPNTEPSSSVMKPTSSSSLASR------SSNNQR  93
            R +P + S + PN EPSS+ + PTS   +  R      S+NN+R
Sbjct  224  RPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNNRR  267


>Q2PE13_DROME unnamed protein product
Length=381

 Score = 28.1 bits (61),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 6/44 (14%)

Query  56   RKKPNISSIHKPNTEPSSSVMKPTSSSSLASR------SSNNQR  93
            R +P + S + PN EPSS+ + PTS   +  R      S+NN+R
Sbjct  224  RPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNNRR  267



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


Query= Dcitr00g01790.1.1 Nose

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IR42_DROME  unnamed protein product                                 144     5e-36
Q9U6W3_DROME  unnamed protein product                                 75.1    2e-14
C6A17_DROME  unnamed protein product                                  30.0    3.9  


>Q8IR42_DROME unnamed protein product
Length=827

 Score = 144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 112/434 (26%), Positives = 192/434 (44%), Gaps = 44/434 (10%)

Query  43   AANSTLNTECTRQSRIYLDHLDNNTHWAIRMLDASLVAPTGLIAGDTIQYGSPDQCIHTH  102
            A N   +T C RQ   +L+ LDN   WA++M D+S    +G++ G+  Q G  DQC+   
Sbjct  145  ARNPDASTLCRRQMHQFLNALDNFDLWALKMHDSSGKLNSGILNGNINQPGDFDQCLGIQ  204

Query  103  IPLPN-------------IRPKYCLPTAQYSPSRAIYPDYYANRTLYGPPYDMEKNVWDF  149
              +               IR +YCL  AQ        P    N       + + ++   F
Sbjct  205  QRMNQDQDAGQDQDGDSIIRGQYCLAYAQ--------PVLPHNSKRLKSFFKLIQSHGPF  256

Query  150  FTPMSD-FIRYPRHKF-SWGVCVPEVCTAQDIQHSLAQSLTTAFAKHQINFDVSLTELGC  207
             +  +D   R PR+   +WG+CVP  C+A+D+++S+A+ L    A   I F+V +    C
Sbjct  257  KSEFNDPGHRVPRYSLINWGLCVPSGCSARDVEYSVAEYLGNQTASTGITFNVRVEPQMC  316

Query  208  YSEAEME-SRRLPLAGYLWVCICVVLVLLCIAGTAVEYQDIHGTDTNLNKEEPAKPGHIK  266
                +    R    A   ++ +  V VL  I   + + Q          K+ P       
Sbjct  317  QVRDQRPWDRNTTWAVRFFLLVLSVAVLSTIYDRSTKSQP---------KQNP-------  360

Query  267  SFLSIFSLIRNTRKLCRMDKNPSSIVVIDGMKGFLMAIFIMFHRAMFSMGFA--KNLEVY  324
             + + FSL +N R L      P  I  + G++ FL AI ++F     +M F    N    
Sbjct  361  -WFTAFSLDKNLRWLFSTSSAPGDIEAVHGIR-FLNAIMLIFSHKSMAMFFNPYNNRTAM  418

Query  325  EQALHNIEYFWLSSGTHMLDTFFFISGFLLAWGIIQKLNKNRTLNYSTMILNRVVRMYPM  384
             ++L         + +   D F   SG L ++ +  +L K + +      ++R++R+ P 
Sbjct  419  SESLGQPWTVIGRAASLYTDPFLLFSGMLTSYSLFGRLMKQQPIRLKNEYISRLMRIVPP  478

Query  385  YILIIAFTIWVLPYVGEGPMWKPYAEAESQYCKQSWWQNLLFVSTLNDYGDLCIASSWYV  444
               +I F  +VLP  G GP W       +  CK++WW+NLLF+     + ++C+  + ++
Sbjct  479  LAALILFCTYVLPLWGSGPQWNLVVGHHADICKKNWWRNLLFIHNYFGFSEMCLTHTHHL  538

Query  445  STDFQLFLISLVLI  458
              D +LF ++ +LI
Sbjct  539  GIDTELFAVAPLLI  552


>Q9U6W3_DROME unnamed protein product
Length=377

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 62/115 (54%), Gaps = 0/115 (0%)

Query  344  DTFFFISGFLLAWGIIQKLNKNRTLNYSTMILNRVVRMYPMYILIIAFTIWVLPYVGEGP  403
            D F   SG L ++ +  +L K + +      ++R++R+ P    +I F  +VLP  G GP
Sbjct  12   DPFLLFSGMLTSYSLFGRLMKQQPIRLKNEYISRLMRIVPPLAALILFCTYVLPLWGSGP  71

Query  404  MWKPYAEAESQYCKQSWWQNLLFVSTLNDYGDLCIASSWYVSTDFQLFLISLVLI  458
             W       +  CK++WW+NLLF+     + ++C+  + ++  D +LF ++ +LI
Sbjct  72   QWNLVVGHHADICKKNWWRNLLFIHNYFGFSEMCLTHTHHLGIDTELFAVAPLLI  126


>C6A17_DROME unnamed protein product
Length=501

 Score = 30.0 bits (66),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 16/62 (26%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  165  SWGVCVPEVCTAQDIQHSLAQSLTTAFAKHQINFD-VSLTELGCYSEAEMES-RRLPLAG  222
            + G  + E+   QD+Q  L + +   F KH   F    + E+    +  ME+ R+ P+  
Sbjct  312  TMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLA  371

Query  223  YL  224
            +L
Sbjct  372  HL  373



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 232245657


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g01800.1.1 Protein

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   213     6e-62
Q9VRF2_DROME  unnamed protein product                                 30.8    1.8  
Q8MST7_DROME  unnamed protein product                                 30.8    1.8  


>TTY2_DROME unnamed protein product
Length=655

 Score = 213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 166/467 (36%), Positives = 253/467 (54%), Gaps = 40/467 (9%)

Query  13   RPPVLTTIFHRFPHVNVSLQLVNSTFDPRSEVYIE----------------SLGILGSIP  56
            +P +L  I H  PHVN + + VN TF+P S+VY+E                SL IL SIP
Sbjct  3    QPSILVKILHSIPHVNYTFRRVNDTFNPDSDVYLEPTNNKLQCQQKGIELQSLVILASIP  62

Query  57   ALWLIFTLFILLIYLLTRCCDRKPRAKHSITVLKWSLFLFAVLCGATLGIALYGNDDVHN  116
            A  LI +L  LL+YLLTRCCDR+ R   +      SL +  ++  A +G+ LYGNDD HN
Sbjct  63   AGLLIGSLLGLLLYLLTRCCDRRQRKPSAQRCQSCSLVIITLMTCAAIGLGLYGNDDFHN  122

Query  117  GLDSAISSLRAIDENIVSARNQTLTIETTLQIKVKQLMTELNDVFSEPVRNQTIRKSLLT  176
            GL  A  S ++++  +++ + QT +I+  L+ ++     E   +  +P  NQT+   L+ 
Sbjct  123  GLLQAFGSGKSVEGLVLTLKRQTESIKHDLETRMAGHKVE--QLVEKPHYNQTVVMLLIE  180

Query  177  SLANMQGNTTSAVKACQEIQTPLHML-------NFTNLFNYLYLGE---SIRYPATMALY  226
            +   +  NT+ AV +   +   +H         N T+L   L LGE   SIR+PAT+A  
Sbjct  181  TSRLVTENTSRAVASLDSM---VHYFMKAKGSENDTSLMGLLQLGEFYESIRWPATLAFL  237

Query  227  ITLLVFCIMLIFGVYRHSRCCLITFSVFGLFAIIICWLLSSLYLVIAVATGDVCMSPDRF  286
              LL+ C +L+ GV R SRC LI FSV GLF IIICWLL+ +YL  +VA GD CM P  +
Sbjct  238  TVLLLLCTVLVIGVARRSRCTLIFFSVSGLFCIIICWLLAGVYLASSVAAGDFCMRPHDY  297

Query  287  LERQSPPPVRLQMDILAYYLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYK  346
            + RQ    V ++   +  +L C T R N F + +      V+    ++  + R++++ Y 
Sbjct  298  MCRQ----VGMRSPYVD-FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYP  351

Query  347  HELLHPSLDILTTEVKLASNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAM  406
            H  +  +L+ +  ++++    ++ L A L+ + I+  Y  AL+  C   L GL+LM++A 
Sbjct  352  HIDIQRTLNAMDNDLEITLRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAG  411

Query  407  AVAGFFFTVLVWLDSHTWIYIRKKREYLQVDEQD--PYMPPSAASQA  451
             +  F  T+LV+ DSH WIY+  KR  L  D+ +  P  P S A  A
Sbjct  412  LLTSFLLTILVYADSHAWIYL-TKRPTLDADKSETAPLFPASNAPSA  457


 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 9/50 (18%)

Query  466  MMMGNNYSSHTLG-----HKKFQR--DGP--GQYSTLSKKCKTLESSDFY  506
            ++ G     HTLG     H++      GP  G+Y+TLSK+CKTLES+DFY
Sbjct  606  LVHGTRSGHHTLGRLPSHHQQSATYLPGPNNGKYATLSKQCKTLESNDFY  655


>Q9VRF2_DROME unnamed protein product
Length=1386

 Score = 30.8 bits (68),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 25/56 (45%), Gaps = 0/56 (0%)

Query  199  LHMLNFTNLFNYLYLGESIRYPATMALYITLLVFCIMLIFGVYRHSRCCLITFSVF  254
            +H  N T L   L     ++   + AL ++ L   +  +   + HS+ C  T SVF
Sbjct  190  IHCFNNTALGQLLSKAAGVQMAQSHALLVSPLAMVLHTLVAEFLHSQNCHFTLSVF  245


>Q8MST7_DROME unnamed protein product
Length=1228

 Score = 30.8 bits (68),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 25/56 (45%), Gaps = 0/56 (0%)

Query  199  LHMLNFTNLFNYLYLGESIRYPATMALYITLLVFCIMLIFGVYRHSRCCLITFSVF  254
            +H  N T L   L     ++   + AL ++ L   +  +   + HS+ C  T SVF
Sbjct  32   IHCFNNTALGQLLSKAAGVQMAQSHALLVSPLAMVLHTLVAEFLHSQNCHFTLSVF  87



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01810.1.1 Protein

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   217     1e-62
M9PB02_DROME  unnamed protein product                                 31.6    1.3  
A0A0R4YI50_DROME  unnamed protein product                             31.2    1.4  


>TTY2_DROME unnamed protein product
Length=655

 Score = 217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 173/497 (35%), Positives = 264/497 (53%), Gaps = 45/497 (9%)

Query  13   RPPVLTTIFHRFPHVNVSLQLVNSTFDPRSEVYIE----------------SLGILGSIP  56
            +P +L  I H  PHVN + + VN TF+P S+VY+E                SL IL SIP
Sbjct  3    QPSILVKILHSIPHVNYTFRRVNDTFNPDSDVYLEPTNNKLQCQQKGIELQSLVILASIP  62

Query  57   ALWLIFTLFILLIYLLTRCCDRKPRAKHSITVLKWSLFLFAVLCGATLGIALYGNDDVHN  116
            A  LI +L  LL+YLLTRCCDR+ R   +      SL +  ++  A +G+ LYGNDD HN
Sbjct  63   AGLLIGSLLGLLLYLLTRCCDRRQRKPSAQRCQSCSLVIITLMTCAAIGLGLYGNDDFHN  122

Query  117  GLDSAISSLRAIDENIVSARNQTLTIETTLQIKVKQLMTELNDVFSEPVRNQTIRKSLLT  176
            GL  A  S ++++  +++ + QT +I+  L+ ++     E   +  +P  NQT+   L+ 
Sbjct  123  GLLQAFGSGKSVEGLVLTLKRQTESIKHDLETRMAGHKVE--QLVEKPHYNQTVVMLLIE  180

Query  177  SLANMQGNTTSAVKACQEIQTPLHML-------NFTNLFNYLYLGE---SIRYPATMALY  226
            +   +  NT+ AV +   + + +H         N T+L   L LGE   SIR+PAT+A  
Sbjct  181  TSRLVTENTSRAVAS---LDSMVHYFMKAKGSENDTSLMGLLQLGEFYESIRWPATLAFL  237

Query  227  ITLLVFCIMLIFGVYRHSRCCLITFSVFGLFAIIICWLLSSLYLVIAVATGDVCMSPDRF  286
              LL+ C +L+ GV R SRC LI FSV GLF IIICWLL+ +YL  +VA GD CM P  +
Sbjct  238  TVLLLLCTVLVIGVARRSRCTLIFFSVSGLFCIIICWLLAGVYLASSVAAGDFCMRPHDY  297

Query  287  LERQSPPPVRLQMDILAYYLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYK  346
            + RQ    V ++   +  +L C T R N F + +      V+    ++  + R++++ Y 
Sbjct  298  MCRQ----VGMRSPYVD-FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYP  351

Query  347  HELLHPSLDILTTEVKLASNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAM  406
            H  +  +L+ +  ++++    ++ L A L+ + I+  Y  AL+  C   L GL+LM++A 
Sbjct  352  HIDIQRTLNAMDNDLEITLRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAG  411

Query  407  AVAGFFFTVLVWLDSHTWIYIRKKREYLQVDEQD--PYMPPSAASQAIAARTMRPPQGDI  464
             +  F  T+LV+ DSH WIY+  KR  L  D+ +  P  P S A  A  + T     G I
Sbjct  412  LLTSFLLTILVYADSHAWIYL-TKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTI  470

Query  465  -----YGRSPGVGGGVG  476
                 + +    GGG G
Sbjct  471  NRTLLHHQQASSGGGSG  487


 Score = 38.5 bits (88),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 9/50 (18%)

Query  528  MMMGNNYSSHTLGH--KKFQRD-----GP--GQYSTLSKKCKTLESSDFY  568
            ++ G     HTLG      Q+      GP  G+Y+TLSK+CKTLES+DFY
Sbjct  606  LVHGTRSGHHTLGRLPSHHQQSATYLPGPNNGKYATLSKQCKTLESNDFY  655


>M9PB02_DROME unnamed protein product
Length=654

 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query  427  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGVGPGNMGTLR  484
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G  P     L 
Sbjct  265  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLE  322


>A0A0R4YI50_DROME unnamed protein product
Length=698

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query  427  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGVGPGNMGTLR  484
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G  P     L 
Sbjct  265  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLE  322



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01820.1.1 Unknown

Length=150


***** No hits found *****



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01830.1.1 Protein

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   58.2    5e-10
M9PBS1_DROME  unnamed protein product                                 30.4    0.70 
M9PB02_DROME  unnamed protein product                                 30.4    0.73 


>TTY2_DROME unnamed protein product
Length=655

 Score = 58.2 bits (139),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  25   YLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYKHELLHPSLDILTTEVKLA  84
            +L C T R N F + +      V+    ++  + R++++ Y H  +  +L+ +  ++++ 
Sbjct  311  FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYPHIDIQRTLNAMDNDLEIT  369

Query  85   SNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTW  144
               ++ L A L+ + I+  Y  AL+  C   L GL+LM++A  +  F  T+LV+ DSH W
Sbjct  370  LRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAGLLTSFLLTILVYADSHAW  429

Query  145  IYIRKKREYLQVDEQD--PYMPPSAASQAIAARTMRPPQGDI-----YGRSPGVGGGWG  196
            IY+  KR  L  D+ +  P  P S A  A  + T     G I     + +    GGG G
Sbjct  430  IYL-TKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTINRTLLHHQQASSGGGSG  487


>M9PBS1_DROME unnamed protein product
Length=603

 Score = 30.4 bits (67),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  147  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGWGQETW  200
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G   +T+
Sbjct  257  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTF  310


>M9PB02_DROME unnamed protein product
Length=654

 Score = 30.4 bits (67),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  147  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGWGQETW  200
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G   +T+
Sbjct  265  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTF  318



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01830.1.2 Protein

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   58.2    5e-10
M9PBS1_DROME  unnamed protein product                                 30.4    0.70 
M9PB02_DROME  unnamed protein product                                 30.4    0.73 


>TTY2_DROME unnamed protein product
Length=655

 Score = 58.2 bits (139),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  25   YLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYKHELLHPSLDILTTEVKLA  84
            +L C T R N F + +      V+    ++  + R++++ Y H  +  +L+ +  ++++ 
Sbjct  311  FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYPHIDIQRTLNAMDNDLEIT  369

Query  85   SNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTW  144
               ++ L A L+ + I+  Y  AL+  C   L GL+LM++A  +  F  T+LV+ DSH W
Sbjct  370  LRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAGLLTSFLLTILVYADSHAW  429

Query  145  IYIRKKREYLQVDEQD--PYMPPSAASQAIAARTMRPPQGDI-----YGRSPGVGGGWG  196
            IY+  KR  L  D+ +  P  P S A  A  + T     G I     + +    GGG G
Sbjct  430  IYL-TKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTINRTLLHHQQASSGGGSG  487


>M9PBS1_DROME unnamed protein product
Length=603

 Score = 30.4 bits (67),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  147  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGWGQETW  200
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G   +T+
Sbjct  257  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTF  310


>M9PB02_DROME unnamed protein product
Length=654

 Score = 30.4 bits (67),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  147  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGWGQETW  200
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G   +T+
Sbjct  265  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTF  318



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01840.1.1 jacalin-related

Length=245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTR6_DROME  unnamed protein product                                 30.8    0.75 
Q7YU48_DROME  unnamed protein product                                 30.4    0.83 
Q9U617_DROME  unnamed protein product                                 27.3    7.7  


>Q9VTR6_DROME unnamed protein product
Length=1713

 Score = 30.8 bits (68),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-GSTNGTGTTGTGTTPG-GST  163
            G+ PG G+  G G  G G  PG G+  G G  G G+ PG G   G G  G GT PG G+ 
Sbjct  486  GSQPGVGAQTGAGQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQ  545

Query  164  NGTGITGTGTTPG  176
             GTG  G G  PG
Sbjct  546  TGTGQPGYGAQPG  558


 Score = 29.6 bits (65),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 39/79 (49%), Gaps = 10/79 (13%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-------GSTNGTGTTGTGTT  158
            GT PG G+  GTG  G G  PG G+  G G  G G+ PG       G+  GTG  G G  
Sbjct  588  GTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGYGSQPGYGTQPGVGAQTGTGQPGYGAQ  647

Query  159  PG-GSTNGTGITGTGTTPG  176
            PG G   G G  G GT PG
Sbjct  648  PGVGGQTGAGQPGYGTQPG  666


>Q7YU48_DROME unnamed protein product
Length=1071

 Score = 30.4 bits (67),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-GSTNGTGTTGTGTTPG-GST  163
            G+ PG G+  G G  G G  PG G+  G G  G G+ PG G   G G  G GT PG G+ 
Sbjct  486  GSQPGVGAQTGAGQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQ  545

Query  164  NGTGITGTGTTPG  176
             GTG  G G  PG
Sbjct  546  TGTGQPGYGAQPG  558


 Score = 29.3 bits (64),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 39/79 (49%), Gaps = 10/79 (13%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-------GSTNGTGTTGTGTT  158
            GT PG G+  GTG  G G  PG G+  G G  G G+ PG       G+  GTG  G G  
Sbjct  588  GTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGYGSQPGYGTQPGVGAQTGTGQPGYGAQ  647

Query  159  PG-GSTNGTGITGTGTTPG  176
            PG G   G G  G GT PG
Sbjct  648  PGVGGQTGAGQPGYGTQPG  666


>Q9U617_DROME unnamed protein product
Length=1729

 Score = 27.3 bits (59),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 45/93 (48%), Gaps = 9/93 (10%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-GSTNGTGTTGTGTTPG-GST  163
            GT PG G+  G G  G G+ PG G   G G  G G+ PG G   G G  G GT PG G+ 
Sbjct  537  GTQPGIGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQ  596

Query  164  NGTGITGTGTTPGGSTNGTGTTPGGSTNGTGTT  196
             GTG  G G+ PG      GT  G    G G+ 
Sbjct  597  TGTGQPGYGSQPG-----VGTQIGAGQPGYGSQ  624



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01850.1.1 leukocyte

Length=216
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VI72_DROME  unnamed protein product                                 28.1    3.9  
KINH_DROME  unnamed protein product                                   26.9    9.4  


>Q9VI72_DROME unnamed protein product
Length=901

 Score = 28.1 bits (61),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 44/88 (50%), Gaps = 14/88 (16%)

Query  127  SKKRKRAKISEESESESEDSDRSKKIEILRQE---------RLKREAEEKVRAE--KVLA  175
            ++ R RA++     SE E  +   +IE+LR+E         ++ RE   K+  E  + +A
Sbjct  553  AQARLRAQLRA---SEKEQRNYRDEIELLRKENKRLEQELVKIGRENNSKMLQEINRNIA  609

Query  176  KLRGESIPDGTKVDELRENGRKKQKYNS  203
            +L  + +P  T  D L ENGR+ Q  + 
Sbjct  610  RLAPKVLPSATMSDILDENGRRTQSLDG  637


>KINH_DROME unnamed protein product
Length=975

 Score = 26.9 bits (58),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (54%), Gaps = 8/106 (8%)

Query  93   AKSTSRYENQRSHEDDGRSKHKKRKEKYRTKPRKSKKRKRAKISEESESESEDSDRS--K  150
            A+  S  E Q++  +   S+++K   +YR     S+   R K  +ES  E+E+  R+  +
Sbjct  629  AQRCSNMETQQADSNKKISEYEKDLGEYRLLI--SQHEARMKSLQESMREAENKKRTLEE  686

Query  151  KIEILRQERLKREAEEKVRAEKVLAKLRGE---SIPDGTKVDELRE  193
            +I+ LR+E  K +A E V A     K R E   S+ D +++DELRE
Sbjct  687  QIDSLREECAKLKAAEHVSAVNAEEKQRAEELRSMFD-SQMDELRE  731



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01860.1.1 Peptidyl-prolyl

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0Q2_DROME  unnamed protein product                                 264     3e-92
Q7K231_DROME  unnamed protein product                                 166     5e-50
Q9W227_DROME  unnamed protein product                                 154     2e-48


>Q9W0Q2_DROME unnamed protein product
Length=176

 Score = 264 bits (675),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)

Query  1    MGEIIVELYWKHAPNTCRNFAELCRRNYYNGIKFHRIIRDFMIQGGDPTGTGRGGSSIYG  60
            MGEI VELYWKHAPNTCRNFAEL RR YYN + FHRIIRDFMIQGGDPTGTGRGG+SIYG
Sbjct  29   MGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYG  88

Query  61   KTFADEIHEELKHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHAIFGRIYSGMSVV  120
              FADE+H +L+HTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKH IFGR+Y+GM VV
Sbjct  89   SEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVV  148

Query  121  KRIGLVETDKNDRPVDDVKILKTHVR  146
            KRIG+VETDKNDRPVD ++I+K  V 
Sbjct  149  KRIGMVETDKNDRPVDPLRIIKAKVE  174


>Q7K231_DROME unnamed protein product
Length=517

 Score = 166 bits (421),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 99/145 (68%), Gaps = 0/145 (0%)

Query  1    MGEIIVELYWKHAPNTCRNFAELCRRNYYNGIKFHRIIRDFMIQGGDPTGTGRGGSSIYG  60
            +G + +EL+    P  C NF + C   YYN + FHR IR+F++QGGDPTG+G GG SI+G
Sbjct  288  LGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIWG  347

Query  61   KTFADEIHEELKHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHAIFGRIYSGMSVV  120
            K F DE    L HTG G+LSMANSGP+TNGSQFFIT    + LDGKH IFG++  G+  +
Sbjct  348  KKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTL  407

Query  121  KRIGLVETDKNDRPVDDVKILKTHV  145
            +++  +E D  DRP++D+ I  + V
Sbjct  408  QKMENIEVDNKDRPIEDIIIESSQV  432


>Q9W227_DROME unnamed protein product
Length=205

 Score = 154 bits (389),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 98/143 (69%), Gaps = 5/143 (3%)

Query  2    GEIIVELYWKHAPNTCRNFAELCRRNY---YNGIKFHRIIRDFMIQGGDPT-GTGRGGSS  57
            G I + L+ K  P T  NF EL  +     Y G KFHRII+DFMIQGGD T G G GG S
Sbjct  43   GRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRS  102

Query  58   IYGKTFADEIHEELKHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHAIFGRIYSGM  117
            IYG+ F DE + +LKH GAG LSMAN+G DTNGSQFFIT   T WLDG+H +FG+I SGM
Sbjct  103  IYGERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGM  161

Query  118  SVVKRIGLVETDKNDRPVDDVKI  140
            +VV++I    TD  DRPV DV I
Sbjct  162  NVVRQIENSATDARDRPVKDVVI  184



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01870.1.1 Leukocyte

Length=221


***** No hits found *****



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01880.1.1 Unknown

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ADAR_DROME  unnamed protein product                                   26.9    4.6  


>ADAR_DROME unnamed protein product
Length=676

 Score = 26.9 bits (58),  Expect = 4.6, Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 19/39 (49%), Gaps = 4/39 (10%)

Query  56   TDGFYEDYKRSGLDFHTFY----AGYRPTFRPHENCIGL  90
            TDG Y    +SG+ FH +      G    F PHEN  G+
Sbjct  407  TDGQYPYKLKSGVHFHLYINTAPCGDARIFSPHENDTGV  445



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01890.1.1 Elongation

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCY6_DROME  unnamed protein product                                 260     6e-84
Q9VCY7_DROME  unnamed protein product                                 179     2e-52
Q5JZZ4_DROME  unnamed protein product                                 134     2e-36


>Q9VCY6_DROME unnamed protein product
Length=295

 Score = 260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 170/254 (67%), Gaps = 2/254 (1%)

Query  1    METIFGPAMRLYKYVNEDLADPRTKDFFLIGSPIPGLCLLAFYNYFVHNLGPRFMEDRKP  60
            M  +    +  + ++  DLADPRT D+FLI SP+P L +LAFY +FV + GP+FM+DRKP
Sbjct  1    MAAVNATQVDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKP  60

Query  61   FKLDRFMIYYNIVQIVASLYLFIEASKVWLFEYNWKCQPIDNSTDEKALNVIRLCYLYFW  120
            FKL+R ++ YN  Q+  S+++  E   +W + Y+W+CQP+D S   KA    R+ Y+Y+ 
Sbjct  61   FKLERTLLVYNFFQVALSVWMVYEGVVIWQY-YSWRCQPVDWSRTPKAYREARVVYVYYL  119

Query  121  LKLIDLTDTIIFVLRKKFSSVSFLHVYHHTGMVMLTWSGVKWFPGGHDTWIGWLNSIVHV  180
             K+ +L DTI FVLRK    V+FLHVYHHT M M++W   K++PGGH T+IGW+NS VH+
Sbjct  120  AKITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHI  179

Query  181  VMYGYYLLCVLQPQYKTSIWWKKHLTQMQMIQFLLNSIHSLQILFYPDCGYPKWLVLIIV  240
            +MY YY L    PQ +  +WWKK++T +QMIQF    IH  Q+L Y DCGYP+W V   +
Sbjct  180  IMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLL-YTDCGYPRWSVCFTL  238

Query  241  PQNFFMFYLFYRFY  254
            P   F ++LF  FY
Sbjct  239  PNAVFFYFLFNDFY  252


>Q9VCY7_DROME unnamed protein product
Length=322

 Score = 179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 151/265 (57%), Gaps = 9/265 (3%)

Query  20   ADPRTKDFFLIGSPIPGLCLLAFYNYFVHNLGPRFMEDRKPFKLDRFMIYYNIVQIVASL  79
             D     +FL+ SP+P + ++  Y  FV  +GP +M++RKP  L R M++YN  Q++ S+
Sbjct  19   VDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI  78

Query  80   YLF---IEASKVWLFEYNWKCQPIDNSTDEKALNVIRLCYLYFWLKLIDLTDTIIFVLRK  136
            ++    I+ S V    ++ KC+   N T E+ L +    + YF+ K+IDL DT  FVLRK
Sbjct  79   WMCRTSIQESNVMASIFSKKCEI--NRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRK  136

Query  137  KFSSVSFLHVYHHTGMVMLTWSGVKWFPGGHDTWIGWLNSIVHVVMYGYYLLCVLQPQYK  196
            K + VSFLHVYHHT  V+ +W  +K+ PG     IG LNS VH++MY YY++  + PQY+
Sbjct  137  KDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQ  196

Query  197  TSIWWKKHLTQMQMIQFLLNSIHSLQILFYPDCGYPKWLVLIIVPQNFFMFYLFYRFYIN  256
              +WWKK++T +Q+IQF+L   + L +     C  PK L    V       YLF  FY  
Sbjct  197  KYLWWKKYMTSIQLIQFVLILGYMLTV-GAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRK  255

Query  257  AYCDNSKAKKLETSKMSHGAEQSSS  281
             Y    KAK ++    + G+  + S
Sbjct  256  TY---KKAKSVDGGSRTTGSSLAQS  277


>Q5JZZ4_DROME unnamed protein product
Length=262

 Score = 134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 138/252 (55%), Gaps = 7/252 (3%)

Query  18   DLADPRTKDFFLIGSPIPGLCLLAFYNYFVHNLGPRFMEDRKPFKLDRFMIYYNIVQIVA  77
            D  D RT+++ L+ S      LL+ Y   V    P++    KP +L   +  +++  +  
Sbjct  13   DQPDERTRNWPLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFL  71

Query  78   SLYLFIE---ASKVWLFEYNWKCQPIDNSTDEKALNVIRLCYLYFWLKLIDLTDTIIFVL  134
            + Y+ +E   A++    +YN+ CQP   S D   + + +  + ++  K+++  DT  F+L
Sbjct  72   NGYICLELYAATRD--LDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFIL  129

Query  135  RKKFSSVSFLHVYHHTGMVMLTWSGVKWFPGGHDTWIGWLNSIVHVVMYGYYLLCVLQPQ  194
            R+K+S +SFLHVYHH+ M +  W  +KW P G       +NS VH++MYGYY L VL P+
Sbjct  130  RQKWSQLSFLHVYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPR  189

Query  195  YKTSIWWKKHLTQMQMIQFLLNSIHSLQILFYPDCGYPKWLVLIIVPQNFFMFYLFYRFY  254
             +  +WWK++LT +Q++QF +    + Q+L    C Y  W+ L +   +    ++F +FY
Sbjct  190  VQRFLWWKRYLTGLQLVQFTIIFFWASQMLV-RGCEYGTWITLSMAIYSLPFLFMFGKFY  248

Query  255  INAYCDNSKAKK  266
            +  Y  ++  KK
Sbjct  249  MQKYTVSAVGKK  260



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01900.1.1 cytochrome

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP301_DROME  unnamed protein product                                  734     0.0  
CCD1P_DROME  unnamed protein product                                  283     5e-89
CCD1D_DROME  unnamed protein product                                  283     6e-89


>CP301_DROME unnamed protein product
Length=553

 Score = 734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/506 (69%), Positives = 417/506 (82%), Gaps = 4/506 (1%)

Query  48   LLDAESAALDNTGLSQGELDSARPYSQVPGPKPYPLLGNTWRLLPYIGQYQISNLADVSA  107
            L D+E A+      S  E  +A PY+Q+PGPKP P+LGNTWRL+P IGQY IS++A +S+
Sbjct  49   LADSEEASAPRIH-STSEWQNALPYNQIPGPKPIPILGNTWRLMPIIGQYTISDVAKISS  107

Query  108  QLYRDYGKIVRLGGLVGRPDLLFVYDADEIEKVYRQEGPTPFRPSMPCLVHYKSVVRKEF  167
             L+  YG+IVR GGL+GRPDLLF+YDADEIEK YR EGPTPFRPSMP LV YKSVVRK+F
Sbjct  108  LLHDRYGRIVRFGGLIGRPDLLFIYDADEIEKCYRSEGPTPFRPSMPSLVKYKSVVRKDF  167

Query  168  FGRLAGVVGVHGEPWREFRTKVQKPILQLRTVRKYIEPIENVTDYFIQRMNEMKDENSEM  227
            FG L GVVGVHGEPWREFR++VQKP+LQL T+R+Y++P+E +T+ F+ R   + DEN E+
Sbjct  168  FGDLGGVVGVHGEPWREFRSRVQKPVLQLSTIRRYLQPLEVITEDFLVRCENLLDENQEL  227

Query  228  PADFDNEIHKWSLECIGRVALDVRLGCLNPDLTGNDEPQKIIDAAKYALRNVAILELKLP  287
            P DFDNEIHKWSLECIGRVALD RLGCL  +L  + EPQ+IIDAAKYALRNVA LELK P
Sbjct  228  PEDFDNEIHKWSLECIGRVALDTRLGCLESNLKPDSEPQQIIDAAKYALRNVATLELKAP  287

Query  288  FWRYIPSNLWRKYVSNMNYFIEICMKYIDSAMERLKTKS-NLNENDMSLVERILLNEPDP  346
            +WRY P+ LW +YV NMN+F+ +CMKYI SA ERLKT+  +L   + SLVE+++L++ D 
Sbjct  288  YWRYFPTPLWTRYVKNMNFFVGVCMKYIQSATERLKTQDPSLRAGEPSLVEKVILSQKDE  347

Query  347  KTAYVLALDLILVGIDTISMAVCSMLYQLATRPEEQEKLHQELCRILPDPSQPLTPDKLD  406
            K A ++ALDLILVGIDTISMAVCSMLYQLATRP +Q+K+H+EL R+LPDP+ PLT   LD
Sbjct  348  KIATIMALDLILVGIDTISMAVCSMLYQLATRPVDQQKVHEELKRLLPDPNTPLTIPLLD  407

Query  407  QMIYLKAFIKEVFRMYSTVIGNGRTLQNDMVICGYRIPKGIQLVFPTIVTGNMPEYVSDP  466
            QM +LK FIKEVFRMYSTVIGNGRTL  D VICGY++PKG+Q VFPTIVTGNM EYV+D 
Sbjct  408  QMHHLKGFIKEVFRMYSTVIGNGRTLMEDSVICGYQVPKGVQAVFPTIVTGNMEEYVTDA  467

Query  467  ETFYPERWIKQSSTTGCPHSQIHPFASLPYGHGARMCLGRRFADLEMQILLAKLIRSYRL  526
             TF PERW+K     G    ++HPFASLPYG+GARMCLGRRFADLEMQILLAKL+R+Y+L
Sbjct  468  ATFRPERWLKPQH--GGTPGKLHPFASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKL  525

Query  527  EFHHKPLEYKVTFMYAPDGELKFKMT  552
            E++HKPL+Y VTFMYAPDG L+FKMT
Sbjct  526  EYNHKPLDYAVTFMYAPDGPLRFKMT  551


>CCD1P_DROME unnamed protein product
Length=521

 Score = 283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/530 (30%), Positives = 276/530 (52%), Gaps = 21/530 (4%)

Query  27   SSTTSTPTTAASVRNQSSVSGLLDAESAALDNTGLSQGELDSARPYSQVPGPKPYPLLGN  86
            SS  S       VR+  S S +L  E A    T       +  + Y ++P P  +  +  
Sbjct  5    SSARSVAIYVGPVRSSRSAS-VLAHEQAKSSIT-------EEHKTYDEIPRPNKFKFM--  54

Query  87   TWRLLPYIGQYQISNLADVSAQLYRDYGKIVRLGGLVGRPDLLFVYDADEIEKVYRQEGP  146
              R     G++Q +++ + ++ + + YG I  + G+ GR D +  ++  +IE V+R EG 
Sbjct  55   --RAFMPGGEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTFNTKDIEMVFRNEGI  112

Query  147  TPFRPSMPCLVHYKSVVRKEFFGRLAGVVGVHGEPWREFRTKVQKPILQLRTVRKYIEPI  206
             P R  +  +V+++  VR + +G + G+V    E W + R+ +    +Q R +R Y EP+
Sbjct  113  WPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPL  172

Query  207  ENVTDYFIQRMNEMKDENS-EMPADFDNEIHKWSLECIGRVALDVRLGCLNPDLTGNDEP  265
             N+ + FI+R+ E++D  + E+P DF +EI +   E +G VA D ++G +  +   N + 
Sbjct  173  SNINNEFIERIKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKN-RDNSDA  231

Query  266  QKIIDAAKYALRNVAILELKLPFWRYIPSNLWRKYVSNMNYFIEICMKYIDSAMERLKTK  325
              +   ++   R    L+++   W+ I +  +RK    +N  + +  K +    + L+ +
Sbjct  232  LTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKR  291

Query  326  SNLNE--NDMSLVERILLNEPDPKTAYVLALDLILVGIDTISMAVCSMLYQLATRPEEQE  383
                E  N  S++ER++  E DPK A +++LD++  G+D  +  + ++L  L+  P++Q 
Sbjct  292  RQAGEKINSNSMLERLM--EIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQA  349

Query  384  KLHQELCRILPDPSQPLTPDKLDQMIYLKAFIKEVFRMYSTVIGNGRTLQNDMVICGYRI  443
            KL +EL  I+P     L  + +  M YL+A IKE  R Y   +G  RT QND+++ GYR+
Sbjct  350  KLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRV  409

Query  444  PKGIQLVFPTIVTGNMPEYVSDPETFYPERWIKQSSTTGCPHSQIHPFASLPYGHGARMC  503
            PKG  ++  + V      Y   P+ F PERW++   T      Q+ PF  LP+G G RMC
Sbjct  410  PKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPET--GKKMQVSPFTFLPFGFGPRMC  467

Query  504  LGRRFADLEMQILLAKLIRSYRLEFHHKPLE-YKVTFMYAPDGELKFKMT  552
            +G+R  DLEM+  +AKLIR++ +EF+      +K  F+  P     FK T
Sbjct  468  IGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFVMEPAITFPFKFT  517


>CCD1D_DROME unnamed protein product
Length=521

 Score = 283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 159/530 (30%), Positives = 275/530 (52%), Gaps = 21/530 (4%)

Query  27   SSTTSTPTTAASVRNQSSVSGLLDAESAALDNTGLSQGELDSARPYSQVPGPKPYPLLGN  86
            SS  S       VR+  S S +L  E A    T       +  + Y ++P P  +  +  
Sbjct  5    SSARSVAIYVGPVRSSRSAS-VLAHEQAKSSIT-------EEHKTYDEIPRPNKFKFM--  54

Query  87   TWRLLPYIGQYQISNLADVSAQLYRDYGKIVRLGGLVGRPDLLFVYDADEIEKVYRQEGP  146
              R     G++Q +++ + ++ + + YG I  + G+ GR D +  ++  +IE V+R EG 
Sbjct  55   --RAFMPGGEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTFNTKDIEMVFRNEGI  112

Query  147  TPFRPSMPCLVHYKSVVRKEFFGRLAGVVGVHGEPWREFRTKVQKPILQLRTVRKYIEPI  206
             P R  +  +V+++  VR + +G + G+V    E W + R+ +    +Q R +R Y EP+
Sbjct  113  WPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPL  172

Query  207  ENVTDYFIQRMNEMKDENS-EMPADFDNEIHKWSLECIGRVALDVRLGCLNPDLTGNDEP  265
             N+ + FI+R+ E++D  + E+P DF +EI +   E +G VA D ++G +  +   N + 
Sbjct  173  SNINNEFIERIKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKN-RDNSDA  231

Query  266  QKIIDAAKYALRNVAILELKLPFWRYIPSNLWRKYVSNMNYFIEICMKYIDSAMERLKTK  325
              +   ++   R    L+++   W+ I +  +RK    +N  + +  K +    + L+ +
Sbjct  232  LTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVSQKMLKENQDALEKR  291

Query  326  SNLNE--NDMSLVERILLNEPDPKTAYVLALDLILVGIDTISMAVCSMLYQLATRPEEQE  383
                E  N  S++ER++  E DPK A +++LD++  G+D  +  + ++L  L+  P++Q 
Sbjct  292  RQAGEKINSNSMLERLM--EIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQA  349

Query  384  KLHQELCRILPDPSQPLTPDKLDQMIYLKAFIKEVFRMYSTVIGNGRTLQNDMVICGYRI  443
            KL +EL  I+P     L  + +  M YL+A IKE  R Y    G  RT QND+++ GYR+
Sbjct  350  KLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGFGTMRTCQNDVILSGYRV  409

Query  444  PKGIQLVFPTIVTGNMPEYVSDPETFYPERWIKQSSTTGCPHSQIHPFASLPYGHGARMC  503
            PKG  ++  + V      Y   P+ F PERW++   T      Q+ PF  LP+G G RMC
Sbjct  410  PKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPET--GKKMQVSPFTFLPFGFGPRMC  467

Query  504  LGRRFADLEMQILLAKLIRSYRLEFHHKPLE-YKVTFMYAPDGELKFKMT  552
            +G+R  DLEM+  +AKLIR++ +EF+      +K  F+  P     FK T
Sbjct  468  IGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFLMEPAITFPFKFT  517



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01910.1.1 Gag

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z6P0_DROME  unnamed protein product                                 39.3    0.001
Q6NR13_DROME  unnamed protein product                                 35.4    0.012
Q7K9B7_DROME  unnamed protein product                                 35.4    0.020


>A1Z6P0_DROME unnamed protein product
Length=310

 Score = 39.3 bits (90),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 36/67 (54%), Gaps = 0/67 (0%)

Query  179  KYIVLVTLFVLTFLSTILPLRVVSTLRDTLDPNKRNKYAKVVGLLSCFAGGVFMASALLD  238
            K + +V LF++T +   +P  +    + T  P    +  KVV  L  F GGV +A+  + 
Sbjct  10   KIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIH  69

Query  239  LLPEVIE  245
            +LPEV+E
Sbjct  70   MLPEVVE  76


>Q6NR13_DROME unnamed protein product
Length=187

 Score = 35.4 bits (80),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query  211  NKRNKYAKVVGLLSCFAGGVFMASALLDLLPEVIET----FSQIAPNSKF  256
              R ++     LL CF  G+ +A+AL+ +LPEV E     F+++A    F
Sbjct  52   RNRRRFPLTASLLLCFGAGILLATALVHILPEVREQMDSKFAEVAMCGGF  101


>Q7K9B7_DROME unnamed protein product
Length=346

 Score = 35.4 bits (80),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  179  KYIVLVTLFVLTFLSTILPLRVVSTLRDTLDPNKRNKYAKVVGLLSCFAGGVFMASALLD  238
            K + +V L V+T L   LP  +      T    +  + + VV  L  F GGV + +  L 
Sbjct  18   KIVSMVVLVVITVLCGSLPYVLNRCFHWTKASPEETRSSLVVRCLLFFGGGVLICTTFLH  77

Query  239  LLPEVIE  245
            +LPEVIE
Sbjct  78   MLPEVIE  84



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01920.1.1 Zinc

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GRW9_DROME  unnamed protein product                                 90.9    8e-22
Q9VEX1_DROME  unnamed protein product                                 90.1    1e-21
Q8SZF0_DROME  unnamed protein product                                 90.1    1e-21


>Q9GRW9_DROME unnamed protein product
Length=494

 Score = 90.9 bits (224),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)

Query  18   SSFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLS  77
            SS R + +  +LSLH LFEG+AIG++    +V  +  AV  HK+++ F VG++LI +   
Sbjct  265  SSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTR  324

Query  78   VKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLP  137
            +         F+++SPLGIGI + I+         LV + I+QG A GT IYV FFE+L 
Sbjct  325  MLLAVLYVLTFAVVSPLGIGIGILINHGQETSGPSLV-SAILQGFACGTLIYVVFFEILS  383

Query  138  KEIQSGRSRLLKLLAILIGFI  158
            K     RS L   LA+ +GF+
Sbjct  384  K----NRSGLRAYLALFVGFL  400


>Q9VEX1_DROME unnamed protein product
Length=495

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)

Query  18   SSFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLS  77
            SS R + +  +LSLH LFEG+AIG++    +V  +  AV  HK+++ F VG++LI +   
Sbjct  266  SSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTR  325

Query  78   VKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLP  137
            +         F+++SPLGIGI + I+         LV + I+QG A GT IYV FFE+L 
Sbjct  326  MLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLV-SAILQGFACGTLIYVVFFEILS  384

Query  138  KEIQSGRSRLLKLLAILIGFI  158
            K     RS L   LA+ +GF+
Sbjct  385  K----NRSGLRAYLALFVGFL  401


>Q8SZF0_DROME unnamed protein product
Length=495

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)

Query  18   SSFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLS  77
            SS R + +  +LSLH LFEG+AIG++    +V  +  AV  HK+++ F VG++LI +   
Sbjct  266  SSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTR  325

Query  78   VKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLP  137
            +         F+++SPLGIGI + I+         LV + I+QG A GT IYV FFE+L 
Sbjct  326  MLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLV-SAILQGFACGTLIYVVFFEILS  384

Query  138  KEIQSGRSRLLKLLAILIGFI  158
            K     RS L   LA+ +GF+
Sbjct  385  K----NRSGLRAYLALFVGFL  401



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01930.1.1 protein

Length=127
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYGO_DROME  unnamed protein product                                   41.6    3e-05
Y2138_DROME  unnamed protein product                                  27.3    2.3  


>PYGO_DROME unnamed protein product
Length=815

 Score = 41.6 bits (96),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 1/25 (4%)

Query  100  DLLPPP-LTGYGDTVVASNPFDDTP  123
            DLLPPP + G+GDT++ASNPFDD+P
Sbjct  79   DLLPPPPMGGFGDTIIASNPFDDSP  103


>Y2138_DROME unnamed protein product
Length=1183

 Score = 27.3 bits (59),  Expect = 2.3, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 2/27 (7%)

Query  81   SNAATITHHAPPPP--PPVMQDLLPPP  105
            S + ++   AP PP  PP++    PPP
Sbjct  645  SPSGSLASTAPSPPHAPPMLSSFQPPP  671



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01940.1.1 Gag

Length=235
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMB8_DROME  unnamed protein product                                 27.7    6.2  
Q1RKY9_DROME  unnamed protein product                                 27.3    6.4  
Q8SXK8_DROME  unnamed protein product                                 27.3    7.0  


>Q8IMB8_DROME unnamed protein product
Length=589

 Score = 27.7 bits (60),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  39   VPILLSAIGEKTVQVLRQLYDPESPSCKSYV---ELCEILRLHF  79
             P +    G ++V++ + LY P+  S  SY    + CEI   HF
Sbjct  379  TPCVAQGWGGRSVELPKGLYVPKEISLSSYAAPSQQCEIHSKHF  422


>Q1RKY9_DROME unnamed protein product
Length=694

 Score = 27.3 bits (59),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  39   VPILLSAIGEKTVQVLRQLYDPESPSCKSYV---ELCEILRLHF  79
             P +    G ++V++ + LY P+  S  SY    + CEI   HF
Sbjct  484  TPCVAQGWGGRSVELPKGLYVPKEISLSSYAAPSQQCEIHSKHF  527


>Q8SXK8_DROME unnamed protein product
Length=640

 Score = 27.3 bits (59),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  39   VPILLSAIGEKTVQVLRQLYDPESPSCKSYV---ELCEILRLHF  79
             P +    G ++V++ + LY P+  S  SY    + CEI   HF
Sbjct  430  TPCVAQGWGGRSVELPKGLYVPKEISLSSYAAPSQQCEIHSKHF  473



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01950.1.1 Zinc

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z6P0_DROME  unnamed protein product                                 96.3    1e-23
Q7K9B7_DROME  unnamed protein product                                 94.7    9e-23
Q7JZR2_DROME  unnamed protein product                                 94.4    1e-22


>A1Z6P0_DROME unnamed protein product
Length=310

 Score = 96.3 bits (238),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 126/237 (53%), Gaps = 18/237 (8%)

Query  1    MASALLDLLPEVIETFS------QIAPNSKFPLGEFVISFGFFVILIVEQIALFYKEEIP  54
            +A+  + +LPEV+E  +       +AP + F L E ++  GF+++  +E+   F      
Sbjct  63   IATTFIHMLPEVVEVVNALQDCRMLAP-TPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQ  121

Query  55   VNFSDDLVVA--PRDDTRTMIPSSDPGDDPTARSPHSSFRSVLLFVSLSLHSLFEGLAIG  112
                 ++V      ++ RT I    P + P  + P +  R + + V+LSLH LF G+AIG
Sbjct  122  QRKLREVVTIKDAGEELRTEI-VVQPEESP--KEP-NWLRGLGIIVALSLHELFGGMAIG  177

Query  113  IQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLSVKSVAQLDFWFSLMSPLGIGIAVG  172
            ++  + TV  +  A+ +HK+++ F +G++++ +             FS+++P+G+GI + 
Sbjct  178  LEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIA  237

Query  173  IDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLPKEIQSGRNRLLKLLAILIGFI  229
            + +     Q   V +GI+QGLA GT IYV FFE++ K     R     LL+ ++GF+
Sbjct  238  VSESAAANQPSTV-SGILQGLACGTLIYVVFFEIVAKNHAGIR----ILLSSMVGFV  289


>Q7K9B7_DROME unnamed protein product
Length=346

 Score = 94.7 bits (234),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 130/263 (49%), Gaps = 44/263 (17%)

Query  1    MASALLDLLPEVIETFSQIAP-----NSKFPLGEFVISFGFFVILIVEQI----------  45
            + +  L +LPEVIE    +        + F L E ++  GFF++  ++++          
Sbjct  71   ICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRHHQG  130

Query  46   ALFYKEEIPV-------NFSDDLVVAPRDDTRTMIPSSDP---------GDDPTARSPHS  89
             L  KE +         +    +++ P+      +  ++P            P      S
Sbjct  131  KLSRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDGS  190

Query  90   SFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLI----QS  145
            S R + + ++LSLH LFEG+AIG++  + TV  +  AV  HK+++ F VG++L+    +S
Sbjct  191  SARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRS  250

Query  146  DLSVKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFE  205
             L++  +      FS+++P+GIG+ +GI Q +   Q  L  +G++QG+A GT +YV FFE
Sbjct  251  SLAILYLVT----FSIVTPIGIGVGLGISQQVAAGQPSLP-SGVLQGIACGTLLYVVFFE  305

Query  206  VLPKEIQSGRNRLLKLLAILIGF  228
            +L +     R     L+A + GF
Sbjct  306  ILIESHAGWR----ALVAAVAGF  324


>Q7JZR2_DROME unnamed protein product
Length=352

 Score = 94.4 bits (233),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 130/263 (49%), Gaps = 44/263 (17%)

Query  1    MASALLDLLPEVIETFSQIAP-----NSKFPLGEFVISFGFFVILIVEQI----------  45
            + +  L +LPEVIE    +        + F L E ++  GFF++  ++++          
Sbjct  77   ICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRHHQG  136

Query  46   ALFYKEEIPV-------NFSDDLVVAPRDDTRTMIPSSDP---------GDDPTARSPHS  89
             L  KE +         +    +++ P+      +  ++P            P      S
Sbjct  137  KLSRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDGS  196

Query  90   SFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLI----QS  145
            S R + + ++LSLH LFEG+AIG++  + TV  +  AV  HK+++ F VG++L+    +S
Sbjct  197  SARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRS  256

Query  146  DLSVKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFE  205
             L++  +      FS+++P+GIG+ +GI Q +   Q  L  +G++QG+A GT +YV FFE
Sbjct  257  SLAILYLVT----FSIVTPIGIGVGLGISQQVAAGQPSLP-SGVLQGIACGTLLYVVFFE  311

Query  206  VLPKEIQSGRNRLLKLLAILIGF  228
            +L +     R     L+A + GF
Sbjct  312  ILIESHAGWR----ALVAAVAGF  330



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01960.1.1 protein

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYGO_DROME  unnamed protein product                                   42.0    7e-04


>PYGO_DROME unnamed protein product
Length=815

 Score = 42.0 bits (97),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 1/25 (4%)

Query  100  DLLPPP-LTGYGDTVVASNPFDDTP  123
            DLLPPP + G+GDT++ASNPFDD+P
Sbjct  79   DLLPPPPMGGFGDTIIASNPFDDSP  103



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01970.1.1 Protein

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYGO_DROME  unnamed protein product                                   155     1e-45
TRX_DROME  unnamed protein product                                    38.9    1e-04
KDM5_DROME  unnamed protein product                                   34.3    0.007


>PYGO_DROME unnamed protein product
Length=815

 Score = 155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 0/96 (0%)

Query  12   KPMPVCAGKIYPENQAMVFNPQNPNAPPIYPCGICHKEVHDNDQAILCESGCNFWYHRMC  71
            KPM +  GK+YP  Q MVFNPQNPNAPPIYPCG+CHKEV+DND+A+ CESGCNF++HR C
Sbjct  719  KPMTMGGGKMYPPGQPMVFNPQNPNAPPIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTC  778

Query  72   TGLSDVAYTMLTAEVYAEWVCDKCLNNKNIPLVKFK  107
             GL++ A+ ML  EV+AEW CDKC+++K+IP+VKFK
Sbjct  779  VGLTEAAFQMLNKEVFAEWCCDKCVSSKHIPMVKFK  814


>TRX_DROME unnamed protein product
Length=3726

 Score = 38.9 bits (89),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 29/56 (52%), Gaps = 3/56 (5%)

Query  43    CGICHKEVHDNDQAI-LCESG-CNFWYHRMCTGLSDVAYTML-TAEVYAEWVCDKC  95
             C IC +   DND  + + E G C  W H  C GLSD  Y +L T     E++C KC
Sbjct  1424  CPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPESIEFICKKC  1479


>KDM5_DROME unnamed protein product
Length=1838

 Score = 34.3 bits (77),  Expect = 0.007, Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  46    CHKEVHDNDQAILCESGCNFWYHRMCTGLS  75
             CHK        + C+ GCN W+H  C GL+
Sbjct  1761  CHKPTGREVDWVQCDGGCNEWFHMYCVGLN  1790


 Score = 30.4 bits (67),  Expect = 0.14, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 8/56 (14%)

Query  41   YPCGICHKEVHDNDQAILCESGCNFWYHRMCTGLSDVAYTMLTAEVYAEWVCDKCL  96
            Y C IC++   D ++++L   GC+  YH  C          LT+    EW+C +C+
Sbjct  449  YICHICNR--GDVEESMLLCDGCDDSYHTFCL------LPPLTSIPKGEWLCPRCV  496



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01980.1.1 Coiled-coil

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPEN_DROME  unnamed protein product                                   32.7    0.39 


>SPEN_DROME unnamed protein product
Length=5560

 Score = 32.7 bits (73),  Expect = 0.39, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 48/84 (57%), Gaps = 8/84 (10%)

Query  131   REQEEIKKKLQFQSLTKQIQLNKDLREMAVYALEKETRRLRQVEENRQKELENKKKLKLM  190
             R++E+ +K+++ + L ++ Q  +D RE  +   +   + +R+ +E R+KEL         
Sbjct  1996  RDKEQKEKEIREKDLREKEQRERDNREKELRDKDLREKEMRE-KEQREKELHR-------  2047

Query  191   EQEKRKREIEETNQALRKLKEEQK  214
             E+++R+RE  E  Q+ R +  EQ+
Sbjct  2048  EKDQREREHREKEQSRRAMDVEQE  2071


 Score = 30.4 bits (67),  Expect = 2.4, Method: Composition-based stats.
 Identities = 29/127 (23%), Positives = 70/127 (55%), Gaps = 4/127 (3%)

Query  272   DMKCRQVQEECDREWRRRELEEQRKRKQMMEELVLCRKQQEAYRRQYQAVEQEKCDAMNT  331
             D++ +  +EE DR+ ++ E E++ ++ +  E+     K+ +  R + +  E+E  +    
Sbjct  1937  DLRKQVEREEKDRKAQQEEREKEDRKAKEEEKEREREKKAQEDREKKEREERELREKEQR  1996

Query  332   LLERQ----READVEKEREKQRQAKQRTLEYGQHLQKLMEEKQAQKKKLHESRVQDGQRL  387
               E++    RE D+ ++ +++R  +++ L      +K M EK+ ++K+LH  + Q  +  
Sbjct  1997  DKEQKEKEIREKDLREKEQRERDNREKELRDKDLREKEMREKEQREKELHREKDQREREH  2056

Query  388   RQEQQNR  394
             R+++Q+R
Sbjct  2057  REKEQSR  2063



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g01990.1.1 Unknown

Length=97
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMW2_DROME  unnamed protein product                                 26.6    2.1  
PUF_DROME  unnamed protein product                                    26.6    2.1  
A0A0B4LIK5_DROME  unnamed protein product                             26.6    2.1  


>Q8IMW2_DROME unnamed protein product
Length=3912

 Score = 26.6 bits (57),  Expect = 2.1, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  49    GALDMFKDFYAGFAQQARQGNEDDNMSNSSEEIL  82
             G L    DFY G  Q        DN  NSSEE L
Sbjct  2745  GVLKSLVDFYLGHKQTDSIDISSDNEDNSSEEAL  2778


>PUF_DROME unnamed protein product
Length=3912

 Score = 26.6 bits (57),  Expect = 2.1, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  49    GALDMFKDFYAGFAQQARQGNEDDNMSNSSEEIL  82
             G L    DFY G  Q        DN  NSSEE L
Sbjct  2745  GVLKSLVDFYLGHKQTDSIDISSDNEDNSSEEAL  2778


>A0A0B4LIK5_DROME unnamed protein product
Length=3921

 Score = 26.6 bits (57),  Expect = 2.1, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  49    GALDMFKDFYAGFAQQARQGNEDDNMSNSSEEIL  82
             G L    DFY G  Q        DN  NSSEE L
Sbjct  2745  GVLKSLVDFYLGHKQTDSIDISSDNEDNSSEEAL  2778



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02000.1.1 Unknown

Length=140
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FRY_DROME  unnamed protein product                                    32.3    0.058
MICAL_DROME  unnamed protein product                                  28.5    1.4  
Q9VC29_DROME  unnamed protein product                                 26.9    3.5  


>FRY_DROME unnamed protein product
Length=3479

 Score = 32.3 bits (72),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 27/57 (47%), Gaps = 6/57 (11%)

Query  40    PKSKKKFRDESSFATYARAISDVCLNQPSLHKEDNVRNRTS-----NGHSYPVSRSE  91
             P+   K R  S  +   R   D+ +N P L +E+NV  R +     NGH +P+   E
Sbjct  1912  PRGADKIRAASGPSILPRP-EDILINDPELRQEENVELRGTSDAAPNGHPHPLPMPE  1967


>MICAL_DROME unnamed protein product
Length=4723

 Score = 28.5 bits (62),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query  72    EDNVRNRTS--NGHSYPVSRSEPTNVYYTHQWKHINDLNRSSRYLFYSNLENFYRQLY  127
             ++N+ +R+S  +G+S+  +RS+P+    T     +  L R++   F S +E    +LY
Sbjct  1333  KENMADRSSLKSGNSFESARSQPSTPLSTPTRVEMEQLERNAPRKFSSEIEAISEKLY  1390


>Q9VC29_DROME unnamed protein product
Length=654

 Score = 26.9 bits (58),  Expect = 3.5, Method: Composition-based stats.
 Identities = 24/87 (28%), Positives = 38/87 (44%), Gaps = 7/87 (8%)

Query  40   PKSKKKFRDESSFATYARAISDVCLNQPSLHKEDNVRNRTSNGHSYPVSRSEPTNVY---  96
            PK   +     S   Y+    D CL  PS+    N+ N+ S   + PV   + ++VY   
Sbjct  528  PKLSTELLTTQSGVEYSMITPDRCLIFPSVDYVRNLVNKQSIRQNVPVV-IDASHVYGAD  586

Query  97   ---YTHQWKHINDLNRSSRYLFYSNLE  120
                T     I+D N+  + LF+ NL+
Sbjct  587  FTTATVIDSLISDFNQRGQLLFFYNLK  613



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02010.1.1 Adp-ribosylation

Length=187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARL8_DROME  unnamed protein product                                   345     2e-123
ARF6_DROME  unnamed protein product                                   123     4e-36 
ARF1_DROME  unnamed protein product                                   120     5e-35 


>ARL8_DROME unnamed protein product
Length=186

 Score = 345 bits (884),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)

Query  1    MFVLLNRILDWFKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKI  60
            M  L+NRIL+WFKS+FWKEEMELTLVGLQ SGKTTFVNVIASGQF++DMIPTVGFNMRKI
Sbjct  1    MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKI  60

Query  61   TKGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADTDKLEASRNELHALIEKPQL  120
            T+GNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAAD DKLEASRNELH+L++KPQL
Sbjct  61   TRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQL  120

Query  121  IGIPILVLGNKRDLPNALDEKELIDRMNLCAIQDREICCYSISCKERDNIDITLQWLIAH  180
             GIP+LVLGNKRDLP ALDE  LI+RMNL +IQDREICCYSISCKE+DNIDITLQWLI H
Sbjct  121  AGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQH  180

Query  181  SKSHTR  186
            SKS +R
Sbjct  181  SKSQSR  186


>ARF6_DROME unnamed protein product
Length=175

 Score = 123 bits (309),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 96/171 (56%), Gaps = 1/171 (1%)

Query  12   FKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKITKGNVTIKVWD  71
               +F  +EM + ++GL  +GKTT +  +  GQ S   IPTVGFN+  +T  NV   VWD
Sbjct  5    LSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQ-SVTTIPTVGFNVETVTYKNVKFNVWD  63

Query  72   IGGQPRFRSMWERYCRGVNAIVYMVDAADTDKLEASRNELHALIEKPQLIGIPILVLGNK  131
            +GGQ + R +W  Y  G   ++++VD AD D+++ +R ELH +I   ++    IL+  NK
Sbjct  64   VGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANK  123

Query  132  RDLPNALDEKELIDRMNLCAIQDREICCYSISCKERDNIDITLQWLIAHSK  182
            +DLP+A+   E+ +++ L  I+DR            D +   L WL ++ K
Sbjct  124  QDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK  174


>ARF1_DROME unnamed protein product
Length=182

 Score = 120 bits (302),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 102/181 (56%), Gaps = 1/181 (1%)

Query  6    NRILDWFKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKITKGNV  65
            N   + FK LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  +   N+
Sbjct  3    NVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVT-TIPTIGFNVETVEYKNI  61

Query  66   TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADTDKLEASRNELHALIEKPQLIGIPI  125
            +  VWD+GGQ + R +W  Y +    ++++VD+ D +++  +R EL  ++ + +L    +
Sbjct  62   SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVL  121

Query  126  LVLGNKRDLPNALDEKELIDRMNLCAIQDREICCYSISCKERDNIDITLQWLIAHSKSHT  185
            L+  NK+DLPNA++  E+ D++ L ++++R     +      D +   L WL    K+  
Sbjct  122  LIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNAN  181

Query  186  R  186
            R
Sbjct  182  R  182



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02020.1.1 Unknown

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMV9_DROME  unnamed protein product                                 30.0    0.74 
E1JHT6_DROME  unnamed protein product                                 30.0    0.82 
Q9V3W9_DROME  unnamed protein product                                 27.3    5.3  


>Q9VMV9_DROME unnamed protein product
Length=595

 Score = 30.0 bits (66),  Expect = 0.74, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (4%)

Query  128  GSFTSQPQ-PLCSTQPPKPTTHNYFQSD  154
            GSFT QP  PL + QP  P+T N++  +
Sbjct  177  GSFTDQPSAPLQAFQPTAPSTANFYDDE  204


>E1JHT6_DROME unnamed protein product
Length=607

 Score = 30.0 bits (66),  Expect = 0.82, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (4%)

Query  128  GSFTSQPQ-PLCSTQPPKPTTHNYFQSD  154
            GSFT QP  PL + QP  P+T N++  +
Sbjct  177  GSFTDQPSAPLQAFQPTAPSTANFYDDE  204


>Q9V3W9_DROME unnamed protein product
Length=414

 Score = 27.3 bits (59),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 28/57 (49%), Gaps = 12/57 (21%)

Query  70   NRCSTPSSSNTYTTLLSH-------DEFIATLAFPS-----TSNYDQSTQYNQALLS  114
            N  ++PSS+NT  ++LS        DE I  LA  S      SN     +YNQ +LS
Sbjct  109  NHTNSPSSTNTEDSVLSRETRPLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLS  165



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02030.1.1 Unknown

Length=115
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEU2_DROME  unnamed protein product                                 27.3    1.6  
A1Z9M5_DROME  unnamed protein product                                 26.9    2.4  
SOS_DROME  unnamed protein product                                    26.6    3.4  


>Q9VEU2_DROME unnamed protein product
Length=261

 Score = 27.3 bits (59),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 25/52 (48%), Gaps = 1/52 (2%)

Query  36   VLLCCEYALGNTLWKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDFFKN  87
            VLLCC   LGNT+W ++ + +    + + L+     +S G +      F K 
Sbjct  155  VLLCCSMILGNTVW-VDVIGMGVGHIYYVLEDVYPTLSNGYRLIKTPYFLKR  205


>A1Z9M5_DROME unnamed protein product
Length=4012

 Score = 26.9 bits (58),  Expect = 2.4, Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query  49   WKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDFFKNSKLSLPNEGVMFTLWKEELLH  108
            W++ D  V+ D+++  ++     I V E  E++    KN+ +S  NE +   L KE   H
Sbjct  520  WRVLDEKVHTDVIEKIVEAPKKTIYVDEFVEIE----KNTSISENNENITLNL-KETSKH  574


>SOS_DROME unnamed protein product
Length=1596

 Score = 26.6 bits (57),  Expect = 3.4, Method: Composition-based stats.
 Identities = 24/90 (27%), Positives = 42/90 (47%), Gaps = 9/90 (10%)

Query  25   MFVVKLCVALCVLLCCEYALGNTLWKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDF  84
            ++V KLC+ L  +LC +  L +++  +E+       V  +    I Q ++ E  E+    
Sbjct  96   LYVEKLCLRLLAMLCAK-PLPHSVQDVEEK------VNKSFPAPIDQWALNEAKEVINS-  147

Query  85   FKNSKLSLPNEGVMFTLWKEELLHCTSSNL  114
             K  K  LP E V   L K+ L +   S++
Sbjct  148  -KKRKSVLPTEKVHTLLQKDVLQYKIDSSV  176



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02040.1.1 Unknown

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEU2_DROME  unnamed protein product                                 31.2    0.14 
A0A0B4KF84_DROME  unnamed protein product                             29.6    0.46 
A0A0B4KG35_DROME  unnamed protein product                             29.6    0.46 


>Q9VEU2_DROME unnamed protein product
Length=261

 Score = 31.2 bits (69),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (51%), Gaps = 1/53 (2%)

Query  12   VLLCCEYALGNTLWKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDFFKKL  64
            VLLCC   LGNT+W ++ + +    + + L+     +S G +      F K+L
Sbjct  155  VLLCCSMILGNTVW-VDVIGMGVGHIYYVLEDVYPTLSNGYRLIKTPYFLKRL  206


>A0A0B4KF84_DROME unnamed protein product
Length=8216

 Score = 29.6 bits (65),  Expect = 0.46, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 3/43 (7%)

Query  34    DDIVQHALKTAITQISVGEKAEMKKDFF--KKLKAVSAKRRGN  74
             +D+V H+++  I +    EK ++ K+F   K+LKA SAK++G+
Sbjct  2586  EDVVDHSIEKKIEEPKRSEKKDLDKEFLEEKELKA-SAKKQGD  2627


>A0A0B4KG35_DROME unnamed protein product
Length=8255

 Score = 29.6 bits (65),  Expect = 0.46, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 3/43 (7%)

Query  34    DDIVQHALKTAITQISVGEKAEMKKDFF--KKLKAVSAKRRGN  74
             +D+V H+++  I +    EK ++ K+F   K+LKA SAK++G+
Sbjct  2625  EDVVDHSIEKKIEEPKRSEKKDLDKEFLEEKELKA-SAKKQGD  2666



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02050.1.1 Irregular

Length=233
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MSN7_DROME  unnamed protein product                                 80.9    1e-17
Q9W4T9_DROME  unnamed protein product                                 80.5    2e-17
O97174_DROME  unnamed protein product                                 80.5    2e-17


>Q8MSN7_DROME unnamed protein product
Length=551

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 20/218 (9%)

Query  16   QTFDREPVSTEVNPDSDTKLDCKVLNKKGTCSWQKDNKPVGIY-----FKKYEWVNPDES  70
            Q F  EP        S   L C+V+ K G   W KD+  +G +     F++Y  V  DE 
Sbjct  82   QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEE  141

Query  71   SGDCSLWIRSATLDFDDGEWECQITASDFTTQDALTSRPVRLIVRVEPQAPRIEYKASAV  130
             GD SL I    LD DD +++CQ+       Q  + SR  +L V V P+AP+I       
Sbjct  142  -GDFSLDIYPLMLD-DDAKYQCQVGPGPQGEQ-GIRSRFAKLTVLVPPEAPKITQ-----  193

Query  131  LPGHNVTVKAGEKATVKCVSRYGNPPAKLKWFLGDEELIAKSNQ-TNSPEADNRRTWSAL  189
              G  +      +  ++CVS+ G P A++ W  G   ++ K  +    P AD+RR  +A 
Sbjct  194  --GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRI-TAR  250

Query  190  SVIEISAEKSQNGRMLRCVALH---ESYPSKSLSVDVR  224
            S+++++ +K  +     C A +    +Y S  L ++V+
Sbjct  251  SILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVK  288


>Q9W4T9_DROME unnamed protein product
Length=956

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 20/218 (9%)

Query  16   QTFDREPVSTEVNPDSDTKLDCKVLNKKGTCSWQKDNKPVGIY-----FKKYEWVNPDES  70
            Q F  EP        S   L C+V+ K G   W KD+  +G +     F++Y  V  DE 
Sbjct  82   QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEE  141

Query  71   SGDCSLWIRSATLDFDDGEWECQITASDFTTQDALTSRPVRLIVRVEPQAPRIEYKASAV  130
             GD SL I    LD DD +++CQ+       Q  + SR  +L V V P+AP+I       
Sbjct  142  -GDFSLDIYPLMLD-DDAKYQCQVGPGPQGEQ-GIRSRFAKLTVLVPPEAPKITQ-----  193

Query  131  LPGHNVTVKAGEKATVKCVSRYGNPPAKLKWFLGDEELIAKSNQ-TNSPEADNRRTWSAL  189
              G  +      +  ++CVS+ G P A++ W  G   ++ K  +    P AD+RR  +A 
Sbjct  194  --GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRI-TAR  250

Query  190  SVIEISAEKSQNGRMLRCVALH---ESYPSKSLSVDVR  224
            S+++++ +K  +     C A +    +Y S  L ++V+
Sbjct  251  SILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVK  288


>O97174_DROME unnamed protein product
Length=975

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 20/218 (9%)

Query  16   QTFDREPVSTEVNPDSDTKLDCKVLNKKGTCSWQKDNKPVGIY-----FKKYEWVNPDES  70
            Q F  EP        S   L C+V+ K G   W KD+  +G +     F++Y  V  DE 
Sbjct  82   QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEE  141

Query  71   SGDCSLWIRSATLDFDDGEWECQITASDFTTQDALTSRPVRLIVRVEPQAPRIEYKASAV  130
             GD SL I    LD DD +++CQ+       Q  + SR  +L V V P+AP+I       
Sbjct  142  -GDFSLDIYPLMLD-DDAKYQCQVGPGPQGEQ-GIRSRFAKLTVLVPPEAPKITQ-----  193

Query  131  LPGHNVTVKAGEKATVKCVSRYGNPPAKLKWFLGDEELIAKSNQ-TNSPEADNRRTWSAL  189
              G  +      +  ++CVS+ G P A++ W  G   ++ K  +    P AD+RR  +A 
Sbjct  194  --GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRI-TAR  250

Query  190  SVIEISAEKSQNGRMLRCVALH---ESYPSKSLSVDVR  224
            S+++++ +K  +     C A +    +Y S  L ++V+
Sbjct  251  SILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVK  288



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02060.1.1 Elongation

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCY6_DROME  unnamed protein product                                 267     4e-88
Q9VCY7_DROME  unnamed protein product                                 215     2e-67
Q5JZZ4_DROME  unnamed protein product                                 166     3e-49


>Q9VCY6_DROME unnamed protein product
Length=295

 Score = 267 bits (682),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 169/246 (69%), Gaps = 2/246 (1%)

Query  21   DFYFDVMNNRSDPRVKDWFLMSGPLPTVCICLSYAFIVKIVGPKLMEDRKPFQLRKTLIV  80
            D++  +  + +DPR  DWFL+  PLP + I   Y F V   GPK M+DRKPF+L +TL+V
Sbjct  10   DYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLV  69

Query  81   YNFLQVLFSSWLFYEAMDGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFD  140
            YNF QV  S W+ YE +    ++ YS RC+PVD+S TPKA R AR  + Y+ +K TE  D
Sbjct  70   YNFFQVALSVWMVYEGV--VIWQYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLD  127

Query  141  TFFFVMRKKYDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFVHIIMYFYYML  200
            T FFV+RK   QV+ LHV HH VMP+ +W   K+ PGGH TF G +N+FVHIIMY YY L
Sbjct  128  TIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFL  187

Query  201  AAFGPHMQKYLWWKKYLTSLQMIQFVCILIHAFQLFFIECDYPKAFAWWIGGHAVMFYFL  260
            +AFGP MQKYLWWKKY+T+LQMIQF C  IH  QL + +C YP+    +   +AV FYFL
Sbjct  188  SAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFL  247

Query  261  FSNFYK  266
            F++FY+
Sbjct  248  FNDFYQ  253


>Q9VCY7_DROME unnamed protein product
Length=322

 Score = 215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 154/250 (62%), Gaps = 4/250 (2%)

Query  32   DPRVKDWFLMSGPLPTVCICLSYAFIVKIVGPKLMEDRKPFQLRKTLIVYNFLQVLFSSW  91
            D  V  WFLMS P+P V + L Y   V  +GP+ M++RKP  L++ ++ YN  QVL+S W
Sbjct  20   DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIW  79

Query  92   LFYEAM--DGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFDTFFFVMRKK  149
            +   ++         +S +CE     T  + + +  G W+YFFSK  +  DT FFV+RKK
Sbjct  80   MCRTSIQESNVMASIFSKKCEI--NRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKK  137

Query  150  YDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFVHIIMYFYYMLAAFGPHMQK  209
             +QVS LHV HH +  L +W  +K+ PG      G+LN+ VHIIMYFYYM+AA GP  QK
Sbjct  138  DNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQK  197

Query  210  YLWWKKYLTSLQMIQFVCILIHAFQLFFIECDYPKAFAWWIGGHAVMFYFLFSNFYKETY  269
            YLWWKKY+TS+Q+IQFV IL +   +    C+ PK   ++  G+ V+F +LF NFY++TY
Sbjct  198  YLWWKKYMTSIQLIQFVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTY  257

Query  270  VKKPKKDGAA  279
             K    DG +
Sbjct  258  KKAKSVDGGS  267


>Q5JZZ4_DROME unnamed protein product
Length=262

 Score = 166 bits (420),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 135/250 (54%), Gaps = 6/250 (2%)

Query  29   NRSDPRVKDWFLMSGPLPTVCICLSYAFIVKIVGPKLMEDRKPFQLRKTLIVYNFLQVLF  88
            ++ D R ++W L+     TV + LS   ++    PK     KP QLR  L  ++   V  
Sbjct  13   DQPDERTRNWPLVDS-FWTVPVLLSIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFL  71

Query  89   SSWLFYEAMDGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFDTFFFVMRK  148
            + ++  E        DY+  C+P   S  P  MR+ +  WW++ SK  EF DT FF++R+
Sbjct  72   NGYICLELYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQ  131

Query  149  KYDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFVHIIMYFYYMLAAFGPHMQ  208
            K+ Q+S LHV HH  M +  W  +K+ P G +    ++N+FVHIIMY YY L+  GP +Q
Sbjct  132  KWSQLSFLHVYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQ  191

Query  209  KYLWWKKYLTSLQMIQFVCILIHAFQLFFIECDYPKAFAWWIGGHAVMFYFLFSNFYKET  268
            ++LWWK+YLT LQ++QF  I   A Q+    C+Y       +  +++ F F+F  FY + 
Sbjct  192  RFLWWKRYLTGLQLVQFTIIFFWASQMLVRGCEYGTWITLSMAIYSLPFLFMFGKFYMQK  251

Query  269  YV-----KKP  273
            Y      KKP
Sbjct  252  YTVSAVGKKP  261



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02070.1.1 Zinc

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCY3_DROME  unnamed protein product                                 156     1e-39
O61360_DROME  unnamed protein product                                 155     2e-39
O61361_DROME  unnamed protein product                                 154     5e-39


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 179/420 (43%), Gaps = 56/420 (13%)

Query  332  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVA  451
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C +T+        HV 
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDFCSKTFTRKEHLLNHV-  380

Query  452  ACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARH  511
              R+   +    C  C + F+ ++ L++H   H GE   + C +  CT+ F     +  H
Sbjct  381  --RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKCTY--CTKAFTRKDHMVNH  435

Query  512  VSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQ  569
            V  H  +  + C  C   FT K  LT H+ R HTG   + C+ C   F     L  HVR 
Sbjct  436  VRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  494

Query  570  HTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCT  629
            HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++ F R   L  H +  H  
Sbjct  495  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554

Query  630  GEMYECCHCARSFP--------------------------------CKSYLIPHLRVHTG  657
               + C  C +SFP                                CK +L+ H+R H+G
Sbjct  555  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  614

Query  658  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  714
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  615  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  674


 Score = 148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 152/339 (45%), Gaps = 33/339 (10%)

Query  376  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  435
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  436  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------  487
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE        
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  488  -----ERRYVCNHMQ------------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMF  528
                  + ++ NH++            C++ F     L  HV  H  +  + C  C   F
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  398

Query  529  TCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRK  588
            T K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF RK
Sbjct  399  TRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRK  457

Query  589  ATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYL  648
              + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +L
Sbjct  458  EHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHL  516

Query  649  IPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  687
              H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  517  NNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  555


 Score = 112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 107/223 (48%), Gaps = 33/223 (15%)

Query  461  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  520
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  521  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  580
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  581  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  639
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C+
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDFCS  367

Query  640  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKK  682
            ++F  K +L+ H+R HTGE P+ C+ C   + R   LV H+++
Sbjct  368  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  410


>O61360_DROME unnamed protein product
Length=962

 Score = 155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  332  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  445
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  446  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  486
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  487  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  544
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ET-PHRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  545  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  604
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  605  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  664
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  665  LCTVRYLRSYELVLHLKKCHRED  687
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 168/360 (47%), Gaps = 19/360 (5%)

Query  365  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  424
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  425  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  484
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  485  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  542
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  543  TGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLM-LHTGA  601
            TG   + C  C   F     L  H+RQH+ + P  C VC + F RK  + +H+   HTG 
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  602  KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSFPCKSYLIPHLRVHTG  657
            +P+ C  C + F     L  H   +H  G+  E    C  C ++F CK +L+ H+R H+G
Sbjct  640  RPFTCETCGKSFPLKGNLLFH-QRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  658  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  714
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  758


 Score = 146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  376  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  435
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  436  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  495
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  496  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  553
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  554  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  613
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  614  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  672
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  673  SYELVLHLKK  682
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 165/379 (44%), Gaps = 56/379 (15%)

Query  336  TCGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
             C  CG +F+F    I   RYH                E K + C  C +   T   L  
Sbjct  222  VCDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTR  266

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVA  451
            H ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+    + K+H+ 
Sbjct  267  HGKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTF----ARKEHLD  321

Query  452  ACREKRRKET-FPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHM  496
                    ET F C+ C + F+ ++ +++H   H GE              +  YV ++M
Sbjct  322  NHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  497  Q-----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHT  543
                        C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HT
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHT  440

Query  544  GSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKP  603
            G   + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P
Sbjct  441  GETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP  500

Query  604  YACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYA  662
            + CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ 
Sbjct  501  FKCTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHR  558

Query  663  CNLCTVRYLRSYELVLHLK  681
            C+ C   + R   L  H++
Sbjct  559  CSYCKKTFTRKEHLTNHVR  577


 Score = 107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  461  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  520
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  521  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  580
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  581  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  639
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  640  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  681
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  547  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  606
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  607  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  666
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  667  TVRYLRSYELVLHLKK  682
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354


>O61361_DROME unnamed protein product
Length=891

 Score = 154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  332  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  445
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  446  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  486
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  487  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  544
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ETP-HRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  545  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  604
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  605  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  664
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  665  LCTVRYLRSYELVLHLKKCHRED  687
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  376  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  435
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  436  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  495
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  496  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  553
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  554  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  613
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  614  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  672
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  673  SYELVLHLKK  682
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 108/377 (29%), Positives = 161/377 (43%), Gaps = 54/377 (14%)

Query  337  CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  392
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  393  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  452
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  453  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  497
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  498  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  545
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  546  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  605
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  606  CTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACN  664
            CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ C+
Sbjct  503  CTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCS  560

Query  665  LCTVRYLRSYELVLHLK  681
             C   + R   L  H++
Sbjct  561  YCKKTFTRKEHLTNHVR  577


 Score = 134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 140/304 (46%), Gaps = 14/304 (5%)

Query  374  YQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSC  433
            +QC  C K+   +  L  H+R H+ E  F CE C  SF +K H  +H+   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHI-LWHTGETPHRC  447

Query  434  NSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVC  493
            + C +T+        HV   R+   +    C  C + F+ ++ L++H   H GE   + C
Sbjct  448  DFCSKTFTRKEHLLNHV---RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKC  503

Query  494  NHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCT  551
             +  CT+ F     +  HV  H  +  + C  C   FT K  LT H+ R HTG   + C+
Sbjct  504  TY--CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCS  560

Query  552  QCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQ  611
             C   F     L  HVR HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++
Sbjct  561  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNK  620

Query  612  KFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG----EKPYACNLCT  667
             F R   L  H +  H     + C  C +SFP K  L+ H R HT     E+P+AC  C 
Sbjct  621  PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCP  680

Query  668  VRYL  671
              ++
Sbjct  681  KNFI  684


 Score = 106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  461  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  520
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  521  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  580
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  581  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  639
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  640  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  681
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 117/284 (41%), Gaps = 43/284 (15%)

Query  365  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  424
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  425  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  484
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  485  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  542
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  543  TGSLSYPCTQCPGKFYSAYELRQHVRQH-----------------------------TDE  573
            TG   + C  C   F     L  H+RQH                             T +
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  574  RPFPCPVCQRTFRRKATMESHLMLHTGA----KPYACTECDQKF  613
            RPF C  C ++F  K  +  H   HT      +P+AC +C + F
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  547  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  606
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  607  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  666
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  667  TVRYLRSYELVLHLKK  682
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02070.1.2 Zinc

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCY3_DROME  unnamed protein product                                 157     6e-40
O61360_DROME  unnamed protein product                                 157     1e-39
O61361_DROME  unnamed protein product                                 155     2e-39


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 157 bits (398),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 179/420 (43%), Gaps = 56/420 (13%)

Query  365  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  424
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  425  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVA  484
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C +T+        HV 
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDFCSKTFTRKEHLLNHV-  380

Query  485  ACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARH  544
              R+   +    C  C + F+ ++ L++H   H GE   + C +  CT+ F     +  H
Sbjct  381  --RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKCTY--CTKAFTRKDHMVNH  435

Query  545  VSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQ  602
            V  H  +  + C  C   FT K  LT H+ R HTG   + C+ C   F     L  HVR 
Sbjct  436  VRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  494

Query  603  HTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCT  662
            HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++ F R   L  H +  H  
Sbjct  495  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554

Query  663  GEMYECCHCARSFP--------------------------------CKSYLIPHLRVHTG  690
               + C  C +SFP                                CK +L+ H+R H+G
Sbjct  555  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  614

Query  691  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  747
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  615  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  674


 Score = 149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 152/339 (45%), Gaps = 33/339 (10%)

Query  409  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  468
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  469  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------  520
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE        
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  521  -----ERRYVCNHMQ------------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMF  561
                  + ++ NH++            C++ F     L  HV  H  +  + C  C   F
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  398

Query  562  TCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRK  621
            T K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF RK
Sbjct  399  TRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRK  457

Query  622  ATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYL  681
              + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +L
Sbjct  458  EHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHL  516

Query  682  IPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  720
              H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  517  NNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  555


 Score = 112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 107/223 (48%), Gaps = 33/223 (15%)

Query  494  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  553
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  554  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  613
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  614  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  672
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C+
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDFCS  367

Query  673  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKK  715
            ++F  K +L+ H+R HTGE P+ C+ C   + R   LV H+++
Sbjct  368  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  410


>O61360_DROME unnamed protein product
Length=962

 Score = 157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  365  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  424
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  425  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  478
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  479  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  519
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  520  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  577
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ET-PHRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  578  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  637
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  638  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  698  LCTVRYLRSYELVLHLKKCHRED  720
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 168/360 (47%), Gaps = 19/360 (5%)

Query  398  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  457
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  458  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  517
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  518  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  575
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  576  TGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLM-LHTGA  634
            TG   + C  C   F     L  H+RQH+ + P  C VC + F RK  + +H+   HTG 
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  635  KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSFPCKSYLIPHLRVHTG  690
            +P+ C  C + F     L  H   +H  G+  E    C  C ++F CK +L+ H+R H+G
Sbjct  640  RPFTCETCGKSFPLKGNLLFH-QRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  691  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  747
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  758


 Score = 147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  409  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  468
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  469  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  528
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  529  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  586
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  587  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  646
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  647  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  705
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  706  SYELVLHLKK  715
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/377 (29%), Positives = 161/377 (43%), Gaps = 54/377 (14%)

Query  370  CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  425
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  426  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  485
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  486  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  530
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  531  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  578
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  579  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  638
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  639  CTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
            CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ C+
Sbjct  503  CTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCS  560

Query  698  LCTVRYLRSYELVLHLK  714
             C   + R   L  H++
Sbjct  561  YCKKTFTRKEHLTNHVR  577


 Score = 107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  494  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  553
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  554  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  613
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  614  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  672
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  673  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  714
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  580  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  639
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  640  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  699
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  700  TVRYLRSYELVLHLKK  715
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354


>O61361_DROME unnamed protein product
Length=891

 Score = 155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  365  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  424
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  425  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  478
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  479  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  519
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  520  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  577
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ETP-HRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  578  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  637
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  638  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  698  LCTVRYLRSYELVLHLKKCHRED  720
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  409  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  468
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  469  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  528
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  529  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  586
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  587  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  646
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  647  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  705
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  706  SYELVLHLKK  715
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 108/377 (29%), Positives = 161/377 (43%), Gaps = 54/377 (14%)

Query  370  CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  425
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  426  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  485
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  486  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  530
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  531  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  578
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  579  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  638
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  639  CTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
            CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ C+
Sbjct  503  CTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCS  560

Query  698  LCTVRYLRSYELVLHLK  714
             C   + R   L  H++
Sbjct  561  YCKKTFTRKEHLTNHVR  577


 Score = 136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 140/304 (46%), Gaps = 14/304 (5%)

Query  407  YQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSC  466
            +QC  C K+   +  L  H+R H+ E  F CE C  SF +K H  +H+   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHI-LWHTGETPHRC  447

Query  467  NSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVC  526
            + C +T+        HV   R+   +    C  C + F+ ++ L++H   H GE   + C
Sbjct  448  DFCSKTFTRKEHLLNHV---RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKC  503

Query  527  NHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCT  584
             +  CT+ F     +  HV  H  +  + C  C   FT K  LT H+ R HTG   + C+
Sbjct  504  TY--CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCS  560

Query  585  QCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQ  644
             C   F     L  HVR HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++
Sbjct  561  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNK  620

Query  645  KFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG----EKPYACNLCT  700
             F R   L  H +  H     + C  C +SFP K  L+ H R HT     E+P+AC  C 
Sbjct  621  PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCP  680

Query  701  VRYL  704
              ++
Sbjct  681  KNFI  684


 Score = 106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  494  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  553
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  554  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  613
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  614  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  672
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  673  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  714
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 117/284 (41%), Gaps = 43/284 (15%)

Query  398  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  457
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  458  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  517
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  518  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  575
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  576  TGSLSYPCTQCPGKFYSAYELRQHVRQH-----------------------------TDE  606
            TG   + C  C   F     L  H+RQH                             T +
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  607  RPFPCPVCQRTFRRKATMESHLMLHTGA----KPYACTECDQKF  646
            RPF C  C ++F  K  +  H   HT      +P+AC +C + F
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  580  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  639
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  640  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  699
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  700  TVRYLRSYELVLHLKK  715
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02070.1.3 Zinc

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCY3_DROME  unnamed protein product                                 156     5e-41
O61360_DROME  unnamed protein product                                 155     2e-40
O61361_DROME  unnamed protein product                                 154     2e-40


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 122/435 (28%), Positives = 189/435 (43%), Gaps = 53/435 (12%)

Query  66   GYRVTTPIKRKFQV-TPAEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGY  124
            G+  +  + R  ++      FTC  C  +F   ++   HM            +   +K +
Sbjct  257  GFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPF  305

Query  125  QCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCN  184
             C  C K  A +  L  H R H+GE  F C+YC+ +F +K H+ +HV K H       C+
Sbjct  306  ACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCD  364

Query  185  SCGQTWL-------------------------GYTSWKQHVAACREKRRKETFPCKRCDE  219
             C +T+                           +T  +  V   R+   +  F C  C +
Sbjct  365  FCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTK  424

Query  220  RFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHM  277
             F+ +D +++H   H GE   + C +  CT+ F     L  HV  H     + C  C   
Sbjct  425  AFTRKDHMVNHVRQHTGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKT  481

Query  278  FTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRR  337
            FT K  LT H+ RLHTG   + C  C   F     L  H+RQH+ + P  C VC + F R
Sbjct  482  FTRKEHLTNHV-RLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  540

Query  338  KATMESHLM-LHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSF  392
            K  + +H+   HTG +P+ C  C + F     L  H   +H  G+  E    C  C ++F
Sbjct  541  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQR-SHTKGQEMERPFACEKCPKNF  599

Query  393  PCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDV  449
             CK +L+ H+R H+GEKP+AC LC+  ++    L  H+K  H +    P        +  
Sbjct  600  ICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPA  659

Query  450  NTVAQVKQEYEELPV  464
              + QVKQE + + +
Sbjct  660  GVLTQVKQEVKPIII  674


 Score = 147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 152/339 (45%), Gaps = 33/339 (10%)

Query  126  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  185
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  186  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------  237
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE        
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  238  -----ERRYVCNHMQ------------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMF  278
                  + ++ NH++            C++ F     L  HV  H  +  + C  C   F
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  398

Query  279  TCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRK  338
            T K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF RK
Sbjct  399  TRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRK  457

Query  339  ATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYL  398
              + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +L
Sbjct  458  EHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHL  516

Query  399  IPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  437
              H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  517  NNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  555


 Score = 110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 107/223 (48%), Gaps = 33/223 (15%)

Query  211  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  270
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  271  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  330
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  331  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  389
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C+
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDFCS  367

Query  390  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKK  432
            ++F  K +L+ H+R HTGE P+ C+ C   + R   LV H+++
Sbjct  368  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  410


>O61360_DROME unnamed protein product
Length=962

 Score = 155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/400 (29%), Positives = 179/400 (45%), Gaps = 45/400 (11%)

Query  66   GYRVTTPIKRKFQV-TPAEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGY  124
            G+  +  + R  ++      FTC  C  +F   ++   HM            +   +K +
Sbjct  257  GFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPF  305

Query  125  QCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCN  184
             C  C K  A +  L  H R H+GE  F C+YC+ +F +K H+ +HV K H       C+
Sbjct  306  ACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCD  364

Query  185  SCGQT------WLGYTSW------------------KQHVAACREKRRKET-FPCKRCDE  219
             C ++      ++ +  W                  K+H+A        ET F C+ C +
Sbjct  365  ICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGK  424

Query  220  RFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHM  277
             FS ++   +H  +H GE   + C+   C++ F     L  HV  H  +  + C  C   
Sbjct  425  SFSRKEHFTNHILWHTGET-PHRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKT  481

Query  278  FTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRR  337
            FT K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF R
Sbjct  482  FTRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTR  540

Query  338  KATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSY  397
            K  + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +
Sbjct  541  KEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEH  599

Query  398  LIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  437
            L  H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  600  LNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639


 Score = 152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 168/360 (47%), Gaps = 19/360 (5%)

Query  115  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  174
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  175  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  234
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  235  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  292
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  293  TGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLM-LHTGA  351
            TG   + C  C   F     L  H+RQH+ + P  C VC + F RK  + +H+   HTG 
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  352  KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSFPCKSYLIPHLRVHTG  407
            +P+ C  C + F     L  H   +H  G+  E    C  C ++F CK +L+ H+R H+G
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQR-SHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  408  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  464
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  758


 Score = 145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 143/309 (46%), Gaps = 11/309 (4%)

Query  126  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  185
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  186  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  245
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  246  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  303
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  304  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  363
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  364  NRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRS  423
             R   L  H    H     + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R 
Sbjct  455  TRKEHLLNHVR-QHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRK  513

Query  424  YELVLHLKK  432
              +V H+++
Sbjct  514  DHMVNHVRQ  522


 Score = 135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/376 (28%), Positives = 161/376 (43%), Gaps = 52/376 (14%)

Query  87   CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  142
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  143  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  202
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  203  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  247
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  248  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  295
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  296  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  355
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  356  CTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNL  415
            CT C + F R   + +++   H     ++C +C ++F  K +L  H+R HTG+ P+ C+ 
Sbjct  503  CTYCTKAFTRKDHM-VNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSY  561

Query  416  CTVRYLRSYELVLHLK  431
            C   + R   L  H++
Sbjct  562  CKKTFTRKEHLTNHVR  577


 Score = 105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  211  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  270
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  271  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  330
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  331  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  389
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  390  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  431
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  297  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  356
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  357  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  416
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  417  TVRYLRSYELVLHLKK  432
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354


>O61361_DROME unnamed protein product
Length=891

 Score = 154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/400 (29%), Positives = 179/400 (45%), Gaps = 45/400 (11%)

Query  66   GYRVTTPIKRKFQV-TPAEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGY  124
            G+  +  + R  ++      FTC  C  +F   ++   HM            +   +K +
Sbjct  257  GFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPF  305

Query  125  QCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCN  184
             C  C K  A +  L  H R H+GE  F C+YC+ +F +K H+ +HV K H       C+
Sbjct  306  ACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCD  364

Query  185  SCGQT------WLGYTSW------------------KQHVAACREKRRKET-FPCKRCDE  219
             C ++      ++ +  W                  K+H+A        ET F C+ C +
Sbjct  365  ICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGK  424

Query  220  RFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHM  277
             FS ++   +H  +H GE   + C+   C++ F     L  HV  H  +  + C  C   
Sbjct  425  SFSRKEHFTNHILWHTGETP-HRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKT  481

Query  278  FTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRR  337
            FT K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF R
Sbjct  482  FTRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTR  540

Query  338  KATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSY  397
            K  + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +
Sbjct  541  KEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEH  599

Query  398  LIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  437
            L  H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  600  LNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639


 Score = 145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 146/310 (47%), Gaps = 13/310 (4%)

Query  126  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  185
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  186  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  245
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  246  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  303
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  304  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  363
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  364  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  422
             R   L  H  +   TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNH--VRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  423  SYELVLHLKK  432
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 140/304 (46%), Gaps = 14/304 (5%)

Query  124  YQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSC  183
            +QC  C K+   +  L  H+R H+ E  F CE C  SF +K H  +H+   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHI-LWHTGETPHRC  447

Query  184  NSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVC  243
            + C +T+        HV   R+   +    C  C + F+ ++ L++H   H GE   + C
Sbjct  448  DFCSKTFTRKEHLLNHV---RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKC  503

Query  244  NHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCT  301
             +  CT+ F     +  HV  H  +  + C  C   FT K  LT H+ R HTG   + C+
Sbjct  504  TY--CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCS  560

Query  302  QCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQ  361
             C   F     L  HVR HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++
Sbjct  561  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNK  620

Query  362  KFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG----EKPYACNLCT  417
             F R   L  H +  H     + C  C +SFP K  L+ H R HT     E+P+AC  C 
Sbjct  621  PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCP  680

Query  418  VRYL  421
              ++
Sbjct  681  KNFI  684


 Score = 135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 105/376 (28%), Positives = 161/376 (43%), Gaps = 52/376 (14%)

Query  87   CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  142
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  143  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  202
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  203  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  247
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  248  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  295
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  296  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  355
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  356  CTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNL  415
            CT C + F R   + +++   H     ++C +C ++F  K +L  H+R HTG+ P+ C+ 
Sbjct  503  CTYCTKAFTRKDHM-VNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSY  561

Query  416  CTVRYLRSYELVLHLK  431
            C   + R   L  H++
Sbjct  562  CKKTFTRKEHLTNHVR  577


 Score = 105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  211  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  270
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  271  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  330
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  331  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  389
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  390  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  431
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 117/284 (41%), Gaps = 43/284 (15%)

Query  115  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  174
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  175  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  234
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  235  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  292
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  293  TGSLSYPCTQCPGKFYSAYELRQHVRQH-----------------------------TDE  323
            TG   + C  C   F     L  H+RQH                             T +
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  324  RPFPCPVCQRTFRRKATMESHLMLHTGA----KPYACTECDQKF  363
            RPF C  C ++F  K  +  H   HT      +P+AC +C + F
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  297  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  356
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  357  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  416
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  417  TVRYLRSYELVLHLKK  432
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02080.1.1 Unknown

Length=144
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6QU65_DROME  unnamed protein product                                 25.8    10.0 


>Q6QU65_DROME unnamed protein product
Length=1407

 Score = 25.8 bits (55),  Expect = 10.0, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 9/14 (64%), Gaps = 0/14 (0%)

Query  103   DPPPSPPAPNPPAP  116
             DPP SP  P PP P
Sbjct  1219  DPPKSPQRPAPPKP  1232



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02090.1.1 Nephrin

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KIB0_DROME  unnamed protein product                                 128     7e-36
Q9VFU7_DROME  unnamed protein product                                 124     1e-34
Q59DZ1_DROME  unnamed protein product                                 120     3e-33


>Q0KIB0_DROME unnamed protein product
Length=1689

 Score = 128 bits (321),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 0/95 (0%)

Query  15   PMVTLRLGPKLKPNAIKEGDDVYFECKVRANPKEHKITWYHNGIAVKRNSSSGVILSTES  74
            P VTL LG  L+P+ IKEGDDVYFEC +++NPKEH+I W H+G  V +N S G+I+ST S
Sbjct  375  PQVTLSLGSTLRPDDIKEGDDVYFECHIKSNPKEHRIMWSHDGQPVTQNVSWGIIISTRS  434

Query  75   LVLQKVSRHNSGRYTCQAVNDRGETSSHPVTLRVQ  109
            LVLQ+V R +SG Y C A NDRGET S PV LR++
Sbjct  435  LVLQRVGRIHSGFYACSAANDRGETQSAPVNLRIR  469


 Score = 33.1 bits (74),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query  32   EGDDVYFECKVRANPKEHKITWYHNGIAVKRNS--SSGVILSTESLVLQKVSRHN-SGRY  88
            EGD++   C+VR    E  +TW +    ++  S  S G  ++   L + ++SR   +  Y
Sbjct  192  EGDNIVLTCEVRGGRPEPTVTWMNGTRTLEAGSGVSMGRHVTVNRLEVAQISRSALNNTY  251

Query  89   TCQAVNDR  96
             CQA N +
Sbjct  252  RCQASNTK  259


>Q9VFU7_DROME unnamed protein product
Length=1001

 Score = 124 bits (311),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%), Gaps = 0/101 (0%)

Query  9    LVISDQPMVTLRLGPKLKPNAIKEGDDVYFECKVRANPKEHKITWYHNGIAVKRNSSSGV  68
            L++  QP  TL++G  L P+ IKEGDD YFEC V ANPK +K++W+HNG  ++ N S+GV
Sbjct  390  LIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGV  449

Query  69   ILSTESLVLQKVSRHNSGRYTCQAVNDRGETSSHPVTLRVQ  109
            ILS +SLVLQ VSR ++G YTC AVN  G+  S+PVTLR++
Sbjct  450  ILSDQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPVTLRIR  490


 Score = 28.1 bits (61),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 16/32 (50%), Gaps = 0/32 (0%)

Query  29   AIKEGDDVYFECKVRANPKEHKITWYHNGIAV  60
            +  EG+D+   C+V        +TWY +  A+
Sbjct  211  SFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAI  242


>Q59DZ1_DROME unnamed protein product
Length=1064

 Score = 120 bits (302),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)

Query  15   PMVTLRLGPKLKPNAIKEGDDVYFECKVRANPKEHKITWYHNGIAVKRNSSSGVILSTES  74
            P+VTLRLG  L P+ IKEGDDVYFEC V++NP+  K+ W HNGI ++ N+S+ VI S +S
Sbjct  367  PLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSNQS  426

Query  75   LVLQKVSRHNSGRYTCQAVNDRGETSSHPVTLRVQ  109
            LVLQK+++H +G Y C A+ND GET S+ + LRV+
Sbjct  427  LVLQKITKHYAGNYACSAINDEGETVSNQLPLRVK  461


 Score = 42.0 bits (97),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 52/99 (53%), Gaps = 7/99 (7%)

Query  2    YSIPILCLVISDQPMVTLRLGPKLKPNAI---KEGDDVYFECKVRANPKEHKITWYHNGI  58
            +   +  +++ +QP++  R G +L    +   +EGDD+   C+V     + ++ W  NG+
Sbjct  154  FRFNLSVIILPEQPIIMDRWGRQLNGTQLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGL  213

Query  59   AVKRNS--SSGVILSTESLVLQKVSRHN-SGRYTCQAVN  94
             V   +  +SG ++    L+   V R++ +  +TCQA+N
Sbjct  214  LVDNQNEHNSGDVIENR-LLWPSVQRNDLNSVFTCQALN  251



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02100.1.1 Cystinosin

Length=396
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CUP_DROME  unnamed protein product                                    35.4    0.055
Q7KTL6_DROME  unnamed protein product                                 30.4    1.9  
Q9VM74_DROME  unnamed protein product                                 30.0    2.0  


>CUP_DROME unnamed protein product
Length=1117

 Score = 35.4 bits (80),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 37/87 (43%), Gaps = 0/87 (0%)

Query  170  FDFLGLNLIGFTLYSLYNLGYYSSSLIQDQFFEKNGTNSNPVQLNDVFFSIHATIITLLT  229
             D L   +I   L +L+NL     +L   Q  + N     P QL+      HA +I    
Sbjct  908  LDMLSSTVIASQLQNLHNLAIVQQTLAARQQPQHNPQTQAPHQLSQEDLQAHANVIMRNA  967

Query  230  IFQCLIYERGTQKVSIGARCLMCAYFL  256
            + +  I E+ ++ ++ GA+      +L
Sbjct  968  VMKRKIEEQTSKLINGGAKHQAQQQYL  994


>Q7KTL6_DROME unnamed protein product
Length=708

 Score = 30.4 bits (67),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (46%), Gaps = 3/81 (4%)

Query  193  SSLIQDQFFEKNG--TNSNPVQLN-DVFFSIHATIITLLTIFQCLIYERGTQKVSIGARC  249
            S+ + + F+ K+G     NPV    ++F+ I   I+  LT     I E  +  VSIGA C
Sbjct  494  SAFVSNLFWCKDGWDVEDNPVSTAFEIFWMIFEPILFGLTGATIKIRELDSHTVSIGAAC  553

Query  250  LMCAYFLYLSGVLGLVLFNKF  270
            +     L +    G+   ++ 
Sbjct  554  IFTGAILRILTTAGIAFGDRL  574


>Q9VM74_DROME unnamed protein product
Length=715

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (46%), Gaps = 3/81 (4%)

Query  193  SSLIQDQFFEKNG--TNSNPVQLN-DVFFSIHATIITLLTIFQCLIYERGTQKVSIGARC  249
            S+ + + F+ K+G     NPV    ++F+ I   I+  LT     I E  +  VSIGA C
Sbjct  501  SAFVSNLFWCKDGWDVEDNPVSTAFEIFWMIFEPILFGLTGATIKIRELDSHTVSIGAAC  560

Query  250  LMCAYFLYLSGVLGLVLFNKF  270
            +     L +    G+   ++ 
Sbjct  561  IFTGAILRILTTAGIAFGDRL  581



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


Query= Dcitr00g02110.1.1 Cystinosin

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SUZ12_DROME  unnamed protein product                                  29.3    6.0  


>SUZ12_DROME unnamed protein product
Length=900

 Score = 29.3 bits (64),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  355  FVLYFSYPVQEEYYLRNPHSANPIQLNDVV  384
            F+  F  P Q   YLRN H  NPI LN  +
Sbjct  58   FLQAFEKPTQIYRYLRNRHETNPIFLNRTL  87



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3265212032


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g02120.1.1 Unknown

Length=130
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I0S6_DROME  unnamed protein product                                 28.1    1.4  
Q9VPG5_DROME  unnamed protein product                                 28.1    1.4  
Q9VPG4_DROME  unnamed protein product                                 28.1    1.4  


>Q8I0S6_DROME unnamed protein product
Length=401

 Score = 28.1 bits (61),  Expect = 1.4, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  49   FMGYCCLVASCIAFATAVLNKSKKAKR  75
            F+G CCL+  C +F  A+   +K   R
Sbjct  205  FLGLCCLLTGCTSFEEAIQLATKGDNR  231


>Q9VPG5_DROME unnamed protein product
Length=417

 Score = 28.1 bits (61),  Expect = 1.4, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  49   FMGYCCLVASCIAFATAVLNKSKKAKR  75
            F+G CCL+  C +F  A+   +K   R
Sbjct  221  FLGLCCLLTGCTSFEEAIQLATKGDNR  247


>Q9VPG4_DROME unnamed protein product
Length=419

 Score = 28.1 bits (61),  Expect = 1.4, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  49   FMGYCCLVASCIAFATAVLNKSKKAKR  75
            F+G CCL+  C +F  A+   +K   R
Sbjct  223  FLGLCCLLTGCTSFEEAIQLATKGDNR  249



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02130.1.1 Retrovirus-related

Length=209
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I0B7_DROME  unnamed protein product                                 28.5    2.4  
TRPCG_DROME  unnamed protein product                                  26.9    8.3  


>Q8I0B7_DROME unnamed protein product
Length=563

 Score = 28.5 bits (62),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 17/32 (53%), Gaps = 0/32 (0%)

Query  121  QIPFNNEIVASQSSPSNPATDNVPSESNDAMD  152
            Q+P  N I A    PS P  D  P+ S DA++
Sbjct  12   QVPLPNAIAAKYQEPSEPRDDEQPTTSKDALE  43


>TRPCG_DROME unnamed protein product
Length=2023

 Score = 26.9 bits (58),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query  98    SSLDPSPASNFFIPEFFPDLKKPQIPFNNEIVASQSSPSNPATDNVPSESNDAMDKAVEN  157
             S+L P P    F  +   ++ K      +E V S +  SNPA  ++P  S   +   +  
Sbjct  1947  STLKPQP----FASKLGMNVLKESSSSTDESVGSSAKSSNPAL-SIPQISTHLVQDEIAK  2001

Query  158   LPTQVHSSTPLPADIPEDEDM  178
             L + + SST    D P +E M
Sbjct  2002  LSSNIKSSTESEKDPPFNETM  2022



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02140.1.1 Myeloid

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MLF_DROME  unnamed protein product                                    165     1e-48
Q70HU3_DROME  unnamed protein product                                 29.3    2.5  
Q7KU01_DROME  unnamed protein product                                 29.3    2.5  


>MLF_DROME unnamed protein product
Length=376

 Score = 165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 136/221 (62%), Gaps = 36/221 (16%)

Query  1    MFGSLMRFVDGDEDDILGAHMQNMNQMMSSMNSMFANPFGMMGG-MPG-FGGASPF----  54
            +FG+LM    GD DD LG    +MN  M++MN    +   +M   MP  F   SPF    
Sbjct  3    LFGALM----GDFDDDLGLMNNHMNHTMNAMNMQMRSMNRLMNSFMPDPFMQVSPFDQGF  58

Query  55   -------------MPMM-----PQMPNMSQLMSQMQNNGNCHSYSSSTVMSMTNGPDGRP  96
                         MP M     P MPN ++L++      +  S+  STVM+M++GPDGRP
Sbjct  59   QQNALMERPQMPAMPAMGLFGMPMMPNFNRLLNADIGGNSGASFCQSTVMTMSSGPDGRP  118

Query  97   QVYQATSSTRSAPGGIRETKKAVCDSRTGVKKLAIGHAIGDKEHIIEREQNLRSGEQEER  156
            Q+YQA++ST++ PGG+RET++ V DSRTGVKK+AIGH IG++ HIIE+EQ++RSG+ EER
Sbjct  119  QIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEER  178

Query  157  QDFINLDEEESEAFNQEWRQKAREAQLLQHSVNYPQTRHQA  197
            Q+FINL+E E+E F++E+  +A    +        Q+RH A
Sbjct  179  QEFINLEEGEAEQFDREFTSRASRGAV--------QSRHHA  211


>Q70HU3_DROME unnamed protein product
Length=1135

 Score = 29.3 bits (64),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 39/85 (46%), Gaps = 8/85 (9%)

Query  15   DILGAHMQNMNQMMSSMNS---MFANPFG-MMGGMPGFGGASPFMPMMP-QMPNMSQLMS  69
            +I G+ M   + M++ + +   +  NPF   MGGMP   G  P   MMP Q+PN +    
Sbjct  882  NISGSDMGFNDNMLTGLGAGPNLMQNPFDPFMGGMPAPTGMPPGPNMMPNQVPNGT---P  938

Query  70   QMQNNGNCHSYSSSTVMSMTNGPDG  94
            Q+  N          V  M NGP G
Sbjct  939  QIWQNQMGPGGGPPGVPPMMNGPGG  963


>Q7KU01_DROME unnamed protein product
Length=1135

 Score = 29.3 bits (64),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 39/85 (46%), Gaps = 8/85 (9%)

Query  15   DILGAHMQNMNQMMSSMNS---MFANPFG-MMGGMPGFGGASPFMPMMP-QMPNMSQLMS  69
            +I G+ M   + M++ + +   +  NPF   MGGMP   G  P   MMP Q+PN +    
Sbjct  882  NISGSDMGFNDNMLTGLGAGPNLMQNPFDPFMGGMPAPTGMPPGPNMMPNQVPNGT---P  938

Query  70   QMQNNGNCHSYSSSTVMSMTNGPDG  94
            Q+  N          V  M NGP G
Sbjct  939  QIWQNQMGPVGGPPGVPPMMNGPGG  963



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02150.1.1 Galactose-1-phosphate

Length=296
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GALT_DROME  unnamed protein product                                   258     6e-85


>GALT_DROME unnamed protein product
Length=350

 Score = 258 bits (659),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 199/348 (57%), Gaps = 62/348 (18%)

Query  4    FQADEHQHVRYNPLKGEWILVSPHRMKRPWSGQEEKSNEDPIAEFDRRIRSALQLPGVN-  62
            F A EH H R NPL G+W+LV PHR +RPWSGQ+EK+ ++ + EFD    +    PGV  
Sbjct  3    FVASEHPHRRLNPLNGQWVLVCPHRTQRPWSGQQEKAQKNELPEFDP---TNPLCPGVTR  59

Query  63   ------PNYDSVFVFNNDFPALLENVPSPPVQDDPLFKMG-----MRLAC--ARSFVSIP  109
                  P Y+S +VF NDFPAL+E VP PP  DDPLF++       R+ C   +S +++P
Sbjct  60   PNGIQTPEYESTYVFENDFPALVEVVPVPPNNDDPLFQIAPARGNCRVMCFHPKSNLTLP  119

Query  110  S-----------------------------------------PTPHYP--SCP-LRKFAR  125
            +                                         P PH    SC  L    +
Sbjct  120  TMSAAEIVVVIDEWISQFNELSAKYAWVQIFENKGAAMGCSNPHPHCQIWSCSFLPTEPQ  179

Query  126  IKDIHQREYYQTHGKPLLMDYVSKELLKRDRVVYETQTGWLWYRSGPSGHFETMILPRTH  185
            +K    R YY T+ +P+L DYV +EL +++R+V E +   +      +  FETM++ R +
Sbjct  180  LKQERLRAYYATNERPMLADYVERELQRQERIVIENRDWLVVVPFWATWPFETMLISRNN  239

Query  186  VLRFTDLDDQQRNNLADIIKKITTKYDNLFKVSFPYSMGFHGAPTGSK-VHQNNSHWVFH  244
              R  DL  +QR NLA  IK++TTKYDNLF+ SFPYSMG+HGAPTG +  H +++HW  H
Sbjct  240  NKRINDLTAEQRYNLALTIKELTTKYDNLFQCSFPYSMGWHGAPTGPEHAHASSAHWTLH  299

Query  245  ASYLPPLLRSATVKKFMVGYELLAQTQRDLTPEQAAERLRNSPHDKHY  292
            A Y PPLLRSA+V+KFMVG+ELLA  QRDLTPEQAA+RLR      HY
Sbjct  300  AIYYPPLLRSASVRKFMVGFELLAMAQRDLTPEQAAQRLREVDGKCHY  347



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02160.1.1 CG12123-RA

Length=180
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED19_DROME  unnamed protein product                                  28.9    1.4  


>MED19_DROME unnamed protein product
Length=337

 Score = 28.9 bits (63),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 0/53 (0%)

Query  86   AVIAGQISVRQLELAIRLGDTPVVIRCCLYYALSLIQQKKLHQARQVIQTQYN  138
             V+A Q S   L+  I LG TP +I    +Y++     K      + + T+Y 
Sbjct  23   PVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDLMTEYG  75



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02170.1.1 Constitutive

Length=402


***** No hits found *****



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02180.1.1 Galactose-1-phosphate

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GALT_DROME  unnamed protein product                                   454     2e-161
SCC4_DROME  unnamed protein product                                   28.9    4.0   


>GALT_DROME unnamed protein product
Length=350

 Score = 454 bits (1169),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 256/345 (74%), Gaps = 1/345 (0%)

Query  4    FQADEHQHVRYNPLKGEWILVSPHRMKRPWSGQEEKSNEDPIAEFDPKNPLCPTATRGNG  63
            F A EH H R NPL G+W+LV PHR +RPWSGQ+EK+ ++ + EFDP NPLCP  TR NG
Sbjct  3    FVASEHPHRRLNPLNGQWVLVCPHRTQRPWSGQQEKAQKNELPEFDPTNPLCPGVTRPNG  62

Query  64   EVNPNYDSVFVFNNDFPALLENVPSPPVQDDPLFKMGNASGVCKVICFHPKSNTTLPIMS  123
               P Y+S +VF NDFPAL+E VP PP  DDPLF++  A G C+V+CFHPKSN TLP MS
Sbjct  63   IQTPEYESTYVFENDFPALVEVVPVPPNNDDPLFQIAPARGNCRVMCFHPKSNLTLPTMS  122

Query  124  IEEIRKVIDTWVDETASLGKTYEWVQIFENKGAIMGCSNPHPHCQVWASSFLPNLPRIKD  183
              EI  VID W+ +   L   Y WVQIFENKGA MGCSNPHPHCQ+W+ SFLP  P++K 
Sbjct  123  AAEIVVVIDEWISQFNELSAKYAWVQIFENKGAAMGCSNPHPHCQIWSCSFLPTEPQLKQ  182

Query  184  IHQREYYQTHGKPLLMDYVSKELLKRDRVVVRNPDWVVVVPFWAEWPFETMILPRTHVLR  243
               R YY T+ +P+L DYV +EL +++R+V+ N DW+VVVPFWA WPFETM++ R +  R
Sbjct  183  ERLRAYYATNERPMLADYVERELQRQERIVIENRDWLVVVPFWATWPFETMLISRNNNKR  242

Query  244  FTDLDDQQRNNLADIIKKITTKYDNLFKVSFPYSMGFHGAPTGSK-VHQNNSHWVFHASY  302
              DL  +QR NLA  IK++TTKYDNLF+ SFPYSMG+HGAPTG +  H +++HW  HA Y
Sbjct  243  INDLTAEQRYNLALTIKELTTKYDNLFQCSFPYSMGWHGAPTGPEHAHASSAHWTLHAIY  302

Query  303  LPPLLRSATVKKFMVGYELLAQTQRDLTPEQAAERLRNSPHDKHY  347
             PPLLRSA+V+KFMVG+ELLA  QRDLTPEQAA+RLR      HY
Sbjct  303  YPPLLRSASVRKFMVGFELLAMAQRDLTPEQAAQRLREVDGKCHY  347


>SCC4_DROME unnamed protein product
Length=632

 Score = 28.9 bits (63),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  163  PHPHCQVWASSFLPNLPRI-KDI-HQREYYQTHGK  195
            P  H Q+W S+ L +L R+ KD+ H+++ Y  H K
Sbjct  527  PDIHVQLWGSAILKDLHRMSKDVQHEKDAYANHVK  561



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02190.1.1 CG12123-RA

Length=238
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T499_DROME  unnamed protein product                                 30.4    0.71 
A1Z957_DROME  unnamed protein product                                 29.6    1.0  
MED19_DROME  unnamed protein product                                  28.5    2.7  


>Q8T499_DROME unnamed protein product
Length=278

 Score = 30.4 bits (67),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 17/72 (24%), Positives = 34/72 (47%), Gaps = 4/72 (6%)

Query  33   LPVVLH--DDTLKSTKYLQLSLDGYRFSCIKKILVMSPTYRRNVIEYFANLSKDSNWKIN  90
            +PV  H  D+ +K+T  L+     Y+   ++ I+  SP      I YF  L +DS   + 
Sbjct  144  IPVEYHTEDEVIKAT--LEQMFAEYKECSMRDIIAFSPPNNSKCIAYFTQLVRDSTTHVG  201

Query  91   VKLIEPSQHVLD  102
              ++  +++  +
Sbjct  202  CGILRQTKNTTN  213


>A1Z957_DROME unnamed protein product
Length=291

 Score = 29.6 bits (65),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 17/72 (24%), Positives = 34/72 (47%), Gaps = 4/72 (6%)

Query  33   LPVVLH--DDTLKSTKYLQLSLDGYRFSCIKKILVMSPTYRRNVIEYFANLSKDSNWKIN  90
            +PV  H  D+ +K+T  L+     Y+   ++ I+  SP      I YF  L +DS   + 
Sbjct  157  IPVEYHTEDEVIKAT--LEQMFAEYKECSMRDIIAFSPPNNSKCIAYFTQLVRDSTTHVG  214

Query  91   VKLIEPSQHVLD  102
              ++  +++  +
Sbjct  215  CGILRQTKNTTN  226


>MED19_DROME unnamed protein product
Length=337

 Score = 28.5 bits (62),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 0/53 (0%)

Query  144  AVIAGQISVRQLELAIRLGDTPVVIRCCLYYALSLIQQKKLHQARQVIQTQYN  196
             V+A Q S   L+  I LG TP +I    +Y++     K      + + T+Y 
Sbjct  23   PVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDLMTEYG  75



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02200.1.1 Pro-Pol

Length=450


***** No hits found *****



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02210.1.1 Myeloid

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MLF_DROME  unnamed protein product                                    165     1e-48
Q70HU3_DROME  unnamed protein product                                 29.3    2.5  
Q7KU01_DROME  unnamed protein product                                 29.3    2.5  


>MLF_DROME unnamed protein product
Length=376

 Score = 165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 136/221 (62%), Gaps = 36/221 (16%)

Query  1    MFGSLMRFVDGDEDDILGAHMQNMNQMMSSMNSMFANPFGMMGG-MPG-FGGASPF----  54
            +FG+LM    GD DD LG    +MN  M++MN    +   +M   MP  F   SPF    
Sbjct  3    LFGALM----GDFDDDLGLMNNHMNHTMNAMNMQMRSMNRLMNSFMPDPFMQVSPFDQGF  58

Query  55   -------------MPMM-----PQMPNMSQLMSQMQNNGNCHSYSSSTVMSMTNGPDGRP  96
                         MP M     P MPN ++L++      +  S+  STVM+M++GPDGRP
Sbjct  59   QQNALMERPQMPAMPAMGLFGMPMMPNFNRLLNADIGGNSGASFCQSTVMTMSSGPDGRP  118

Query  97   QVYQATSSTRSAPGGIRETKKAVCDSRTGVKKLAIGHAIGDKEHIIEREQNLRSGEQEER  156
            Q+YQA++ST++ PGG+RET++ V DSRTGVKK+AIGH IG++ HIIE+EQ++RSG+ EER
Sbjct  119  QIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEER  178

Query  157  QDFINLDEEESEAFNQEWRQKAREAQLLQHSVNYPQTRHQA  197
            Q+FINL+E E+E F++E+  +A    +        Q+RH A
Sbjct  179  QEFINLEEGEAEQFDREFTSRASRGAV--------QSRHHA  211


>Q70HU3_DROME unnamed protein product
Length=1135

 Score = 29.3 bits (64),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 39/85 (46%), Gaps = 8/85 (9%)

Query  15   DILGAHMQNMNQMMSSMNS---MFANPFG-MMGGMPGFGGASPFMPMMP-QMPNMSQLMS  69
            +I G+ M   + M++ + +   +  NPF   MGGMP   G  P   MMP Q+PN +    
Sbjct  882  NISGSDMGFNDNMLTGLGAGPNLMQNPFDPFMGGMPAPTGMPPGPNMMPNQVPNGT---P  938

Query  70   QMQNNGNCHSYSSSTVMSMTNGPDG  94
            Q+  N          V  M NGP G
Sbjct  939  QIWQNQMGPGGGPPGVPPMMNGPGG  963


>Q7KU01_DROME unnamed protein product
Length=1135

 Score = 29.3 bits (64),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 39/85 (46%), Gaps = 8/85 (9%)

Query  15   DILGAHMQNMNQMMSSMNS---MFANPFG-MMGGMPGFGGASPFMPMMP-QMPNMSQLMS  69
            +I G+ M   + M++ + +   +  NPF   MGGMP   G  P   MMP Q+PN +    
Sbjct  882  NISGSDMGFNDNMLTGLGAGPNLMQNPFDPFMGGMPAPTGMPPGPNMMPNQVPNGT---P  938

Query  70   QMQNNGNCHSYSSSTVMSMTNGPDG  94
            Q+  N          V  M NGP G
Sbjct  939  QIWQNQMGPVGGPPGVPPMMNGPGG  963



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02220.1.1 endoribonuclease

Length=531


***** No hits found *****



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02230.1.1 embryo

Length=198
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    89.4    6e-21


>VIR_DROME unnamed protein product
Length=1854

 Score = 89.4 bits (220),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 9/66 (14%)

Query  4     RKPFVTPMRGRGFR----TISSIQRGDIFRTRLPNTSRPPSLHVDDFVALETCGQQPTGP  59
             +K FV+ +RGRGF     +     RGD+FR+R PNTSRPPSLHVDDF+ALETCG QPTGP
Sbjct  1713  KKMFVSSVRGRGFARPPPS-----RGDLFRSRPPNTSRPPSLHVDDFLALETCGAQPTGP  1767

Query  60    TGYNKM  65
             TGYNK+
Sbjct  1768  TGYNKI  1773



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02240.1.1 ATP-dependent

Length=1082
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDX18_DROME  unnamed protein product                                  157     7e-40
DDX49_DROME  unnamed protein product                                  153     3e-39
Q9VJ74_DROME  unnamed protein product                                 147     4e-36


>DDX18_DROME unnamed protein product
Length=680

 Score = 157 bits (398),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 116/426 (27%), Positives = 198/426 (46%), Gaps = 74/426 (17%)

Query  469  IKQHSRRSLFWPRDICVSAPTGSGKTLAFVLPILQIL-QYRVVPR--IRALVVLPTQDLA  525
            I+  S   L   RD+  +A TGSGKTLAF++P ++++ + R +PR     +++ PT++L+
Sbjct  213  IQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFMPRNGTGVIIISPTRELS  272

Query  526  SQVYSVFKTYIKGTKLQVVLTVGSTPMLDEQRKLVAVDKVTGKHVSLVDIVVTTPGRLVD  585
             Q + V K  +        L +G +    E  KL       GK +   +I+V TPGRL+D
Sbjct  273  MQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKL-------GKGI---NILVATPGRLLD  322

Query  586  HLTNSPGFDLSELKFLVVDEADRMIDNNDCNWLLHINKHINYQGLNSVPPLSLHTFLTYP  645
            HL NSP F    L+ L++DE DR+++     +   + + IN                  P
Sbjct  323  HLQNSPDFLYKNLQCLIIDEVDRILE---IGFEEELKQIIN----------------LLP  363

Query  646  SRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIG  705
             R Q +LFSAT +   E L +L+L    ++       G  D Q T++    D L  G+I 
Sbjct  364  KRRQTMLFSATQTARIEALSKLALKSEPIYV------GVHDNQDTAT---VDGLEQGYI-  413

Query  706  KFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVA  765
                          C +  + LVL+  ++K+  + V+ F ++         L ++ID   
Sbjct  414  -------------VCPSEKRLLVLFTFLKKNRKKKVMVFFSSCMSVKYHHELFNYID---  457

Query  766  TKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEA  825
                   + +  ++   K  +R     +F   +  +++ +D  ARG+D+  +D ++ Y+ 
Sbjct  458  -------LPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQYDP  510

Query  826  PDNIKKYIHRIGRTARGGRQGTSVTLVTTHERSAFLKMLSS---------VGKQNIEDLE  876
            PD+ ++YIHR+GRTARG        L+   E   FL+ L +            Q I D++
Sbjct  511  PDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLRYLKAAKVPLNEFEFSWQKIADIQ  570

Query  877  CTEEEL  882
               E+L
Sbjct  571  LQLEKL  576


>DDX49_DROME unnamed protein product
Length=521

 Score = 153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 122/418 (29%), Positives = 189/418 (45%), Gaps = 82/418 (20%)

Query  441  LNPYFKKLLRRNEVTNFFPVQSELIPFLIKQHSRRSLFWPRDICVSAPTGSGKTLAFVLP  500
            L P+  K L +  +    P+Q + IP         ++   +D   +A TGSGKT AF LP
Sbjct  14   LRPWLVKQLTKLGLKGATPIQQKCIP---------AILAGQDCIGAAKTGSGKTFAFALP  64

Query  501  ILQILQYRVVPRIRALVVLPTQDLASQVYSVFKTYIKGTKLQVVLTVGSTPMLDEQRKLV  560
            IL+ L    V    ALV+ PT +LA Q+   F    +   ++V +  G T  + E +KL+
Sbjct  65   ILERLSEEPVSHF-ALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQKLM  123

Query  561  AVDKVTGKHVSLVDIVVTTPGRLVDHLTNSPGFDLSELKFLVVDEADRMIDNNDCNWLLH  620
                          IVV  PGRL DHLT    F    LK+LVVDEADRM+ N D +  L 
Sbjct  124  QRPH----------IVVAMPGRLADHLTGCDTFSFDNLKYLVVDEADRML-NGDFDESLS  172

Query  621  INKHINYQGLNSVPPLSLHTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVE  680
            I +                     P   Q L FSAT+    + + + S+F          
Sbjct  173  IIER------------------CLPKTRQNLFFSATMK---DFIKESSIF----------  201

Query  681  PAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQ-  739
                    P +S+    +  S       T   L ++   C+   + +VL + +RK+  + 
Sbjct  202  --------PIASDCFEWSQDS----DVATVETLDQRYLLCADYDRDMVLIEALRKYREEN  249

Query  740  ---GVLCFVNTAQGAHRLARLL--HHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEF  794
                V+ F NT +    L+  L    IDNV   G             ++  +R   +  F
Sbjct  250  ENANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGF------------MRQKERVAALSRF  297

Query  795  RRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLV  852
            +  +I  ++A+D  ARG+D+ ++++V+N+  P   K+YIHR+GRTAR GR+G S+++ 
Sbjct  298  KSNQIRTLIATDVAARGLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISIF  355


>Q9VJ74_DROME unnamed protein product
Length=822

 Score = 147 bits (370),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 120/449 (27%), Positives = 203/449 (45%), Gaps = 86/449 (19%)

Query  459  PVQSELIPFLIKQHSRRSLFWPRDICVSAPTGSGKTLAFVLPILQILQYRVVPRIR----  514
            P+Q + IP  ++          RDI   A TGSGKTLAF++P+L  +Q   +P+I     
Sbjct  419  PIQRQAIPIGLQN---------RDIIGVAETGSGKTLAFLIPLLSWIQ--SLPKIERLED  467

Query  515  ------ALVVLPTQDLASQVYSVFKTYIKGTKLQVVLTVGSTPMLDEQRKLVAVDKVTGK  568
                  A+++ PT++LA Q+      + +   ++ V+ VG     +EQ          G 
Sbjct  468  VDQGPYAIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVGGLSR-EEQ----------GF  516

Query  569  HVSL-VDIVVTTPGRLVDHLTNSPGFDLSELKFLVVDEADRMIDNNDCNWLLHINKHINY  627
             + L  +IV+ TPGRL+D L N     L++  ++V+DEADRMID     +   + K + Y
Sbjct  517  RLRLGCEIVIATPGRLIDVLENR-YLVLNQCTYIVLDEADRMID---MGFEPDVQKILEY  572

Query  628  QGLNSVPPLS---------LHTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSV  678
              + ++ P +         +  F T     Q ++F+AT+    E+L +  L +P      
Sbjct  573  MPVTNLKPDTEEAEDETKLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRP------  626

Query  679  VEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLT-TCSTNLKPLVLYQLIRKHA  737
                                 ++ +IG    P E +E++      N K   L +++ +  
Sbjct  627  ---------------------ATVYIGSVGKPTERTEQIVYMMGENDKRKKLMEILSRKI  665

Query  738  MQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRR  797
               V+ FVN  +GA  LA+ L  +   +    G K            +QR   +   +  
Sbjct  666  DPPVIIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQ----------EQREYALAALKSG  715

Query  798  KIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHER  857
              D++VA+D   RGID++++ +VINY+    I+ Y HRIGRT R G+ G +++ VT  + 
Sbjct  716  AKDILVATDVAGRGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDS  775

Query  858  SAFLKMLSSVGKQNIEDLECTEEELEHLE  886
            + F  +   V    +    C  E + H E
Sbjct  776  ALFYDLKQCVSASPVST--CPPELMNHPE  802



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02250.1.1 Activating

Length=111
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJ74_DROME  unnamed protein product                                 28.1    1.0  


>Q9VJ74_DROME unnamed protein product
Length=822

 Score = 28.1 bits (61),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 21/27 (78%), Gaps = 2/27 (7%)

Query  68   SVWLTKEERA--KIAQKQEELDRQRHS  92
             V+LTKE+RA   I ++QEE++RQR +
Sbjct  148  PVFLTKEQRALEAIKRRQEEVERQRAA  174



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02260.1.1 embryo

Length=118
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    94.7    6e-24
M9PBS1_DROME  unnamed protein product                                 27.3    2.1  
A0A0R4YI50_DROME  unnamed protein product                             27.3    2.2  


>VIR_DROME unnamed protein product
Length=1854

 Score = 94.7 bits (234),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 1/62 (2%)

Query  8     RKPFVTPMRGRGFRTISSIQRGDIFRTRLPNTSRPPSLHVDDFVALETCGQQPTGPTGYN  67
             +K FV+ +RGRGF       RGD+FR+R PNTSRPPSLHVDDF+ALETCG QPTGPTGYN
Sbjct  1713  KKMFVSSVRGRGFARPPP-SRGDLFRSRPPNTSRPPSLHVDDFLALETCGAQPTGPTGYN  1771

Query  68    KM  69
             K+
Sbjct  1772  KI  1773


>M9PBS1_DROME unnamed protein product
Length=603

 Score = 27.3 bits (59),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  9    KPFVTPMRGRGFRTISSIQRGDIFRT  34
            +PFV  + G+GFR  S++ R  I  T
Sbjct  336  RPFVCKVCGKGFRQASTLCRHKIIHT  361


>A0A0R4YI50_DROME unnamed protein product
Length=698

 Score = 27.3 bits (59),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  9    KPFVTPMRGRGFRTISSIQRGDIFRT  34
            +PFV  + G+GFR  S++ R  I  T
Sbjct  344  RPFVCKVCGKGFRQASTLCRHKIIHT  369



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02270.1.1 Activating

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PHX4_DROME  unnamed protein product                                 32.7    0.36 
Q8IQX7_DROME  unnamed protein product                                 32.3    0.45 
KLP68_DROME  unnamed protein product                                  32.7    0.46 


>M9PHX4_DROME unnamed protein product
Length=383

 Score = 32.7 bits (73),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 52/127 (41%), Gaps = 17/127 (13%)

Query  140  NCLKCGRIVCSVEGSGPCLFC-GEL-VCSREERRLIEQSDQGDTLYQKLMDRKVIKGLEE  197
            +CLKCG   C +   G  L+  G L +C R+  RL      G+T Y      KVI   E 
Sbjct  185  DCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF-----GNTGYCAACS-KVIPAFEM  238

Query  198  ALKNRDRLVDFD----RNCEKRTTVIDDAHDYFCDNSVWLT--KEERAKIAQKQEELDRQ  251
             ++ R  +   +    + C  R  V D    Y C+N +      EER   A        +
Sbjct  239  VMRARTNVYHLECFACQQCNHRFCVGD--RFYLCENKILCEYDYEERLVFASMANHPMLK  296

Query  252  RH-SRLG  257
            RH S LG
Sbjct  297  RHVSSLG  303


>Q8IQX7_DROME unnamed protein product
Length=384

 Score = 32.3 bits (72),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 52/127 (41%), Gaps = 17/127 (13%)

Query  140  NCLKCGRIVCSVEGSGPCLFC-GEL-VCSREERRLIEQSDQGDTLYQKLMDRKVIKGLEE  197
            +CLKCG   C +   G  L+  G L +C R+  RL      G+T Y      KVI   E 
Sbjct  186  DCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF-----GNTGYCAACS-KVIPAFEM  239

Query  198  ALKNRDRLVDFD----RNCEKRTTVIDDAHDYFCDNSVW--LTKEERAKIAQKQEELDRQ  251
             ++ R  +   +    + C  R  V D    Y C+N +      EER   A        +
Sbjct  240  VMRARTNVYHLECFACQQCNHRFCVGDRF--YLCENKILCEYDYEERLVFASMANHPMLK  297

Query  252  RH-SRLG  257
            RH S LG
Sbjct  298  RHVSSLG  304


>KLP68_DROME unnamed protein product
Length=784

 Score = 32.7 bits (73),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query  235  KEERAKIAQKQEELDRQR--HSRLGPRKITIDFAGREVRAEDNMVDTYS  281
            KE  A++A+  EEL+R+R  +S+L  +    +  G+ VR   N++DTYS
Sbjct  432  KENEAEVAKSNEELERERVENSKLAAK--LAELEGQLVRGGKNLLDTYS  478



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02280.1.1 Xaa-Pro

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VG79_DROME  unnamed protein product                                 346     2e-117
XPP_DROME  unnamed protein product                                    47.8    3e-06 
SPT16_DROME  unnamed protein product                                  30.8    0.99  


>Q9VG79_DROME unnamed protein product
Length=491

 Score = 346 bits (887),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 207/286 (72%), Gaps = 0/286 (0%)

Query  1    MRYASRISSEAHRSVMRKVSAGMYEYQAEAIFKHYILYVGGSRHVAYTCICASGGNGAVL  60
            +RY +++SS+AH  VMR +  G  E++ E++F H+   VGG RH +YTCIC SG N ++L
Sbjct  198  LRYVAKVSSDAHIKVMRFMRPGRMEFEGESLFLHHAYSVGGCRHASYTCICGSGTNSSIL  257

Query  61   HYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKFTEKQAYIYNAVLSANR  120
            HYGHA APN K V DGD+ +FDMG++YCGYA+DITC++P NGKFT+ Q +IYNAVL A  
Sbjct  258  HYGHAGAPNSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFIYNAVLDARN  317

Query  121  AVMEAAKPGVSWVDMHHLANKVVLSKLLDIGLLRGTIDELMEHNIGALFQPHGLGHLIGI  180
            AV E+A+ GVSWVDMH LA +V+L +L + G+L+G ++E++E  +  +FQPHGLGHLIG+
Sbjct  318  AVTESARDGVSWVDMHKLAGRVLLQRLKEGGMLKGDVEEMLEAGVSGVFQPHGLGHLIGL  377

Query  181  DVHDVGGYLPHCPPRGTLPGLKSLRTARVLAENMVLTIEPGCYFIPAILEKAFKDEKIAF  240
            DVHDVGGYLP  P R + P L  LR AR+L   M +TIEPGCYFI  ++++A  D  IA 
Sbjct  378  DVHDVGGYLPKEPKRPSEPWLSKLRFARILKAGMYVTIEPGCYFINWLMDRALADPNIAK  437

Query  241  LFNQDKIREYFNTGGVRIEDVVVVKANGIENLVNVPRTVEEIEKWM  286
              N +    + N GGVRIED V++   G+EN   VPRTVE+IE  M
Sbjct  438  FINAEMFNRFRNFGGVRIEDDVLITKTGVENFAIVPRTVEDIEATM  483


>XPP_DROME unnamed protein product
Length=613

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 7/109 (6%)

Query  45   VAYTCICASGGNGAVLHYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKF  104
            +++T I ASG NG+V+HY H     ++++ND ++ + D G+ Y    +D+T +    G+ 
Sbjct  372  LSFTTISASGPNGSVIHY-HPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEP  429

Query  105  TEKQAYIYNAVLSANRAVMEAAKPG-VSWVDMHHLANKVVLSKLLDIGL  152
            TE Q   Y  VL    +      P  V    +  LA K     L D+GL
Sbjct  430  TEFQKEAYTRVLKGQLSFGSTVFPAKVKGQVLDTLARKA----LWDVGL  474


>SPT16_DROME unnamed protein product
Length=1083

 Score = 30.8 bits (68),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 25/93 (27%), Positives = 43/93 (46%), Gaps = 6/93 (6%)

Query  45   VAYTCICASGGNGAVLHYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKF  104
            +AY  I  SGG  ++      SA  DK      ++V  +G+ Y  Y S+I+ ++ VN   
Sbjct  242  MAYPPIIQSGGAYSL----KFSAVADKNPLHFGVIVCSLGARYKSYCSNISRTFLVNP--  295

Query  105  TEKQAYIYNAVLSANRAVMEAAKPGVSWVDMHH  137
            TE     Y  ++S    +++   PG    D++ 
Sbjct  296  TEAMQENYTFLVSVQEEILKLLVPGTKLCDVYE  328



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02290.1.1 Protein

Length=1163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    146     2e-35
Q9VLB4_DROME  unnamed protein product                                 29.6    9.6  


>VIR_DROME unnamed protein product
Length=1854

 Score = 146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/336 (28%), Positives = 169/336 (50%), Gaps = 31/336 (9%)

Query  804   EIVDYLNELYYLSFTHEGKHAISHVLTSDKNISLLLKIYKSKAEVDI---------KQKS  854
             ++  +++ +Y  +    G+     VL  + N+ + + + K +  +           K KS
Sbjct  882   KLATHMHAIYSQTCDPAGRQHTVEVLGLNNNLKIFMDLIKKEQRLQTQRQLSSPGTKYKS  941

Query  855   PSKLYISDLIKLAIKYSNHVPFLIKYSNDLMNL--NNQDYPD-----LVEIGPYLKPLYI  907
             P   Y  D++   ++Y   + +LI++   ++ L  N++ +       L E+  Y+KPL  
Sbjct  942   PVLSYAVDMVDACVRYCEQLDYLIEHGGVILELAKNHETFEPSVSAVLQEMYVYMKPLEA  1001

Query  908   KEIFSYDDIFEHVDILKKHMDNICNLSGEVITVLRILNYIS-----GNHLEDDIQEYKQL  962
               +F YDDI   V+++ + +D +    G++I  +RIL Y+S            + E  +L
Sbjct  1002  INVFVYDDIMPLVEVIGRSLDYLTTFPGDLIMAMRILRYLSISKPLAGQKAPPVTE--EL  1059

Query  963   KYKYVILQLYSLDGIHILTSILTKLVAHYEQAFVH----MFTNCYSLMSVISLSIKLLAK  1018
             K+++V LQLY+ DG+ +   I+ +L A++EQ   H    M         ++  ++++L +
Sbjct  1060  KHRFVALQLYAADGVQLCIQIMERLCAYFEQPGAHAPALMTIQGVHCCQIMLPTLQILRE  1119

Query  1019  MLYYVIQARNADYKDLTCVDTLLNIHTLCYYIPVSSNGYAIAQEICKDVVSVLLSYTLPV  1078
             +L Y I  R+  YKDLT +D L+ ++ L YY P         ++   +VV  LL+YT P 
Sbjct  1120  LLSYAILCRDGTYKDLTAIDHLVKVYYLLYYFPTRCQAGPEVEQCKMEVVQTLLAYTQP-  1178

Query  1079  TTEGDEKDALYNSLWSRMMTSVIKYVTNSPHLFIPG  1114
               E DE ++L+ SLW+ M+  V+K V    H FIPG
Sbjct  1179  -NEQDE-ESLHKSLWTLMIREVLKNVDGPAH-FIPG  1211


 Score = 103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/291 (27%), Positives = 148/291 (51%), Gaps = 30/291 (10%)

Query  493  VNIGLDYDKALNQVEASYKVRHIKIGVRLTEAILSLDQDINYVLLTEHGVD--KRLLHLF  550
            + I L +  A  Q + ++K+RHIK+G R+ E +L   +++   LL EH  D  + +  L+
Sbjct  496  LQIALSFQAACMQPQPAFKIRHIKLGARMAE-LLGSSEELFQHLLKEHKFDIFEAVFRLY  554

Query  551  QQEYMALSIKLLIIKTFDTLLVNSKVTQEFI--RRGGYKDLLEMIESKQLIRVKFALKNL  608
             + YMALSIKL ++K    LL      + F+  +  GY+ ++E I++ +L R K+AL+ +
Sbjct  555  HEPYMALSIKLQLLKAVYALLDTRMGIEHFMGAKNNGYQMIVEAIKTAKLTRTKYALQAI  614

Query  609  LHKIHMHETLQDLSDIIKRDIQD-------KESMEVCLLLLDQVLSGYK---------QI  652
            + K+H+ E L+ +    +R   D       ++ ME  ++   Q+   ++         Q+
Sbjct  615  IKKLHLWEGLESVQIWCRRLFVDRIIIPGNRDQMEDTVITCQQIEFAFEMLMDALFSSQL  674

Query  653  PYKIIQPKRFIPAGSQFDIAS--SIPGDLYRSIFLFYREFGLLESFLYLLTLSNLSHYTS  710
             Y  +QP+RF+P   +F++ +  +       ++  +  +  L ES L +L        T+
Sbjct  675  SY--LQPRRFLPVSKKFEVVTDPTAQRSFGNALQSYLGQNSLAESLLVMLANCKELPATT  732

Query  711  VISYIVELLSIVSESHDGLLFLMHYPGDVTNKLLRILLGSSNEEPEVPEHP  761
             +S +++L+  +  SH G+ + +     VT  ++ ILLG      EVP +P
Sbjct  733  YLS-MLDLMHTLLRSHVGIDYFVDDAFPVTQTIVAILLGLD----EVPRNP  778


>Q9VLB4_DROME unnamed protein product
Length=328

 Score = 29.6 bits (65),  Expect = 9.6, Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 36/95 (38%), Gaps = 3/95 (3%)

Query  206  PPPEPREPRERFPEESPAPVESAWPQSKHSTPPHPSSDKDRARGPPQSPPQDRDTIRVRR  265
            P  +P E  +  PE  PA +  + P          S+DK     P + P +  D   +  
Sbjct  204  PENKPVESSKGNPEVKPAGIPESKPGGSSVGAAAESADKKPIESPDKKPIESPDKKPIEI  263

Query  266  PRSLYGRSPSLDEGDWERGGGGPYWSEGKRPRSPS  300
            P+   G+     +G   R    P  S G++P   S
Sbjct  264  PK---GKPGGDSDGSTGRPEEKPIVSPGEKPTGSS  295



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02300.1.1 Activating

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PHX4_DROME  unnamed protein product                                 32.7    0.32 
Q8IQX7_DROME  unnamed protein product                                 32.7    0.35 
KLP68_DROME  unnamed protein product                                  32.7    0.41 


>M9PHX4_DROME unnamed protein product
Length=383

 Score = 32.7 bits (73),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 52/127 (41%), Gaps = 17/127 (13%)

Query  115  NCLKCGRIVCSVEGSGPCLFC-GEL-VCSREERRLIEQSDQGDTLYQKLMDRKVIKGLEE  172
            +CLKCG   C +   G  L+  G L +C R+  RL      G+T Y      KVI   E 
Sbjct  185  DCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF-----GNTGYCAACS-KVIPAFEM  238

Query  173  ALKNRDRLVDFD----RNCEKRTTVIDDAHDYFCDNSVWLT--KEERAKIAQKQEELDRQ  226
             ++ R  +   +    + C  R  V D    Y C+N +      EER   A        +
Sbjct  239  VMRARTNVYHLECFACQQCNHRFCVGD--RFYLCENKILCEYDYEERLVFASMANHPMLK  296

Query  227  RH-SRLG  232
            RH S LG
Sbjct  297  RHVSSLG  303


>Q8IQX7_DROME unnamed protein product
Length=384

 Score = 32.7 bits (73),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 52/127 (41%), Gaps = 17/127 (13%)

Query  115  NCLKCGRIVCSVEGSGPCLFC-GEL-VCSREERRLIEQSDQGDTLYQKLMDRKVIKGLEE  172
            +CLKCG   C +   G  L+  G L +C R+  RL      G+T Y      KVI   E 
Sbjct  186  DCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF-----GNTGYCAACS-KVIPAFEM  239

Query  173  ALKNRDRLVDFD----RNCEKRTTVIDDAHDYFCDNSVW--LTKEERAKIAQKQEELDRQ  226
             ++ R  +   +    + C  R  V D    Y C+N +      EER   A        +
Sbjct  240  VMRARTNVYHLECFACQQCNHRFCVGDRF--YLCENKILCEYDYEERLVFASMANHPMLK  297

Query  227  RH-SRLG  232
            RH S LG
Sbjct  298  RHVSSLG  304


>KLP68_DROME unnamed protein product
Length=784

 Score = 32.7 bits (73),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query  210  KEERAKIAQKQEELDRQR--HSRLGPRKITIDFAGREVRAEDNMVDTYS  256
            KE  A++A+  EEL+R+R  +S+L  +    +  G+ VR   N++DTYS
Sbjct  432  KENEAEVAKSNEELERERVENSKLAAK--LAELEGQLVRGGKNLLDTYS  478



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02310.1.1 Xaa-Pro

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VG79_DROME  unnamed protein product                                 211     3e-66
XPP_DROME  unnamed protein product                                    48.5    1e-06
SPT16_DROME  unnamed protein product                                  31.6    0.37 


>Q9VG79_DROME unnamed protein product
Length=491

 Score = 211 bits (538),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 125/162 (77%), Gaps = 0/162 (0%)

Query  1    MRYASRISSEAHRSVMRKVSAGMYEYQAEAIFKHYILYVGGSRHVAYTCICASGGNGAVL  60
            +RY +++SS+AH  VMR +  G  E++ E++F H+   VGG RH +YTCIC SG N ++L
Sbjct  198  LRYVAKVSSDAHIKVMRFMRPGRMEFEGESLFLHHAYSVGGCRHASYTCICGSGTNSSIL  257

Query  61   HYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKFTEKQAYIYNAVLSANR  120
            HYGHA APN K V DGD+ +FDMG++YCGYA+DITC++P NGKFT+ Q +IYNAVL A  
Sbjct  258  HYGHAGAPNSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFIYNAVLDARN  317

Query  121  AVMEAAKPGVSWVDMHLLANKVVLSKLLDIGLLRGTIDELME  162
            AV E+A+ GVSWVDMH LA +V+L +L + G+L+G ++E++E
Sbjct  318  AVTESARDGVSWVDMHKLAGRVLLQRLKEGGMLKGDVEEMLE  359


>XPP_DROME unnamed protein product
Length=613

 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 7/109 (6%)

Query  45   VAYTCICASGGNGAVLHYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKF  104
            +++T I ASG NG+V+HY H     ++++ND ++ + D G+ Y    +D+T +    G+ 
Sbjct  372  LSFTTISASGPNGSVIHY-HPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEP  429

Query  105  TEKQAYIYNAVLSANRAVMEAAKPG-VSWVDMHLLANKVVLSKLLDIGL  152
            TE Q   Y  VL    +      P  V    +  LA K     L D+GL
Sbjct  430  TEFQKEAYTRVLKGQLSFGSTVFPAKVKGQVLDTLARKA----LWDVGL  474


>SPT16_DROME unnamed protein product
Length=1083

 Score = 31.6 bits (70),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (47%), Gaps = 6/92 (7%)

Query  45   VAYTCICASGGNGAVLHYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKF  104
            +AY  I  SGG  ++      SA  DK      ++V  +G+ Y  Y S+I+ ++ VN   
Sbjct  242  MAYPPIIQSGGAYSL----KFSAVADKNPLHFGVIVCSLGARYKSYCSNISRTFLVNP--  295

Query  105  TEKQAYIYNAVLSANRAVMEAAKPGVSWVDMH  136
            TE     Y  ++S    +++   PG    D++
Sbjct  296  TEAMQENYTFLVSVQEEILKLLVPGTKLCDVY  327



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02320.1.1 Xaa-Pro

Length=99
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VG79_DROME  unnamed protein product                                 44.3    1e-06
WAPL_DROME  unnamed protein product                                   28.5    0.55 
Q9V3I2_DROME  unnamed protein product                                 26.2    2.4  


>Q9VG79_DROME unnamed protein product
Length=491

 Score = 44.3 bits (103),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)

Query  51   LQSKSPSVLLTLAGVNTDSDLHAIEATFKGIEKFKVDNQILFPVIAE  97
            L+  SP ++LTL+G N+DS L      F G EK+  D  +L+P+++E
Sbjct  139  LEGASPKLILTLSGTNSDSGLTLQPPDFAGKEKYVTDCNLLYPILSE  185


>WAPL_DROME unnamed protein product
Length=1741

 Score = 28.5 bits (62),  Expect = 0.55, Method: Composition-based stats.
 Identities = 21/81 (26%), Positives = 33/81 (41%), Gaps = 0/81 (0%)

Query  2     NAPFTSCLIDYFLIHKCRLSDQRFSILRARVVLVSVQIFDRGNKKIVQVLQSKSPSVLLT  61
             N P T CL    L  KC +   R  +    VV    +     NK +   L + +   +L+
Sbjct  1183  NPPATRCLSALQLAAKCMMPAFRMHVRAHGVVTKFFKALSDANKDLSLGLCTSAIMYILS  1242

Query  62    LAGVNTDSDLHAIEATFKGIE  82
               G+N D D  ++E     +E
Sbjct  1243  QEGLNMDLDRDSLELMINLLE  1263


>Q9V3I2_DROME unnamed protein product
Length=219

 Score = 26.2 bits (56),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 40/77 (52%), Gaps = 6/77 (8%)

Query  20   LSDQRFSILRARVVLVSVQ---IFDRGNKKIVQVLQSKSPSVLLTLAGVNTD-SDLHAIE  75
            L+   +   +A +V+  +Q    F R    + ++ +  SP++++ LAG   D S++  +E
Sbjct  94   LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVE  153

Query  76   ATFKGIEKFKVDNQILF  92
              F   +++  +N +LF
Sbjct  154  --FDEAKQYAEENGLLF  168



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02330.1.1 histone

Length=196
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCB8_DROME  unnamed protein product                                 31.2    0.33 
A1Z951_DROME  unnamed protein product                                 30.4    0.50 
F0JAQ8_DROME  unnamed protein product                                 30.4    0.51 


>Q9VCB8_DROME unnamed protein product
Length=1122

 Score = 31.2 bits (69),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 56/111 (50%), Gaps = 23/111 (21%)

Query  85   GQDVGKMLKEMAK--KWDGFEKKVSKKLDDFEANLNFYGEKVEQSCTTLKNLEQKLIAME  142
            GQ   +  K M K  +   F+ +   + D  +++L   GEK+E+     + L++KL++++
Sbjct  765  GQHQSRNQKAMQKIMELQNFDYQELPEYDRLKSHLADSGEKIEKCRLEREMLQEKLLSIQ  824

Query  143  KR---IDKTETENR------------------ELKTRLRTLEIQIQENTQK  172
             R   ++ TE E R                  E+++++R+L++  +ENT++
Sbjct  825  HRQTELESTEAEERRALEGINKKLTALDTEAGEVESKMRSLDLHYEENTRR  875


>A1Z951_DROME unnamed protein product
Length=639

 Score = 30.4 bits (67),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 0/62 (0%)

Query  102  FEKKVSKKLDDFEANLNFYGEKVEQSCTTLKNLEQKLIAMEKRIDKTETENRELKTRLRT  161
            FEK++ +++++    +     K  Q+C   K L+ +    E  +   + ENR L TR+R 
Sbjct  86   FEKELREQIENMNRIMKSKERKQMQTCRDHKALQTRFARQESLLQSMQQENRSLLTRIRQ  145

Query  162  LE  163
             E
Sbjct  146  YE  147


>F0JAQ8_DROME unnamed protein product
Length=662

 Score = 30.4 bits (67),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 0/62 (0%)

Query  102  FEKKVSKKLDDFEANLNFYGEKVEQSCTTLKNLEQKLIAMEKRIDKTETENRELKTRLRT  161
            FEK++ +++++    +     K  Q+C   K L+ +    E  +   + ENR L TR+R 
Sbjct  109  FEKELREQIENMNRIMKSKERKQMQTCRDHKALQTRFARQESLLQSMQQENRSLLTRIRQ  168

Query  162  LE  163
             E
Sbjct  169  YE  170



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02340.1.1 Unknown

Length=178


***** No hits found *****



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02350.1.1 E3

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0D7_DROME  unnamed protein product                                 56.6    8e-10
Q9VSK2_DROME  unnamed protein product                                 48.5    7e-07
P91683_DROME  unnamed protein product                                 47.0    2e-06


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 56.6 bits (135),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 3/51 (6%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVI  87
            C +C +   D+ ++ CGH+FCW CL +WLE    R  CP+C+ ++ K +VI
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVI  293


>Q9VSK2_DROME unnamed protein product
Length=878

 Score = 48.5 bits (114),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 31/66 (47%), Gaps = 6/66 (9%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVIPVYGRGGSE  96
            C IC +  KD  I  CGHL C PCL  W +     Q CP C+A I   + I V       
Sbjct  369  CKICAENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEIKGTEQIVV-----DA  422

Query  97   IDPRDE  102
             DPR +
Sbjct  423  FDPRKQ  428


>P91683_DROME unnamed protein product
Length=448

 Score = 47.0 bits (110),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 32/75 (43%), Gaps = 12/75 (16%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVIPVYGRGGSE  96
            C IC +  KD  I  CGHL C PCL  W +     Q CP C+A I            G+E
Sbjct  369  CKICAENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEIK-----------GTE  416

Query  97   IDPRDEVPPRPQGQR  111
                D   PR Q  R
Sbjct  417  QIVVDAFDPRKQHNR  431



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02350.1.2 E3

Length=247
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0D7_DROME  unnamed protein product                                 55.5    4e-09
Q9VSK2_DROME  unnamed protein product                                 47.8    3e-06
P91683_DROME  unnamed protein product                                 46.6    4e-06


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 55.5 bits (132),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 3/51 (6%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVI  87
            C +C +   D+ ++ CGH+FCW CL +WLE    R  CP+C+ ++ K +VI
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVI  293


>Q9VSK2_DROME unnamed protein product
Length=878

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 31/66 (47%), Gaps = 6/66 (9%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVIPVYGRGGSE  96
            C IC +  KD  I  CGHL C PCL  W +     Q CP C+A I   + I V       
Sbjct  369  CKICAENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEIKGTEQIVV-----DA  422

Query  97   IDPRDE  102
             DPR +
Sbjct  423  FDPRKQ  428


>P91683_DROME unnamed protein product
Length=448

 Score = 46.6 bits (109),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 32/75 (43%), Gaps = 12/75 (16%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVIPVYGRGGSE  96
            C IC +  KD  I  CGHL C PCL  W +     Q CP C+A I            G+E
Sbjct  369  CKICAENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEI-----------KGTE  416

Query  97   IDPRDEVPPRPQGQR  111
                D   PR Q  R
Sbjct  417  QIVVDAFDPRKQHNR  431



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02360.1.1 dentin

Length=261
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED15_DROME  unnamed protein product                                  27.7    6.7  
X2J957_DROME  unnamed protein product                                 27.3    7.5  
Q9VJ24_DROME  unnamed protein product                                 27.3    8.1  


>MED15_DROME unnamed protein product
Length=749

 Score = 27.7 bits (60),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 24/43 (56%), Gaps = 6/43 (14%)

Query  108  NITRSFTVHRPKIRERKTTFESKEEYLLG------DTKWKLCL  144
            +IT      RP++ E+ T+FE +  ++L       DTK+K+ L
Sbjct  598  DITAPVPAKRPRVEEKSTSFEQEVPHVLQGEIARLDTKFKVKL  640


>X2J957_DROME unnamed protein product
Length=560

 Score = 27.3 bits (59),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 6/44 (14%)

Query  128  ESKEEYLLGDTKWKLCLSRKRVPDVARYWVMYIKCSSDVKKDLE  171
            E +++ LLG+ + K C S +R+  V R       CS+ +  DLE
Sbjct  212  ECQQDVLLGEQEDKYCFSFRRLSRVVR------GCSTKIPTDLE  249


>Q9VJ24_DROME unnamed protein product
Length=561

 Score = 27.3 bits (59),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 6/44 (14%)

Query  128  ESKEEYLLGDTKWKLCLSRKRVPDVARYWVMYIKCSSDVKKDLE  171
            E +++ LLG+ + K C S +R+  V R       CS+ +  DLE
Sbjct  213  ECQQDVLLGEQEDKYCFSFRRLSRVVR------GCSTKIPTDLE  250



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02370.1.1 Unknown

Length=193
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JW07_DROME  unnamed protein product                                 28.9    1.4  
Q1EC11_DROME  unnamed protein product                                 26.6    8.4  


>Q7JW07_DROME unnamed protein product
Length=231

 Score = 28.9 bits (63),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  15   GGQKASLHTFGPASGRRSIPVIVPCIMGEE  44
            GGQ  S  T+GP +  R + V + C+  EE
Sbjct  158  GGQSVSFVTYGPFNRNRIMTVPLKCVSAEE  187


>Q1EC11_DROME unnamed protein product
Length=364

 Score = 26.6 bits (57),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 34/78 (44%), Gaps = 0/78 (0%)

Query  23   TFGPASGRRSIPVIVPCIMGEELPIDAELVNKGLSAISIKHKLKPDDAGLSAKGSKDHVI  82
            T   AS   S+ + +  +    LP      N+ ++   +KH+L+PD+       + D  I
Sbjct  205  TLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPI  264

Query  83   KCTISFTKKSSHGLIKQR  100
             C      +S+  +I +R
Sbjct  265  DCDWDLAHESTANVICRR  282



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02380.1.1 E3

Length=239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0D7_DROME  unnamed protein product                                 57.4    8e-10
Q9VSK2_DROME  unnamed protein product                                 48.1    2e-06
P91683_DROME  unnamed protein product                                 47.0    3e-06


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 57.4 bits (137),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 3/51 (6%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVI  87
            C +C +   D+ ++ CGH+FCW CL +WLE    R  CP+C+ ++ K +VI
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVI  293


>Q9VSK2_DROME unnamed protein product
Length=878

 Score = 48.1 bits (113),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 31/66 (47%), Gaps = 6/66 (9%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVIPVYGRGGSE  96
            C IC +  KD  I  CGHL C PCL  W +     Q CP C+A I   + I V       
Sbjct  369  CKICAENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEIKGTEQIVV-----DA  422

Query  97   IDPRDE  102
             DPR +
Sbjct  423  FDPRKQ  428


>P91683_DROME unnamed protein product
Length=448

 Score = 47.0 bits (110),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 32/75 (43%), Gaps = 12/75 (16%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVIPVYGRGGSE  96
            C IC +  KD  I  CGHL C PCL  W +     Q CP C+A I            G+E
Sbjct  369  CKICAENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEI-----------KGTE  416

Query  97   IDPRDEVPPRPQGQR  111
                D   PR Q  R
Sbjct  417  QIVVDAFDPRKQHNR  431



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02390.1.1 Nephrin

Length=101
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KIB0_DROME  unnamed protein product                                 77.0    4e-18
Q59DZ1_DROME  unnamed protein product                                 71.2    6e-16
Q9VFU7_DROME  unnamed protein product                                 55.5    2e-10


>Q0KIB0_DROME unnamed protein product
Length=1689

 Score = 77.0 bits (188),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 0/95 (0%)

Query  2    SVQIVNKPIRLVANQEHTFICHVAGSRPSPQVTWWSDSKSFNRGKIDEHSNETLTVSKLR  61
            SV + NK     +N ++   C VAGS P  ++ W  +++ F RG +    +    +S L 
Sbjct  278  SVNLTNKLKVFASNTQYNLTCIVAGSVPDTEIKWTQNNRPFKRGLLSTSQSNGRVISTLT  337

Query  62   FMPTPDDDSRSLKCRGENPVLQDASLEDTVSLNVV  96
            F P P+DD   LKC G NP LQ++++ED++ +NV+
Sbjct  338  FYPQPEDDGTMLKCEGSNPRLQNSAIEDSLMMNVI  372


 Score = 30.0 bits (66),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (54%), Gaps = 0/26 (0%)

Query  20   FICHVAGSRPSPQVTWWSDSKSFNRG  45
              C V G RP P VTW + +++   G
Sbjct  198  LTCEVRGGRPEPTVTWMNGTRTLEAG  223


>Q59DZ1_DROME unnamed protein product
Length=1064

 Score = 71.2 bits (173),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 2/96 (2%)

Query  1    LSVQIVNKPIRLVANQEHTFICHVAGSRPSPQVTWWSDSKSFNRGKIDEHSNETLTVSKL  60
            L V+I+  P  ++A++ +   C  +GSRP+  +TW+   +   R K D   N T   S+L
Sbjct  271  LVVKILEPPSSMIADRRYEVSCESSGSRPNAIITWYKGKRQLRRTKDDISKNSTR--SEL  328

Query  61   RFMPTPDDDSRSLKCRGENPVLQDASLEDTVSLNVV  96
             F+PT DDD +S+ CR ENP +    LE    LNVV
Sbjct  329  SFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVV  364


 Score = 26.6 bits (57),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 9/14 (64%), Gaps = 0/14 (0%)

Query  22   CHVAGSRPSPQVTW  35
            C V G RP PQV W
Sbjct  195  CRVVGGRPQPQVRW  208


>Q9VFU7_DROME unnamed protein product
Length=1001

 Score = 55.5 bits (132),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 50/91 (55%), Gaps = 4/91 (4%)

Query  1    LSVQIVNKPIRLVANQEHTFICHVAGSRPSPQVTWWSDSKSFNR--GKIDEHSNETLTVS  58
            ++V I+ K   + A++ +   C  +GS+P   +TWW  SK   +     +E  N++L++ 
Sbjct  298  IAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSLSI-  356

Query  59   KLRFMPTPDDDSRSLKCRGENPVLQDASLED  89
             L F P  +DD + L CR EN  +  +++ED
Sbjct  357  -LTFTPGREDDGKYLTCRAENQFIDGSAIED  386


 Score = 30.4 bits (67),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  22   CHVAGSRPSPQVTWWSDSKSFN  43
            C V+G RP P VTW+ D+ + +
Sbjct  222  CEVSGGRPRPNVTWYLDNTAID  243



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02400.1.1 RNA-directed

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RTXE_DROME  unnamed protein product                                   92.0    1e-21
RTBS_DROME  unnamed protein product                                   80.1    1e-17
KPYK_DROME  unnamed protein product                                   31.2    0.34 


>RTXE_DROME unnamed protein product
Length=908

 Score = 92.0 bits (227),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 87/162 (54%), Gaps = 5/162 (3%)

Query  28   VPPFTLEDLVEVSAKMKSKKAPGPDSILPEIVKSAVMAVPEWVLAVMNKILLNGDFPSMW  87
            + PF   ++ EV  +  + KAPG D I    +K+       ++  V N I+    FP  W
Sbjct  433  ITPFEPCEVAEVIVRQSNNKAPGHDVICNATLKALPRQAILYITLVFNAIVRLQYFPYQW  492

Query  88   KRAKVVLLPKPGKPAFQPSSYRPLCLLDTFSKLLEGLLIRRMMEELGERGLS-ESQFGFR  146
            K   + ++ KPGKP  +P+SYRP+ LL + SK+ E L+  R++  +  +G++ E QFGFR
Sbjct  493  KLGIISMIHKPGKPEREPASYRPISLLPSISKVFERLIAVRIVSIMEAQGITPEHQFGFR  552

Query  147  PQRSTVDAIQRVFSIADEERKKSRRRRGFCLLVTLDVRNAFN  188
                TV+ + RV     E+   +   + +C  + LD+R AF+
Sbjct  553  AGHCTVEQLHRVV----EQILTAYDSKEYCNSLFLDIREAFD  590


>RTBS_DROME unnamed protein product
Length=906

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 55/169 (33%), Positives = 92/169 (54%), Gaps = 5/169 (3%)

Query  21   PDVTSDSVPPFTLEDLVEVSAKMKSKKAPGPDSILPEIVKSAVMAVPEWVLAVMNKILLN  80
            P   S  + P  +E++VE    +  KK+PG D++    +K+  +    ++  + N IL  
Sbjct  427  PLQMSLPIKPIRVEEIVEAIKSLPLKKSPGIDNVCNATLKALPVRAILYLALIYNAILRV  486

Query  81   GDFPSMWKRAKVVLLPKPGKPAFQPSSYRPLCLLDTFSKLLEGLLIRRMMEELGERG-LS  139
              FP  WK A ++++ KPGKP   P SYRP+ LL + SKL E L+  R+ + + ER  L 
Sbjct  487  QFFPKQWKMAAILMIHKPGKPEESPESYRPISLLSSLSKLWERLIANRLNDIMTERRILP  546

Query  140  ESQFGFRPQRSTVDAIQRVFSIADEERKKSRRRRGFCLLVTLDVRNAFN  188
            + QFGFR   STV+ + R+     +   ++   + +C  V +D++ AF+
Sbjct  547  DHQFGFRQGHSTVEQVHRL----TKHILQAFDDKEYCNAVFIDMQQAFD  591


>KPYK_DROME unnamed protein product
Length=533

 Score = 31.2 bits (69),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  88   KRAKVVLLPKPGKPAFQPSSYRPLC  112
            K + +V++   GK AFQ S YRP C
Sbjct  426  KASAIVVITTSGKSAFQVSKYRPRC  450



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


Query= Dcitr00g02410.1.1 Organic

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CART_DROME  unnamed protein product                                   332     3e-103
Q961J5_DROME  unnamed protein product                                 271     2e-81 
OCTL_DROME  unnamed protein product                                   270     3e-81 


>CART_DROME unnamed protein product
Length=674

 Score = 332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 201/611 (33%), Positives = 317/611 (52%), Gaps = 28/611 (5%)

Query  177  IETDLDFDDILPHLGEFGRYQKILFFAM-IPFAFSVAFVYFAQIFITVIPERYWCQVPEL  235
            ++   D DD+LP +GEFG+YQK+L F + +P      F  F Q+F+   P+ YWC++PEL
Sbjct  30   VDEAFDLDDLLPTIGEFGKYQKLLVFGICLPACIPCGFCAFNQLFMADTPDDYWCRIPEL  89

Query  236  SHLDPEQRRLLSIPRKGS----TFDSCSMYAVNFTSLIAAG------ITEADPSWPISEC  285
              L  EQR+ LSIP++       +  C  Y VN+T L+ +G        E + SWP+ +C
Sbjct  90   LDLPLEQRKSLSIPKELDNDELVYSKCYTYGVNWTQLLESGEEDDLTTMEPNASWPLIKC  149

Query  286  QHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPA  345
              GWEY  T V ++SI  + + VC QD  PT+  A    G  VG  +FG + D  GR  +
Sbjct  150  PQGWEYN-TSVVWSSIVIDFDLVCDQDIYPTIGLAALNTGGPVGVYLFGLLNDRGGRRLS  208

Query  346  LVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVAN  405
                  T     + T+ +  FW +A  R  VGL     + + +I+ LE VG ++R+FV  
Sbjct  209  YFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTIPAVYQIPFIISLELVGENYRSFVTV  268

Query  406  MSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDE  465
            M+   F+T    LL  + Y   +W  L  ITSLP     +  +++PES RWL+ +GR++E
Sbjct  269  MT-CTFYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEE  327

Query  466  AVVIMKRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSV--LDLFRTPRLRNITCL  523
            A+ I++R  K+N ++    ++ +L+   +R   ++   K  +V   DL RTP +R  T L
Sbjct  328  ALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRTPNMRLKTIL  387

Query  524  LIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGT  583
            + + W A   V+ G       LG + +++F L++  ELP+     + +D WGRRW    +
Sbjct  388  ITLSWFANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSLS  447

Query  584  MVFSGVFSLLSSSVETGKLSAGLAI--IGRFLVNISYNTGLQYAAEVLPTVVRAQGVALI  641
            M+  GV  +++  +    +   L +  + + L++ S+     +A E+ PT VR  G+   
Sbjct  448  MILGGVACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPTQVRGIGIGAS  507

Query  642  HIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGEN  701
              +G +  I  PFI YL   N KLPL+I+G + +LGG   L LPETL   LPQT+++GE 
Sbjct  508  SYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGMTGLRLPETLHHRLPQTIEEGEE  567

Query  702  FGRDQKFLDFPCCGKKSDKEEEEKPESYFKRGHKTRGANSSTRSSMRASLRGEQFRSSLI  761
            FG++ +F D  CC      E   +P SY          +S+  S +   LR         
Sbjct  568  FGKNWQFKD--CCRCAQKPEILSQPASY--ENLDVLAGSSTNASEVELELRDS-------  616

Query  762  QRTQRPFQKTD  772
            +R + P  + D
Sbjct  617  RRVREPAPRID  627


>Q961J5_DROME unnamed protein product
Length=604

 Score = 271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 186/576 (32%), Positives = 299/576 (52%), Gaps = 33/576 (6%)

Query  181  LDFDDILPHLGEFGRYQKILFFA-MIPFAFSVAFVYFAQIFITVIPERYWCQVPELSHLD  239
            +DFD++L  +G FG YQK++  + ++P A   AF  ++Q+FI   P+ + C+VPEL    
Sbjct  1    MDFDEVLREVGSFGLYQKVIICSVLLPAALPCAFHAYSQLFIAATPQHF-CRVPELEPWT  59

Query  240  PEQRRL---LSIPR-KGSTFDSCSMYAVNFTSLI---------------AAGITEADP-S  279
             +  +L   LSIPR +   +  CSMY+ N+T ++               A  + +  P +
Sbjct  60   QDYVQLVKNLSIPRNRNGAYAECSMYSRNYTDIVRYLEYRPPPDLLRQQAEDLLKLQPDT  119

Query  280  WPISECQHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADH  339
              +  CQHGW Y+   +  +++  E N VC +  L TLA  +F  G ++G  VFG++ D 
Sbjct  120  TQVVPCQHGWHYD-KSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLVDL  178

Query  340  FGRIPALVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSW  399
            +GR P+     L   +A  A+AFA  ++ +   RF VGL         Y+L +E VGP  
Sbjct  179  WGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGPER  238

Query  400  RTFVANMSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVS  459
            R F   +S  I ++L   +L  + Y V +W+ L +  S+PLL+     +++PES RWL++
Sbjct  239  RVFCTIVS-NIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWLMA  297

Query  460  QGRVDEAVVIMKRFEKINNKKVDPKLYQQL--KETCQRQAKQEID-GKRYSVLDLFRTPR  516
             G+   A+ I+K   ++N  +V+    ++L  K    R A+ +      Y +LDLFR P 
Sbjct  298  VGKTRRAIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRGPN  357

Query  517  LRNITCLLIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGR  576
            +R  T ++ +IW A + V+ G       LG D    F LA A ELP   +L   L  +GR
Sbjct  358  MRRKTLIITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLSYFGR  417

Query  577  RWYACGTMVFSGVFSLLSSSVETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQ  636
            RW    +M+  GV  +  ++     ++  L  +G+  ++ S+      A+E+ PTVVR  
Sbjct  418  RWILFISMLVGGVACV--ATFLYPDITLLLYCVGKMGISSSFVVLPLMASELYPTVVRGL  475

Query  637  GVALIHIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTL  696
            G++   ++  V  IV P I ++      LPLI++G + ILGG   L LPET  ++LPQTL
Sbjct  476  GMSFSSVISMVGPIVIPMINHMGQQMLVLPLIVMGALLILGGFASLLLPETRNRNLPQTL  535

Query  697  QDGENFGRDQKFLDFPCCGKKSDKEEEEKPESYFKR  732
            ++GE       FL   CC  +S+++      S  KR
Sbjct  536  EEGE--AVPLSFLL--CCCVESERKPNNIRASPKKR  567


>OCTL_DROME unnamed protein product
Length=567

 Score = 270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 174/545 (32%), Positives = 287/545 (53%), Gaps = 31/545 (6%)

Query  181  LDFDDILPHLGEFGRYQKILFFAMIPFAFSVAFVYFAQIFITVIPERYWCQVP---ELSH  237
            + +D+ + HLG+FGRYQKI++F +   +  VAF   A +F+   P+ + C +P     S+
Sbjct  1    MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPD-FRCALPFENGSSY  59

Query  238  LDPEQRRLLSIPRKGSTFDSCSMYAVNFTSLIAAGITEADPSWPIS--ECQHGWEYEFTD  295
              P     LS P      + CS Y V++T     G      S P S  E +    Y +  
Sbjct  60   DLPTHLWNLSYPEN----ERCSYYDVDYTEEYLNG------SIPRSSNETKTCSSYVYDR  109

Query  296  VPY-TSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPALVGTNLTGF  354
              Y  S  TE N VC +D +   + ++F  G ++G +VFG ++D +GR P L  + +   
Sbjct  110  SKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQV  169

Query  355  VAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVANMSIAIFFTL  414
            + GV    A  ++ +   R  VG      F + Y++ +E VGP  R + A + + +FF++
Sbjct  170  LFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLY-AGIFVMMFFSV  228

Query  415  AASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIMKRFE  474
               L    AY+V +W++L +  +LP L+ +   WI+PESARWL+ +GR D A+  M++  
Sbjct  229  GFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAA  288

Query  475  KINNKKVDPKLYQQL---KETCQRQAKQEID------GKRYSVLDLFRTPRLRNITCLLI  525
            + N  ++  +   +L    E  + +AKQ+++      G   SV DLF  P LR  T L+ 
Sbjct  289  RFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIF  348

Query  526  VIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMV  585
            + W+  S V+ G      NLG ++ + F ++ A E+PA   L  TL+ WGRR   CG +V
Sbjct  349  LDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLV  408

Query  586  FSGVFSLLSSSV---ETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIH  642
             +G+ SLL++ +       L    A++G+  +  SY T   ++AE  PTVVR   +    
Sbjct  409  MAGL-SLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFSAEQFPTVVRNVALGAAS  467

Query  643  IMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENF  702
            ++  ++ +++PF+ +LA I   LPL+I G + ++ G L L LPET  + + +T+ DGE F
Sbjct  468  MVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLETIADGERF  527

Query  703  GRDQK  707
            G+  K
Sbjct  528  GKKTK  532



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 355846672


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g02420.1.1 Organic

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CART_DROME  unnamed protein product                                   180     4e-51
OCTL_DROME  unnamed protein product                                   178     7e-51
Q961J5_DROME  unnamed protein product                                 149     6e-40


>CART_DROME unnamed protein product
Length=674

 Score = 180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 187/366 (51%), Gaps = 15/366 (4%)

Query  6    FFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIM  65
            F+T    LL  + Y   +W  L  ITSLP     +  +++PES RWL+ +GR++EA+ I+
Sbjct  273  FYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEEALKIL  332

Query  66   KRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSV--LDLFRTPRLRNITCLLIVIW  123
            +R  K+N ++    ++ +L+   +R   ++   K  +V   DL RTP +R  T L+ + W
Sbjct  333  ERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRTPNMRLKTILITLSW  392

Query  124  MAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMVFSG  183
             A   V+ G       LG + +++F L++  ELP+     + +D WGRRW    +M+  G
Sbjct  393  FANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSLSMILGG  452

Query  184  VFSLLSSSVETGKLSAGLAI--IGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIHIMGY  241
            V  +++  +    +   L +  + + L++ S+     +A E+ PT VR  G+     +G 
Sbjct  453  VACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPTQVRGIGIGASSYIGG  512

Query  242  VASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENFGRNQ  301
            +  I  PFI YL   N KLPL+I+G + +LGG   L LPETL   LPQT+++GE FG+N 
Sbjct  513  LGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGMTGLRLPETLHHRLPQTIEEGEEFGKNW  572

Query  302  KFLDFPCCGKKSDKEEEEKPESYFKRGHKTRGANSSTRSSMRASLRGEQFRSSLIQRTQR  361
            +F D  CC      E   +P SY          +S+  S +   LR         +R + 
Sbjct  573  QFKD--CCRCAQKPEILSQPASY--ENLDVLAGSSTNASEVELELRDS-------RRVRE  621

Query  362  PFQKTD  367
            P  + D
Sbjct  622  PAPRID  627


>OCTL_DROME unnamed protein product
Length=567

 Score = 178 bits (451),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 105/312 (34%), Positives = 175/312 (56%), Gaps = 13/312 (4%)

Query  3    IAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAV  62
            + +FF++   L    AY+V +W++L +  +LP L+ +   WI+PESARWL+ +GR D A+
Sbjct  222  VMMFFSVGFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAI  281

Query  63   VIMKRFEKINNKKVDPKLYQQL---KETCQRQAKQEID------GKRYSVLDLFRTPRLR  113
              M++  + N  ++  +   +L    E  + +AKQ+++      G   SV DLF  P LR
Sbjct  282  ANMQKAARFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLR  341

Query  114  NITCLLIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRW  173
              T L+ + W+  S V+ G      NLG ++ + F ++ A E+PA   L  TL+ WGRR 
Sbjct  342  RKTLLIFLDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRS  401

Query  174  YACGTMVFSGVFSLLSSSV---ETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRA  230
              CG +V +G+ SLL++ +       L    A++G+  +  SY T   ++AE  PTVVR 
Sbjct  402  ILCGCLVMAGL-SLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFSAEQFPTVVRN  460

Query  231  QGVALIHIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQT  290
              +    ++  ++ +++PF+ +LA I   LPL+I G + ++ G L L LPET  + + +T
Sbjct  461  VALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLET  520

Query  291  LQDGENFGRNQK  302
            + DGE FG+  K
Sbjct  521  IADGERFGKKTK  532


>Q961J5_DROME unnamed protein product
Length=604

 Score = 149 bits (375),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 105/326 (32%), Positives = 171/326 (52%), Gaps = 9/326 (3%)

Query  5    IFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVI  64
            I ++L   +L  + Y V +W+ L +  S+PLL+     +++PES RWL++ G+   A+ I
Sbjct  248  IAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWLMAVGKTRRAIKI  307

Query  65   MKRFEKINNKKVDPKLYQQL--KETCQRQAKQEID-GKRYSVLDLFRTPRLRNITCLLIV  121
            +K   ++N  +V+    ++L  K    R A+ +      Y +LDLFR P +R  T ++ +
Sbjct  308  LKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRGPNMRRKTLIITL  367

Query  122  IWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMVF  181
            IW A + V+ G       LG D    F LA A ELP   +L   L  +GRRW    +M+ 
Sbjct  368  IWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLSYFGRRWILFISMLV  427

Query  182  SGVFSLLSSSVETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIHIMGY  241
             GV  +  ++     ++  L  +G+  ++ S+      A+E+ PTVVR  G++   ++  
Sbjct  428  GGVACV--ATFLYPDITLLLYCVGKMGISSSFVVLPLMASELYPTVVRGLGMSFSSVISM  485

Query  242  VASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENFGRNQ  301
            V  IV P I ++      LPLI++G + ILGG   L LPET  ++LPQTL++GE    + 
Sbjct  486  VGPIVIPMINHMGQQMLVLPLIVMGALLILGGFASLLLPETRNRNLPQTLEEGEAVPLS-  544

Query  302  KFLDFPCCGKKSDKEEEEKPESYFKR  327
             FL   CC  +S+++      S  KR
Sbjct  545  -FLL--CCCVESERKPNNIRASPKKR  567



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02430.1.1 Organic

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CART_DROME  unnamed protein product                                   322     8e-100
OCTL_DROME  unnamed protein product                                   269     9e-81 
Q961J5_DROME  unnamed protein product                                 266     2e-79 


>CART_DROME unnamed protein product
Length=674

 Score = 322 bits (826),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 198/611 (32%), Positives = 313/611 (51%), Gaps = 27/611 (4%)

Query  177  IETDLDFDDILPHLGEFGRYQKILFFAM-IPFAFSVAFVYFAQIFITVIPERYWCQVPEL  235
            ++   D DD+LP +GEFG+YQK+L F + +P      F  F Q+F+   P+ YWC++PEL
Sbjct  30   VDEAFDLDDLLPTIGEFGKYQKLLVFGICLPACIPCGFCAFNQLFMADTPDDYWCRIPEL  89

Query  236  SHLDPEQRLATPIYSRKGS---TFDSCSMYAVNFTSLIAAG------ITEADPSWPISEC  286
              L  EQR +  I     +    +  C  Y VN+T L+ +G        E + SWP+ +C
Sbjct  90   LDLPLEQRKSLSIPKELDNDELVYSKCYTYGVNWTQLLESGEEDDLTTMEPNASWPLIKC  149

Query  287  QHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPA  346
              GWEY  T V ++SI  + + VC QD  PT+  A    G  VG  +FG + D  GR  +
Sbjct  150  PQGWEYN-TSVVWSSIVIDFDLVCDQDIYPTIGLAALNTGGPVGVYLFGLLNDRGGRRLS  208

Query  347  LVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVAN  406
                  T     + T+ +  FW +A  R  VGL     + + +I+ LE VG ++R+FV  
Sbjct  209  YFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTIPAVYQIPFIISLELVGENYRSFVTV  268

Query  407  MSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDE  466
            M+   F+T    LL  + Y   +W  L  ITSLP     +  +++PES RWL+ +GR++E
Sbjct  269  MT-CTFYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEE  327

Query  467  AVVIMKRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSV--LDLFRTPRLRNITCL  524
            A+ I++R  K+N ++    ++ +L+   +R   ++   K  +V   DL RTP +R  T L
Sbjct  328  ALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRTPNMRLKTIL  387

Query  525  LIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGT  584
            + + W A   V+ G       LG + +++F L++  ELP+     + +D WGRRW    +
Sbjct  388  ITLSWFANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSLS  447

Query  585  MVFSGVFSLLSSSVETGKLSAGLAI--IGRFLVNISYNTGLQYAAEVLPTVVRAQGVALI  642
            M+  GV  +++  +    +   L +  + + L++ S+     +A E+ PT VR  G+   
Sbjct  448  MILGGVACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPTQVRGIGIGAS  507

Query  643  HIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGEN  702
              +G +  I  PFI YL   N KLPL+I+G + +LGG   L LPETL   LPQT+++GE 
Sbjct  508  SYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGMTGLRLPETLHHRLPQTIEEGEE  567

Query  703  FGRDQKFLDFPCCGKKSDKEEEEKPESYFKRGHKTRGANSSTRSSMRASLRGEQFRSSLI  762
            FG++ +F D  CC      E   +P SY          +S+  S +   LR         
Sbjct  568  FGKNWQFKD--CCRCAQKPEILSQPASY--ENLDVLAGSSTNASEVELELRDS-------  616

Query  763  QRTQRPFQKTD  773
            +R + P  + D
Sbjct  617  RRVREPAPRID  627


>OCTL_DROME unnamed protein product
Length=567

 Score = 269 bits (687),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 171/543 (31%), Positives = 287/543 (53%), Gaps = 26/543 (5%)

Query  181  LDFDDILPHLGEFGRYQKILFFAMIPFAFSVAFVYFAQIFITVIPERYWCQVPELSHLDP  240
            + +D+ + HLG+FGRYQKI++F +   +  VAF   A +F+   P+ + C +P  +    
Sbjct  1    MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPD-FRCALPFEN--GS  57

Query  241  EQRLATPIYSRKGSTFDSCSMYAVNFTSLIAAGITEADPSWPIS--ECQHGWEYEFTDVP  298
               L T +++      + CS Y V++T     G      S P S  E +    Y +    
Sbjct  58   SYDLPTHLWNLSYPENERCSYYDVDYTEEYLNG------SIPRSSNETKTCSSYVYDRSK  111

Query  299  Y-TSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPALVGTNLTGFVA  357
            Y  S  TE N VC +D +   + ++F  G ++G +VFG ++D +GR P L  + +   + 
Sbjct  112  YLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQVLF  171

Query  358  GVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVANMSIAIFFTLAA  417
            GV    A  ++ +   R  VG      F + Y++ +E VGP  R + A + + +FF++  
Sbjct  172  GVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLY-AGIFVMMFFSVGF  230

Query  418  SLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIMKRFEKI  477
             L    AY+V +W++L +  +LP L+ +   WI+PESARWL+ +GR D A+  M++  + 
Sbjct  231  MLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARF  290

Query  478  NNKKVDPKLYQQL---KETCQRQAKQEID------GKRYSVLDLFRTPRLRNITCLLIVI  528
            N  ++  +   +L    E  + +AKQ+++      G   SV DLF  P LR  T L+ + 
Sbjct  291  NKVEISDEALSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFLD  350

Query  529  WMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMVFS  588
            W+  S V+ G      NLG ++ + F ++ A E+PA   L  TL+ WGRR   CG +V +
Sbjct  351  WLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMA  410

Query  589  GVFSLLSSSV---ETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIHIM  645
            G+ SLL++ +       L    A++G+  +  SY T   ++AE  PTVVR   +    ++
Sbjct  411  GL-SLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFSAEQFPTVVRNVALGAASMV  469

Query  646  GYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENFGR  705
              ++ +++PF+ +LA I   LPL+I G + ++ G L L LPET  + + +T+ DGE FG+
Sbjct  470  ARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLETIADGERFGK  529

Query  706  DQK  708
              K
Sbjct  530  KTK  532


>Q961J5_DROME unnamed protein product
Length=604

 Score = 266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 182/578 (31%), Positives = 297/578 (51%), Gaps = 36/578 (6%)

Query  181  LDFDDILPHLGEFGRYQKILFFA-MIPFAFSVAFVYFAQIFITVIPERYWCQVPELS---  236
            +DFD++L  +G FG YQK++  + ++P A   AF  ++Q+FI   P+ + C+VPEL    
Sbjct  1    MDFDEVLREVGSFGLYQKVIICSVLLPAALPCAFHAYSQLFIAATPQHF-CRVPELEPWT  59

Query  237  --HLDPEQRLATPIYSRKGSTFDSCSMYAVNFTSLI---------------AAGITEADP  279
              ++   + L+ P    +   +  CSMY+ N+T ++               A  + +  P
Sbjct  60   QDYVQLVKNLSIP--RNRNGAYAECSMYSRNYTDIVRYLEYRPPPDLLRQQAEDLLKLQP  117

Query  280  -SWPISECQHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVA  338
             +  +  CQHGW Y+   +  +++  E N VC +  L TLA  +F  G ++G  VFG++ 
Sbjct  118  DTTQVVPCQHGWHYD-KSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLV  176

Query  339  DHFGRIPALVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGP  398
            D +GR P+     L   +A  A+AFA  ++ +   RF VGL         Y+L +E VGP
Sbjct  177  DLWGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGP  236

Query  399  SWRTFVANMSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWL  458
              R F   +S  I ++L   +L  + Y V +W+ L +  S+PLL+     +++PES RWL
Sbjct  237  ERRVFCTIVS-NIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWL  295

Query  459  VSQGRVDEAVVIMKRFEKINNKKVDPKLYQQL--KETCQRQAKQEID-GKRYSVLDLFRT  515
            ++ G+   A+ I+K   ++N  +V+    ++L  K    R A+ +      Y +LDLFR 
Sbjct  296  MAVGKTRRAIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRG  355

Query  516  PRLRNITCLLIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVW  575
            P +R  T ++ +IW A + V+ G       LG D    F LA A ELP   +L   L  +
Sbjct  356  PNMRRKTLIITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLSYF  415

Query  576  GRRWYACGTMVFSGVFSLLSSSVETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVR  635
            GRRW    +M+  GV  +  ++     ++  L  +G+  ++ S+      A+E+ PTVVR
Sbjct  416  GRRWILFISMLVGGVACV--ATFLYPDITLLLYCVGKMGISSSFVVLPLMASELYPTVVR  473

Query  636  AQGVALIHIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQ  695
              G++   ++  V  IV P I ++      LPLI++G + ILGG   L LPET  ++LPQ
Sbjct  474  GLGMSFSSVISMVGPIVIPMINHMGQQMLVLPLIVMGALLILGGFASLLLPETRNRNLPQ  533

Query  696  TLQDGENFGRDQKFLDFPCCGKKSDKEEEEKPESYFKR  733
            TL++GE       FL   CC  +S+++      S  KR
Sbjct  534  TLEEGE--AVPLSFLL--CCCVESERKPNNIRASPKKR  567



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02440.1.1 Tyrosine-protein

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PTP10_DROME  unnamed protein product                                  338     2e-106
Q9W4F5_DROME  unnamed protein product                                 305     4e-95 
Q8IRS0_DROME  unnamed protein product                                 305     4e-95 


>PTP10_DROME unnamed protein product
Length=1990

 Score = 338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 188/232 (81%), Gaps = 1/232 (0%)

Query  29   TNRSFSPLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPP  88
            T+  +   T  +  APDPP+NLSV VRSGK A I WSPP  G Y+ FK+KV+ LSE +  
Sbjct  108  THHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVLGLSEASSS  167

Query  89   RIIGFTENPPA-GYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWF  147
                F  N     +S+K+LTPG +YQVQ +++YD KESVAYTSRNFTTKPNTPGKFIVWF
Sbjct  168  YNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPNTPGKFIVWF  227

Query  148  RNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRA  207
            RNETTLLVLWQP YPA IYTHYKVSI+PPDA +SVLYVEKEGEPPGPAQAAFKGLVPGRA
Sbjct  228  RNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQAAFKGLVPGRA  287

Query  208  YNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKG  259
            YNISVQT+SEDEIS PTTAQYRT+PLRPL+ T+D+  ITSNS RV+WE PKG
Sbjct  288  YNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLWEAPKG  339


 Score = 49.7 bits (117),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 84/196 (43%), Gaps = 14/196 (7%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRI--IGFTENPPAGY  101
            P+PP N+++      +  + WSPP SG+++ + ++  + SE+   R+  +  TE      
Sbjct  583  PNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQQWVRLPSVRSTE-----A  637

Query  102  SLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSY  161
             + D+T G  Y +Q+ +V    ES      N T  PN P   I+   +   + + W    
Sbjct  638  DITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPN-PVSNIIQLVDSRNITLEWPK--  694

Query  162  PASIYTHYKVSIDPPDAPESV----LYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSE  217
            P      Y +   P D P  V    +   K  +     +     L+PG  Y   +QT S 
Sbjct  695  PEGRVESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELMPGVQYKFDIQTTSY  754

Query  218  DEISTPTTAQYRTIPL  233
              +S  T+   RT+PL
Sbjct  755  GILSGITSLYPRTMPL  770


 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  196  QAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWE  255
            +  F GLVPGR YNI+V TVS    S P   Q R  P  P++  +   +IT   + + W+
Sbjct  828  KVTFTGLVPGRLYNITVWTVSGGVASLPIQRQDRLYP-EPITQLH-ATNITDTEISLRWD  885

Query  256  PPKG  259
             PKG
Sbjct  886  LPKG  889


 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 46/212 (22%), Positives = 94/212 (44%), Gaps = 24/212 (11%)

Query  35   PLTSILEKAPDPPTNLSVNVR--SGKTAQIFWSPPIS-GKYSGFKLKVISLSEK-TPPRI  90
            P T+     P  P N++ +    +  + ++ W  P    ++  +++ V +   + T PR 
Sbjct  303  PTTAQYRTVPLRPLNVTFDRDFITSNSFRVLWEAPKGISEFDKYQVSVATTRRQSTVPR-  361

Query  91   IGFTENPPAGYSLKDLT-PGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRN  149
               +  P A +  +D+  PG ++ V + +V     S   T  + T +P  P + +    +
Sbjct  362  ---SNEPVAFFDFRDIAEPGKTFNVIVKTVSGKVTSWPATG-DVTLRP-LPVRNLRSIND  416

Query  150  E--TTLLVLWQPSYPASIYTHYKV---SIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVP  204
            +   T+++ W+   PAS    Y++    ++  +   S L  ++        +   + L+P
Sbjct  417  DKTNTMIITWEAD-PASTQDEYRIVYHELETFNGDTSTLTTDR-------TRFTLESLLP  468

Query  205  GRAYNISVQTVSEDEISTPTTAQYRTIPLRPL  236
            GR Y++SVQ VS+   S  T+    T P  P+
Sbjct  469  GRNYSLSVQAVSKKMESNETSIFVVTRPSSPI  500


 Score = 27.7 bits (60),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 38/160 (24%), Positives = 66/160 (41%), Gaps = 15/160 (9%)

Query  103  LKDLTPGGSYQVQLFSV-YDSK-ESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPS  160
            +K+L PG  Y++++F+V +D + E  AY    +   PN P    +      ++LV W P 
Sbjct  550  IKNLQPGAGYELKVFAVSHDLRSEPHAYFQAVY---PNPPRNMTIETVRSNSVLVHWSPP  606

Query  161  YPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEI  220
                 +T Y +        + V             +A    +  G  Y I V TVS   +
Sbjct  607  ESGE-FTEYSIRYRTDSEQQWVRLPSVRS-----TEADITDMTKGEKYTIQVNTVSFG-V  659

Query  221  STPTTAQYR-TIPLRPLSFTYDKASITSNSLRVVWEPPKG  259
             +P   +   T+P  P+S       + S ++ + W  P+G
Sbjct  660  ESPVPQEVNTTVPPNPVSNII--QLVDSRNITLEWPKPEG  697


>Q9W4F5_DROME unnamed protein product
Length=1767

 Score = 305 bits (782),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 180/233 (77%), Gaps = 1/233 (0%)

Query  29   TNRSFSPLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPP  88
            T+R     T  +  APDPP NLSV +RS K+A I W PP SG+YSGF+++V+ L++    
Sbjct  136  THREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRPPGSGRYSGFRIRVLGLTDLPFE  195

Query  89   RIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFR  148
            R      N     S K+LTPGGSYQVQ +SVY  KESVAYTSRNFTTKPNTPGKFIVWFR
Sbjct  196  RSYSLEGNETLQLSAKELTPGGSYQVQAYSVYQGKESVAYTSRNFTTKPNTPGKFIVWFR  255

Query  149  NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAY  208
            NETTLLVLWQP +PA IYTHY+VSI P DA +SVLYVE+EGEPPGPAQAAFKGLVPGR Y
Sbjct  256  NETTLLVLWQPPFPAGIYTHYRVSITPDDAIQSVLYVEREGEPPGPAQAAFKGLVPGREY  315

Query  209  NISVQTVSEDEIST-PTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGF  260
            NISVQTVSEDE S+ PTTA+Y T+P R L+ T+D+A  TS+S RV WEPP+ +
Sbjct  316  NISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRVRWEPPRTY  368


 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 95/228 (42%), Gaps = 19/228 (8%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPI-SGKYSGFKLKVISLSEKTPPRIIGFTENP-----  97
            P+ P    V  R+  T  + W PP  +G Y+ ++   +S++     + + + E       
Sbjct  244  PNTPGKFIVWFRNETTLLVLWQPPFPAGIYTHYR---VSITPDDAIQSVLYVEREGEPPG  300

Query  98   PAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGK--FIVWFRNETTLLV  155
            PA  + K L PG  Y + + +V + + S   T+  + T P       F   +   ++  V
Sbjct  301  PAQAAFKGLVPGREYNISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRV  360

Query  156  LWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTV  215
             W+P    S +  Y+V +        +  V +              L PGR Y + V+T+
Sbjct  361  RWEPPRTYSEFDAYQVMLS---TSRRIFNVPRAANGDSVYFDYPDILEPGRTYEVVVKTI  417

Query  216  SEDEISTPTTAQ--YRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFR  261
            +++  S P + +   R  P+R L    D     SN+L + WEP +  R
Sbjct  418  ADNVNSWPASGEVTLRPRPVRSLGGFLDD---RSNALHISWEPAETGR  462


 Score = 41.6 bits (96),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 73/192 (38%), Gaps = 8/192 (4%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTP-PRIIGFTENPPAGYS  102
            P PP NL++         + W  P    +S + ++    ++ +P  RI G  EN      
Sbjct  620  PKPPQNLTLQTVHTNLVVLHWQAPEGSDFSEYVVRY--RTDASPWQRISGLHENEA---R  674

Query  103  LKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLW-QPSY  161
            +KD+  G  Y VQ+ +V    ES      N T  P  P   +V   +   L + W +P  
Sbjct  675  IKDMHYGERYLVQVNTVSFGVESPHPLELNVTMPPQ-PVSNVVPLVDSRNLTLEWPRPDG  733

Query  162  PASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEIS  221
                YT      D  D  E     + E       +   + L PGR Y   VQ  S    S
Sbjct  734  HVDFYTLKWWPTDEEDRVEFKNVTQLEDLSSPSVRIPIEDLSPGRQYRFEVQASSNGIRS  793

Query  222  TPTTAQYRTIPL  233
              T    RT+PL
Sbjct  794  GTTHLSTRTMPL  805


 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 79/200 (40%), Gaps = 23/200 (12%)

Query  35    PLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFT  94
             P+  +    P P ++L     + +   + W+ P +G+Y+ F+L+ +S  E+ P  +   T
Sbjct  891   PVQRLYRLHPLPISDLKAIQVAAREITLHWTAP-AGEYTDFELQYLSADEEAPQLLQNVT  949

Query  95    EN---------PPAGYSLKDLTPGGSYQVQLF---SVYDSKESVAYTSRNFTTKPNTPGK  142
             +N         P   Y+   +   GS Q   F   SV     S A  S ++ T    PGK
Sbjct  950   KNTEITLQGLRPYHNYTFTVVVRSGSIQGTDFADVSVSTLMRSSAPISASYQTLTAPPGK  1009

Query  143   FIVWFR------NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQ  196
              + +F+       E T     +P+       +++++    D    V   E    P    Q
Sbjct  1010  -VDYFQPSDVQPGEVTFEWSLEPAEQHGPIDYFRITCQNADDAADVSSYEF---PVNATQ  1065

Query  197   AAFKGLVPGRAYNISVQTVS  216
                 GLVPG  Y   +Q  S
Sbjct  1066  GKIDGLVPGNHYIFRIQAKS  1085


 Score = 36.6 bits (83),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 4/63 (6%)

Query  198  AFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKA-SITSNSLRVVWEP  256
            +F GL PG+ YN++V TVS    S P    YR   L PL  +  KA  + +  + + W  
Sbjct  866  SFSGLTPGKLYNVTVWTVSGGVASLPVQRLYR---LHPLPISDLKAIQVAAREITLHWTA  922

Query  257  PKG  259
            P G
Sbjct  923  PAG  925


 Score = 34.7 bits (78),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 10/153 (7%)

Query  108  PGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPAS-IY  166
            PG  Y   L+    +       + N TT P+ P    V  R+  +  + W+P  P S  Y
Sbjct  122  PGTEYNFWLYYTNSTHREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRP--PGSGRY  179

Query  167  THYKVSI-DPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTP-T  224
            + +++ +    D P    Y  +  E     Q + K L PG +Y +   +V + + S   T
Sbjct  180  SGFRIRVLGLTDLPFERSYSLEGNE---TLQLSAKELTPGGSYQVQAYSVYQGKESVAYT  236

Query  225  TAQYRTIPLRPLSFTYDKASITSNSLRVVWEPP  257
            +  + T P  P  F     + T  +L V+W+PP
Sbjct  237  SRNFTTKPNTPGKFIVWFRNET--TLLVLWQPP  267


>Q8IRS0_DROME unnamed protein product
Length=1607

 Score = 305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 180/233 (77%), Gaps = 1/233 (0%)

Query  29   TNRSFSPLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPP  88
            T+R     T  +  APDPP NLSV +RS K+A I W PP SG+YSGF+++V+ L++    
Sbjct  136  THREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRPPGSGRYSGFRIRVLGLTDLPFE  195

Query  89   RIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFR  148
            R      N     S K+LTPGGSYQVQ +SVY  KESVAYTSRNFTTKPNTPGKFIVWFR
Sbjct  196  RSYSLEGNETLQLSAKELTPGGSYQVQAYSVYQGKESVAYTSRNFTTKPNTPGKFIVWFR  255

Query  149  NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAY  208
            NETTLLVLWQP +PA IYTHY+VSI P DA +SVLYVE+EGEPPGPAQAAFKGLVPGR Y
Sbjct  256  NETTLLVLWQPPFPAGIYTHYRVSITPDDAIQSVLYVEREGEPPGPAQAAFKGLVPGREY  315

Query  209  NISVQTVSEDEIST-PTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGF  260
            NISVQTVSEDE S+ PTTA+Y T+P R L+ T+D+A  TS+S RV WEPP+ +
Sbjct  316  NISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRVRWEPPRTY  368


 Score = 48.1 bits (113),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 95/228 (42%), Gaps = 19/228 (8%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPI-SGKYSGFKLKVISLSEKTPPRIIGFTENP-----  97
            P+ P    V  R+  T  + W PP  +G Y+ ++   +S++     + + + E       
Sbjct  244  PNTPGKFIVWFRNETTLLVLWQPPFPAGIYTHYR---VSITPDDAIQSVLYVEREGEPPG  300

Query  98   PAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGK--FIVWFRNETTLLV  155
            PA  + K L PG  Y + + +V + + S   T+  + T P       F   +   ++  V
Sbjct  301  PAQAAFKGLVPGREYNISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRV  360

Query  156  LWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTV  215
             W+P    S +  Y+V +        +  V +              L PGR Y + V+T+
Sbjct  361  RWEPPRTYSEFDAYQVMLS---TSRRIFNVPRAANGDSVYFDYPDILEPGRTYEVVVKTI  417

Query  216  SEDEISTPTTAQ--YRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFR  261
            +++  S P + +   R  P+R L    D     SN+L + WEP +  R
Sbjct  418  ADNVNSWPASGEVTLRPRPVRSLGGFLDD---RSNALHISWEPAETGR  462


 Score = 42.0 bits (97),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 73/192 (38%), Gaps = 8/192 (4%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTP-PRIIGFTENPPAGYS  102
            P PP NL++         + W  P    +S + ++    ++ +P  RI G  EN      
Sbjct  620  PKPPQNLTLQTVHTNLVVLHWQAPEGSDFSEYVVRY--RTDASPWQRISGLHENEA---R  674

Query  103  LKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLW-QPSY  161
            +KD+  G  Y VQ+ +V    ES      N T  P  P   +V   +   L + W +P  
Sbjct  675  IKDMHYGERYLVQVNTVSFGVESPHPLELNVTMPPQ-PVSNVVPLVDSRNLTLEWPRPDG  733

Query  162  PASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEIS  221
                YT      D  D  E     + E       +   + L PGR Y   VQ  S    S
Sbjct  734  HVDFYTLKWWPTDEEDRVEFKNVTQLEDLSSPSVRIPIEDLSPGRQYRFEVQASSNGIRS  793

Query  222  TPTTAQYRTIPL  233
              T    RT+PL
Sbjct  794  GTTHLSTRTMPL  805


 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 79/200 (40%), Gaps = 23/200 (12%)

Query  35    PLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFT  94
             P+  +    P P ++L     + +   + W+ P +G+Y+ F+L+ +S  E+ P  +   T
Sbjct  891   PVQRLYRLHPLPISDLKAIQVAAREITLHWTAP-AGEYTDFELQYLSADEEAPQLLQNVT  949

Query  95    EN---------PPAGYSLKDLTPGGSYQVQLF---SVYDSKESVAYTSRNFTTKPNTPGK  142
             +N         P   Y+   +   GS Q   F   SV     S A  S ++ T    PGK
Sbjct  950   KNTEITLQGLRPYHNYTFTVVVRSGSIQGTDFADVSVSTLMRSSAPISASYQTLTAPPGK  1009

Query  143   FIVWFR------NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQ  196
              + +F+       E T     +P+       +++++    D    V   E    P    Q
Sbjct  1010  -VDYFQPSDVQPGEVTFEWSLEPAEQHGPIDYFRITCQNADDAADVSSYEF---PVNATQ  1065

Query  197   AAFKGLVPGRAYNISVQTVS  216
                 GLVPG  Y   +Q  S
Sbjct  1066  GKIDGLVPGNHYIFRIQAKS  1085


 Score = 36.6 bits (83),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 4/63 (6%)

Query  198  AFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKA-SITSNSLRVVWEP  256
            +F GL PG+ YN++V TVS    S P    YR   L PL  +  KA  + +  + + W  
Sbjct  866  SFSGLTPGKLYNVTVWTVSGGVASLPVQRLYR---LHPLPISDLKAIQVAAREITLHWTA  922

Query  257  PKG  259
            P G
Sbjct  923  PAG  925


 Score = 34.7 bits (78),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 10/153 (7%)

Query  108  PGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPAS-IY  166
            PG  Y   L+    +       + N TT P+ P    V  R+  +  + W+P  P S  Y
Sbjct  122  PGTEYNFWLYYTNSTHREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRP--PGSGRY  179

Query  167  THYKVSI-DPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTP-T  224
            + +++ +    D P    Y  +  E     Q + K L PG +Y +   +V + + S   T
Sbjct  180  SGFRIRVLGLTDLPFERSYSLEGNE---TLQLSAKELTPGGSYQVQAYSVYQGKESVAYT  236

Query  225  TAQYRTIPLRPLSFTYDKASITSNSLRVVWEPP  257
            +  + T P  P  F     + T  +L V+W+PP
Sbjct  237  SRNFTTKPNTPGKFIVWFRNET--TLLVLWQPP  267



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02450.1.1 Methyl-accepting

Length=91
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYB_DROME  unnamed protein product                                    25.0    6.6  
Q9VKB1_DROME  unnamed protein product                                 24.6    9.1  
Q9U722_DROME  unnamed protein product                                 24.6    9.5  


>MYB_DROME unnamed protein product
Length=657

 Score = 25.0 bits (53),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query  18   DTLLRDLGKKHYTYGAKAKYVDLIGPQFISAIQPSLESRWSPELN  62
            D LL+ L + H       +  ++IGP F   ++  ++ RW+  LN
Sbjct  93   DVLLKQLVETH------GENWEIIGPHFKDRLEQQVQQRWAKVLN  131


>Q9VKB1_DROME unnamed protein product
Length=585

 Score = 24.6 bits (52),  Expect = 9.1, Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)

Query  54   ESRWSPELNNAWIHLFG  70
            +SRW P ++ +W  LFG
Sbjct  315  KSRWIPSVSESWGWLFG  331


>Q9U722_DROME unnamed protein product
Length=444

 Score = 24.6 bits (52),  Expect = 9.5, Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)

Query  54   ESRWSPELNNAWIHLFG  70
            +SRW P ++ +W  LFG
Sbjct  205  KSRWIPSVSESWGWLFG  221



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02460.1.1 Cytochrome

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  189     8e-54
C4D21_DROME  unnamed protein product                                  184     4e-52
CP4E3_DROME  unnamed protein product                                  164     8e-45


>CP4G1_DROME unnamed protein product
Length=556

 Score = 189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 147/528 (28%), Positives = 247/528 (47%), Gaps = 68/528 (13%)

Query  29   WRRR-KLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIG  87
            WRR  + Y +   +P P  LPI+G          + +  +    + KYG     ++ W+G
Sbjct  44   WRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGET---MKAWLG  100

Query  88   PELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQV  145
              L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  RK++   
Sbjct  101  NVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHRKMIAPT  158

Query  146  LHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQ  205
             H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +GV    +
Sbjct  159  FHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMGVKKLPE  216

Query  206  NNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILQFTQTLL  262
             N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL  T  ++
Sbjct  217  GNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRM--MNIILGMTSKVV  273

Query  263  DNAKH---------VRDDST--------------------------SKERITLNQVLVQ-  286
             + K          V + ST                          +K R+ L   +V+ 
Sbjct  274  KDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEM  333

Query  287  --SPGMTKEEQK--AQIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETVQILGED  342
              +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E   I G++
Sbjct  334  AKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDN  393

Query  343  TSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLPTGVTVF  402
                 T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P G TV 
Sbjct  394  MLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVPKGTTVI  450

Query  403  VLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLF  462
            VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+L+LK+ 
Sbjct  451  VLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVL  510

Query  463  SVAIIREFEILPTENFTTLRDVEKAIRMNAT--MDLEEKCHIRLRNRR  508
               I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  511  LSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551


>C4D21_DROME unnamed protein product
Length=511

 Score = 184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 129/458 (28%), Positives = 214/458 (47%), Gaps = 37/458 (8%)

Query  43   GPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIGPELAILVTDASVASQ  102
            GP  +PI+GN L  L     N          KYG      R WI  E  I   D      
Sbjct  35   GPFTIPIVGNGLQALTLRPENFIQRFGDYFNKYGKT---FRLWILGECLIYTKDLKYFES  91

Query  103  V--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQVLHFKLLKTYIPIFHD  160
            +  ++  L KA  Y+ L   ++  G+ +    + W + RK++    HFK L+ ++ I   
Sbjct  92   ILSSSTLLKKAHLYRFLRD-FLGDGLLLSTG-NKWTSRRKVLAPAFHFKCLENFVEIMDR  149

Query  161  ESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQNNEKQPFIEAVHYCF  220
             S I+V+K K YA         KF+ L        T +GV +NAQN    P+ +A+    
Sbjct  150  NSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTTETAMGVQVNAQNEPNFPYTKALKSVV  209

Query  221  ELMQARIFYPFLRSIFV---STILGYRKEEMNCVRYILQFTQTLLDNAKHV---------  268
             +   R+    +R  ++   +  L YR+ + + +  +  FT  ++   + +         
Sbjct  210  YIESKRLASVSMRYNWLFPLAAPLVYRRLQKD-IAIMQDFTDKVIRERRAILERARADGT  268

Query  269  -------RDDSTSKERITLNQVLVQS----PGMTKEEQKAQIITVLGAGLDTSMYQNSLL  317
                    DD   K ++TL  +L+Q+      ++  + + ++   + AG DT+    S  
Sbjct  269  YKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIREEVDVFIFAGDDTTTSGVSHA  328

Query  318  LICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSAR  377
            L  ++ HP +Q  +YEE V +LG D     T   L++L YL+ VIKE +RL P      R
Sbjct  329  LHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKYLDCVIKETMRLHPPVPILGR  388

Query  378  KITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRD-P  436
             I ED+K+      E  +P   ++ ++ + + +  +Y+  P  F P+RW+  ++     P
Sbjct  389  YIPEDLKIG-----EITIPGNTSILLMPYYVYRDPEYFPDPLVFKPERWMDMKTTSNTPP  443

Query  437  LSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILP  474
            L+Y PFSSGP+NCIG K+A LQ+K     +IR +E+LP
Sbjct  444  LAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELLP  481


>CP4E3_DROME unnamed protein product
Length=526

 Score = 164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 117/449 (26%), Positives = 205/449 (46%), Gaps = 30/449 (7%)

Query  43   GPTALPIIGNLLYVLRFGASNVYPISKILV--AKYGGVNGLIRFWIGPELAILVTDASVA  100
            GPT +PI+GN     R G +    +S        YG  N L  FWIG    I++T+    
Sbjct  35   GPTPVPILGN---ANRIGKNPAEILSTFFDWWYDYGKDNFL--FWIGYSSHIVMTNPKQL  89

Query  101  SQV-NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQVLHFKLLKTYIPIFH  159
              + N+  L +      L  P++  G+        W   RK++T   HF +L+ +  + +
Sbjct  90   EYILNSQQLIQKSTIYDLLHPWLGHGLLTSFG-SKWHKHRKMITPSFHFNILQDFHEVMN  148

Query  160  DESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQNNEKQPFIEAVHYC  219
            + S   + + KK +         +     T   I  T +GV INA        ++A    
Sbjct  149  ENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDM  208

Query  220  FELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILQFTQTLLD---------NAKHVRD  270
               +  R F+PF RS  V ++          ++ +  FT  +++          +K   D
Sbjct  209  CYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHD  268

Query  271  DSTSKERITLNQVLVQSP----GMTKEEQKAQIITVLGAGLDTSMYQNSLLLICLALHPH  326
             S  ++++     L+ S      +T++E   ++ T +  G DT+    S  +  L+ HP 
Sbjct  269  PSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPD  328

Query  327  IQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVT  386
            +Q K+Y E  +++G D +   +++++ K+ YL+  IKE  R++P+     R   +D  + 
Sbjct  329  VQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDIN  388

Query  387  CSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGP  446
             S     ++P G T+ + L  +  + + +  P  F P+R+  E+     P  Y PFS+GP
Sbjct  389  GS-----IVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPA---PFEYLPFSAGP  440

Query  447  RNCIGGKYALLQLKLFSVAIIREFEILPT  475
            RNCIG K+ALL+LK     ++R FE+LP 
Sbjct  441  RNCIGQKFALLELKTVISKVVRSFEVLPA  469



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02460.1.2 Cytochrome

Length=437
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  176     9e-50
C4D21_DROME  unnamed protein product                                  172     1e-48
CP4E3_DROME  unnamed protein product                                  154     7e-42


>CP4G1_DROME unnamed protein product
Length=556

 Score = 176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 226/474 (48%), Gaps = 64/474 (14%)

Query  6    IRFWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASR  63
            ++ W+G  L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  R
Sbjct  95   MKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHR  152

Query  64   KIVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLG  123
            K++    H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +G
Sbjct  153  KMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMG  210

Query  124  VNINAQNNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILQ  180
            V    + N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL 
Sbjct  211  VKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRMMNI--ILG  267

Query  181  FTQTLLDNAKH---------VRDDST--------------------------SKERITLN  205
             T  ++ + K          V + ST                          +K R+ L 
Sbjct  268  MTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALL  327

Query  206  QVLVQ---SPGMTKEEQKA--QIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETV  260
              +V+   +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E  
Sbjct  328  DAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQK  387

Query  261  QILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLP  320
             I G++     T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P
Sbjct  388  AIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVP  444

Query  321  TGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYAL  380
             G TV VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+
Sbjct  445  KGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAM  504

Query  381  LQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNA--TMDLEEKCHIRLRNRR  432
            L+LK+    I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  505  LKLKVLLSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551


>C4D21_DROME unnamed protein product
Length=511

 Score = 172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 119/419 (28%), Positives = 201/419 (48%), Gaps = 36/419 (9%)

Query  7    RFWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRK  64
            R WI  E  I   D      +  ++  L KA  Y+ L   ++  G+ +    + W + RK
Sbjct  72   RLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLRD-FLGDGLLLSTG-NKWTSRRK  129

Query  65   IVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGV  124
            ++    HFK L+ ++ I    S I+V+K K YA         KF+ L        T +GV
Sbjct  130  VLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTTETAMGV  189

Query  125  NINAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFV---STILGYRKEEMNCVRYILQ-  180
             +NAQN    P+ +A+     +   R+    +R  ++   +  L YR+ + +    I+Q 
Sbjct  190  QVNAQNEPNFPYTKALKSVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIA--IMQD  247

Query  181  FTQTLLDNAKHV----------------RDDSTSKERITLNQVLVQS----PGMTKEEQK  220
            FT  ++   + +                 DD   K ++TL  +L+Q+      ++  + +
Sbjct  248  FTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIR  307

Query  221  AQIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLD  280
             ++   + AG DT+    S  L  ++ HP +Q  +YEE V +LG D     T   L++L 
Sbjct  308  EEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELK  367

Query  281  YLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYD  340
            YL+ VIKE +RL P      R I ED+K+      E  +P   ++ ++ + + +  +Y+ 
Sbjct  368  YLDCVIKETMRLHPPVPILGRYIPEDLKIG-----EITIPGNTSILLMPYYVYRDPEYFP  422

Query  341  HPDEFDPDRWLPERSEGRD-PLSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILP  398
             P  F P+RW+  ++     PL+Y PFSSGP+NCIG K+A LQ+K     +IR +E+LP
Sbjct  423  DPLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELLP  481


>CP4E3_DROME unnamed protein product
Length=526

 Score = 154 bits (390),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 115/463 (25%), Positives = 204/463 (44%), Gaps = 48/463 (10%)

Query  8    FWIGPELAILVTDASVASQV-NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIV  66
            FWIG    I++T+      + N+  L +      L  P++  G+        W   RK++
Sbjct  73   FWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFG-SKWHKHRKMI  131

Query  67   TQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNI  126
            T   HF +L+ +  + ++ S   + + KK +         +     T   I  T +GV I
Sbjct  132  TPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPI  191

Query  127  NAQNNEKQPFIEAVH-YCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILQFTQTL  185
            NA        ++A    C+ +   R F+PF RS  V ++          ++ +  FT  +
Sbjct  192  NAMEQRDSSIVQAFRDMCYNI-NMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDI  250

Query  186  LD---------NAKHVRDDSTSKERITLNQVLVQSP----GMTKEEQKAQIITVLGAGLD  232
            ++          +K   D S  ++++     L+ S      +T++E   ++ T +  G D
Sbjct  251  IEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHD  310

Query  233  TSMYQNSLLLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRL  292
            T+    S  +  L+ HP +Q K+Y E  +++G D +   +++++ K+ YL+  IKE  R+
Sbjct  311  TTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRV  370

Query  293  FPAALGSARKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLP  352
            +P+     R   +D  +  S     ++P G T+ + L  +  + + +  P  F P+R+  
Sbjct  371  YPSVPFIGRYCDKDYDINGS-----IVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEE  425

Query  353  ERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPT-----------EN  401
            E+     P  Y PFS+GPRNCIG K+ALL+LK     ++R FE+LP              
Sbjct  426  EKPA---PFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNT  482

Query  402  FTTLRDVEKAIRMNA------------TMDLEEKCHIRLRNRR  432
            +  L   EK  R               T+  +   H+RLR RR
Sbjct  483  YLGLAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHLRLRERR  525



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02470.1.1 Cytochrome

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  189     8e-54
C4D21_DROME  unnamed protein product                                  184     5e-52
CP4E3_DROME  unnamed protein product                                  164     8e-45


>CP4G1_DROME unnamed protein product
Length=556

 Score = 189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 147/528 (28%), Positives = 247/528 (47%), Gaps = 68/528 (13%)

Query  29   WRRR-KLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIG  87
            WRR  + Y +   +P P  LPI+G          + +  +    + KYG     ++ W+G
Sbjct  44   WRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGET---MKAWLG  100

Query  88   PELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQV  145
              L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  RK++   
Sbjct  101  NVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHRKMIAPT  158

Query  146  LHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQ  205
             H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +GV    +
Sbjct  159  FHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMGVKKLPE  216

Query  206  NNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILKFTQTLL  262
             N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL  T  ++
Sbjct  217  GNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRM--MNIILGMTSKVV  273

Query  263  DNAKH---------VRDDST--------------------------SKERITLNQVLVQ-  286
             + K          V + ST                          +K R+ L   +V+ 
Sbjct  274  KDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEM  333

Query  287  --SPGMTKEEQK--AQIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETVQILGED  342
              +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E   I G++
Sbjct  334  AKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDN  393

Query  343  TSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLPTGVTVF  402
                 T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P G TV 
Sbjct  394  MLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVPKGTTVI  450

Query  403  VLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLF  462
            VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+L+LK+ 
Sbjct  451  VLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVL  510

Query  463  SVAIIREFEILPTENFTTLRDVEKAIRMNAT--MDLEEKCHIRLRNRR  508
               I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  511  LSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551


>C4D21_DROME unnamed protein product
Length=511

 Score = 184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 129/458 (28%), Positives = 214/458 (47%), Gaps = 37/458 (8%)

Query  43   GPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIGPELAILVTDASVASQ  102
            GP  +PI+GN L  L     N          KYG      R WI  E  I   D      
Sbjct  35   GPFTIPIVGNGLQALTLRPENFIQRFGDYFNKYGKT---FRLWILGECLIYTKDLKYFES  91

Query  103  V--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQVLHFKLLKTYIPIFHD  160
            +  ++  L KA  Y+ L   ++  G+ +    + W + RK++    HFK L+ ++ I   
Sbjct  92   ILSSSTLLKKAHLYRFLRD-FLGDGLLLSTG-NKWTSRRKVLAPAFHFKCLENFVEIMDR  149

Query  161  ESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQNNEKQPFIEAVHYCF  220
             S I+V+K K YA         KF+ L        T +GV +NAQN    P+ +A+    
Sbjct  150  NSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTTETAMGVQVNAQNEPNFPYTKALKSVV  209

Query  221  ELMQARIFYPFLRSIFV---STILGYRKEEMNCVRYILKFTQTLLDNAKHV---------  268
             +   R+    +R  ++   +  L YR+ + + +  +  FT  ++   + +         
Sbjct  210  YIESKRLASVSMRYNWLFPLAAPLVYRRLQKD-IAIMQDFTDKVIRERRAILERARADGT  268

Query  269  -------RDDSTSKERITLNQVLVQS----PGMTKEEQKAQIITVLGAGLDTSMYQNSLL  317
                    DD   K ++TL  +L+Q+      ++  + + ++   + AG DT+    S  
Sbjct  269  YKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIREEVDVFIFAGDDTTTSGVSHA  328

Query  318  LICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSAR  377
            L  ++ HP +Q  +YEE V +LG D     T   L++L YL+ VIKE +RL P      R
Sbjct  329  LHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKYLDCVIKETMRLHPPVPILGR  388

Query  378  KITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRD-P  436
             I ED+K+      E  +P   ++ ++ + + +  +Y+  P  F P+RW+  ++     P
Sbjct  389  YIPEDLKIG-----EITIPGNTSILLMPYYVYRDPEYFPDPLVFKPERWMDMKTTSNTPP  443

Query  437  LSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILP  474
            L+Y PFSSGP+NCIG K+A LQ+K     +IR +E+LP
Sbjct  444  LAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELLP  481


>CP4E3_DROME unnamed protein product
Length=526

 Score = 164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 117/449 (26%), Positives = 205/449 (46%), Gaps = 30/449 (7%)

Query  43   GPTALPIIGNLLYVLRFGASNVYPISKILV--AKYGGVNGLIRFWIGPELAILVTDASVA  100
            GPT +PI+GN     R G +    +S        YG  N L  FWIG    I++T+    
Sbjct  35   GPTPVPILGN---ANRIGKNPAEILSTFFDWWYDYGKDNFL--FWIGYSSHIVMTNPKQL  89

Query  101  SQV-NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQVLHFKLLKTYIPIFH  159
              + N+  L +      L  P++  G+        W   RK++T   HF +L+ +  + +
Sbjct  90   EYILNSQQLIQKSTIYDLLHPWLGHGLLTSFG-SKWHKHRKMITPSFHFNILQDFHEVMN  148

Query  160  DESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQNNEKQPFIEAVHYC  219
            + S   + + KK +         +     T   I  T +GV INA        ++A    
Sbjct  149  ENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDM  208

Query  220  FELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILKFTQTLLD---------NAKHVRD  270
               +  R F+PF RS  V ++          ++ +  FT  +++          +K   D
Sbjct  209  CYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHD  268

Query  271  DSTSKERITLNQVLVQSP----GMTKEEQKAQIITVLGAGLDTSMYQNSLLLICLALHPH  326
             S  ++++     L+ S      +T++E   ++ T +  G DT+    S  +  L+ HP 
Sbjct  269  PSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPD  328

Query  327  IQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVT  386
            +Q K+Y E  +++G D +   +++++ K+ YL+  IKE  R++P+     R   +D  + 
Sbjct  329  VQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDIN  388

Query  387  CSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGP  446
             S     ++P G T+ + L  +  + + +  P  F P+R+  E+     P  Y PFS+GP
Sbjct  389  GS-----IVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPA---PFEYLPFSAGP  440

Query  447  RNCIGGKYALLQLKLFSVAIIREFEILPT  475
            RNCIG K+ALL+LK     ++R FE+LP 
Sbjct  441  RNCIGQKFALLELKTVISKVVRSFEVLPA  469



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02470.1.2 Cytochrome

Length=437
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  176     1e-49
C4D21_DROME  unnamed protein product                                  172     2e-48
CP4E3_DROME  unnamed protein product                                  154     8e-42


>CP4G1_DROME unnamed protein product
Length=556

 Score = 176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 226/474 (48%), Gaps = 64/474 (14%)

Query  6    IRFWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASR  63
            ++ W+G  L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  R
Sbjct  95   MKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHR  152

Query  64   KIVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLG  123
            K++    H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +G
Sbjct  153  KMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMG  210

Query  124  VNINAQNNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILK  180
            V    + N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL 
Sbjct  211  VKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRMMNI--ILG  267

Query  181  FTQTLLDNAKH---------VRDDST--------------------------SKERITLN  205
             T  ++ + K          V + ST                          +K R+ L 
Sbjct  268  MTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALL  327

Query  206  QVLVQ---SPGMTKEEQKA--QIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETV  260
              +V+   +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E  
Sbjct  328  DAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQK  387

Query  261  QILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLP  320
             I G++     T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P
Sbjct  388  AIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVP  444

Query  321  TGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYAL  380
             G TV VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+
Sbjct  445  KGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAM  504

Query  381  LQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNA--TMDLEEKCHIRLRNRR  432
            L+LK+    I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  505  LKLKVLLSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551


>C4D21_DROME unnamed protein product
Length=511

 Score = 172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/418 (28%), Positives = 200/418 (48%), Gaps = 34/418 (8%)

Query  7    RFWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRK  64
            R WI  E  I   D      +  ++  L KA  Y+ L   ++  G+ +    + W + RK
Sbjct  72   RLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLRD-FLGDGLLLSTG-NKWTSRRK  129

Query  65   IVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGV  124
            ++    HFK L+ ++ I    S I+V+K K YA         KF+ L        T +GV
Sbjct  130  VLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTTETAMGV  189

Query  125  NINAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFV---STILGYRKEEMNCVRYILKF  181
             +NAQN    P+ +A+     +   R+    +R  ++   +  L YR+ + + +  +  F
Sbjct  190  QVNAQNEPNFPYTKALKSVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKD-IAIMQDF  248

Query  182  TQTLLDNAKHV----------------RDDSTSKERITLNQVLVQS----PGMTKEEQKA  221
            T  ++   + +                 DD   K ++TL  +L+Q+      ++  + + 
Sbjct  249  TDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIRE  308

Query  222  QIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDY  281
            ++   + AG DT+    S  L  ++ HP +Q  +YEE V +LG D     T   L++L Y
Sbjct  309  EVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKY  368

Query  282  LERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDH  341
            L+ VIKE +RL P      R I ED+K+      E  +P   ++ ++ + + +  +Y+  
Sbjct  369  LDCVIKETMRLHPPVPILGRYIPEDLKIG-----EITIPGNTSILLMPYYVYRDPEYFPD  423

Query  342  PDEFDPDRWLPERSEGRD-PLSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILP  398
            P  F P+RW+  ++     PL+Y PFSSGP+NCIG K+A LQ+K     +IR +E+LP
Sbjct  424  PLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELLP  481


>CP4E3_DROME unnamed protein product
Length=526

 Score = 154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 115/463 (25%), Positives = 204/463 (44%), Gaps = 48/463 (10%)

Query  8    FWIGPELAILVTDASVASQV-NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIV  66
            FWIG    I++T+      + N+  L +      L  P++  G+        W   RK++
Sbjct  73   FWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFG-SKWHKHRKMI  131

Query  67   TQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNI  126
            T   HF +L+ +  + ++ S   + + KK +         +     T   I  T +GV I
Sbjct  132  TPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPI  191

Query  127  NAQNNEKQPFIEAVH-YCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILKFTQTL  185
            NA        ++A    C+ +   R F+PF RS  V ++          ++ +  FT  +
Sbjct  192  NAMEQRDSSIVQAFRDMCYNI-NMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDI  250

Query  186  LD---------NAKHVRDDSTSKERITLNQVLVQSP----GMTKEEQKAQIITVLGAGLD  232
            ++          +K   D S  ++++     L+ S      +T++E   ++ T +  G D
Sbjct  251  IEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHD  310

Query  233  TSMYQNSLLLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRL  292
            T+    S  +  L+ HP +Q K+Y E  +++G D +   +++++ K+ YL+  IKE  R+
Sbjct  311  TTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRV  370

Query  293  FPAALGSARKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLP  352
            +P+     R   +D  +  S     ++P G T+ + L  +  + + +  P  F P+R+  
Sbjct  371  YPSVPFIGRYCDKDYDINGS-----IVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEE  425

Query  353  ERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPT-----------EN  401
            E+     P  Y PFS+GPRNCIG K+ALL+LK     ++R FE+LP              
Sbjct  426  EKPA---PFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNT  482

Query  402  FTTLRDVEKAIRMNA------------TMDLEEKCHIRLRNRR  432
            +  L   EK  R               T+  +   H+RLR RR
Sbjct  483  YLGLAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHLRLRERR  525



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02480.1.1 Methyl-accepting

Length=91
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYB_DROME  unnamed protein product                                    25.0    6.6  
Q9VKB1_DROME  unnamed protein product                                 24.6    9.1  
Q9U722_DROME  unnamed protein product                                 24.6    9.5  


>MYB_DROME unnamed protein product
Length=657

 Score = 25.0 bits (53),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query  18   DTLLRDLGKKHYTYGAKAKYVDLIGPQFISAIQPSLESRWSPELN  62
            D LL+ L + H       +  ++IGP F   ++  ++ RW+  LN
Sbjct  93   DVLLKQLVETH------GENWEIIGPHFKDRLEQQVQQRWAKVLN  131


>Q9VKB1_DROME unnamed protein product
Length=585

 Score = 24.6 bits (52),  Expect = 9.1, Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)

Query  54   ESRWSPELNNAWIHLFG  70
            +SRW P ++ +W  LFG
Sbjct  315  KSRWIPSVSESWGWLFG  331


>Q9U722_DROME unnamed protein product
Length=444

 Score = 24.6 bits (52),  Expect = 9.5, Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)

Query  54   ESRWSPELNNAWIHLFG  70
            +SRW P ++ +W  LFG
Sbjct  205  KSRWIPSVSESWGWLFG  221



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02490.1.1 Kelch-like

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KLHDB_DROME  unnamed protein product                                  359     3e-116
KELC_DROME  unnamed protein product                                   363     8e-111
Q9VGE5_DROME  unnamed protein product                                 322     2e-102


>KLHDB_DROME unnamed protein product
Length=623

 Score = 359 bits (922),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 212/544 (39%), Positives = 310/544 (57%), Gaps = 13/544 (2%)

Query  56   EHPNQVLTGFNEARKNNEFCDVTLCVDGTKFPAHRVVLAASSPYFKAMFHSRCLEAKQNN  115
            +HP   LT  N  R++ E CDV L V G K  AHRV+L+A S YF AMF     E++Q  
Sbjct  53   KHPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTE  112

Query  116  IQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDAS  175
            + ++ ID   M LL+++CY++ I +  +N Q LL AA LLQ++ ++   C FL++ +D +
Sbjct  113  VTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPT  172

Query  176  NCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKE  235
            NCLGI  FA+ H+C EL   A  F   NF  V ++EEFL LP  +L+++  SD L +  E
Sbjct  173  NCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSE  232

Query  236  EMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVE  295
            E +F AV  WL+Y+V  R      VL+ +RLP LSP FL   V    +++++  C  LV+
Sbjct  233  EQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVD  292

Query  296  EAKLFHLLPDRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTKVWKTL  355
            EAK + LLP  R     PRT+PRK      V+ AVGG      + SVE F  +T  WK +
Sbjct  293  EAKNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMV  352

Query  356  SCLPFAISKHGLVVSGRN-TIYLVGGEFPDGNASA-SVWKYDPVLDHWQ-EVAPLLNPRS  412
            +  P +  + G+ V+  N  +Y VGG   DG +   S+ +YDP  + W  +VAP  + R+
Sbjct  353  A--PMSKRRCGVGVAVLNDLLYAVGGH--DGQSYLNSIERYDPQTNQWSCDVAPTTSCRT  408

Query  413  ELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYV  472
             +G+A+LDGF+YAVGG DG   L+ VERYDP +N+WS + PM       AV    G LY 
Sbjct  409  SVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYA  468

Query  473  TGGAILEDGD-GIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTEN  531
             GG+   DG   +  V+RY+P+ N+W  ++PM   R        ++ IY +GG     E 
Sbjct  469  IGGS---DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMEL  525

Query  532  TNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDND  591
            ++  E Y+   NTW     M  +R   G+AV++G++Y +GG +G   Y  +IE YD + +
Sbjct  526  SS-AERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDG-SAYLKTIEVYDPETN  583

Query  592  SWEI  595
             W +
Sbjct  584  QWRL  587


 Score = 114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 96/188 (51%), Gaps = 7/188 (4%)

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            ++AVGGW     + SVER+DP  N+W  + PM        V     +LY  GG    DG 
Sbjct  324  LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGG---HDGQ  380

Query  483  G-IEQVQRYNPKVNQWQ-DLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYHI  540
              +  ++RY+P+ NQW  D+AP    R+   +  LD  +Y +GG     +  N VE Y  
Sbjct  381  SYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGG-QDGVQCLNHVERYDP  439

Query  541  AENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLP  600
             EN W   +PM  +R    +AV+ G +Y +GG +G     +++E YD  ++ W  +S + 
Sbjct  440  KENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPL-NTVERYDPRHNKWVAVSPMS  498

Query  601  SARSWLGC  608
            + R  LGC
Sbjct  499  TRRKHLGC  506


 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 98/211 (46%), Gaps = 13/211 (6%)

Query  308  SAHITPRTKPRKSAGSI---NVIIAVGGEDDKVVLRSVEGFCVKTKVWKTLSCLPFAISK  364
            S  + P T  R S G       + AVGG+D    L  VE +  K   W  ++  P    +
Sbjct  397  SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVA--PMTTRR  454

Query  365  HGLVVSGRNT-IYLVGGEFPDGNASA-SVWKYDPVLDHWQEVAPLLNPRSELGIAMLDGF  422
             G+ V+     +Y +GG   DG     +V +YDP  + W  V+P+   R  LG A+ + +
Sbjct  455  LGVAVAVLGGFLYAIGGS--DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNY  512

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            +YAVGG D    L S ERY+P  N WS I  M    +   +    G LY  GG    DG 
Sbjct  513  IYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGF---DGS  569

Query  483  G-IEQVQRYNPKVNQWQDLAPMLIPRSGAAI  512
              ++ ++ Y+P+ NQW+    M   R G  +
Sbjct  570  AYLKTIEVYDPETNQWRLCGCMNYRRLGGGV  600


>KELC_DROME unnamed protein product
Length=1477

 Score = 363 bits (931),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 207/558 (37%), Positives = 313/558 (56%), Gaps = 12/558 (2%)

Query  52   FAETEHPNQVLTGFNEARKNNEFCDVTLCVDGTKFPAHRVVLAASSPYFKAMFHSRCLEA  111
            ++  +H  +     NE RK  + CDV L  D  +  AHR+VLA+ SPYF AMF S   E+
Sbjct  134  YSNEQHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTS-FEES  192

Query  112  KQNNIQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQH  171
            +Q  I ++ +D   + LL++Y Y++ + +  +N Q LL+AANLLQ+  V+ A C FLQ  
Sbjct  193  RQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQ  252

Query  172  MDASNCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLE  231
            +DASNCLGI  FA+ HAC EL N A+ ++  +F+ V Q +EFL+L   ++I L  +D + 
Sbjct  253  LDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLSHEQVISLIGNDRIS  312

Query  232  IDKEEMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCA  291
            +  EE +++ V  WL+YDV  R     L++E +RLP LS  ++   V++  +++ N  C 
Sbjct  313  VPNEERVYECVIAWLRYDVPMREQFTSLLMEHVRLPFLSKEYITQRVDKEILLEGNIVCK  372

Query  292  QLVEEAKLFHLLP-DRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTK  350
             L+ EA  +HLLP + +SA    RT PRK  G   +++ +GG+  K + RSVE + ++ +
Sbjct  373  NLIIEALTYHLLPTETKSA----RTVPRKPVGMPKILLVIGGQAPKAI-RSVEWYDLREE  427

Query  351  VWKTLSCLPFAISKHGLVVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNP  410
             W   + +P    + GL V G + +Y VGG F       +V  YDP  D W   + +   
Sbjct  428  KWYQAAEMPNRRCRSGLSVLG-DKVYAVGG-FNGSLRVRTVDVYDPATDQWANCSNMEAR  485

Query  411  RSELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGML  470
            RS LG+A+L+G +YAVGG+DG+  L S E YDP  + W +I  M    +S  V    G+L
Sbjct  486  RSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVVHGLL  545

Query  471  YVTGGAILEDGDGIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTE  530
            Y  GG        +  V+RYNP  + W ++A M   RSGA +  L++ +Y +GG H    
Sbjct  546  YAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGAGVGVLNNILYAVGG-HDGPM  604

Query  531  NTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDN  590
                VE Y    N+W   + M   R   G+   DG +YV+GG++G      S+E Y  D+
Sbjct  605  VRRSVEAYDCETNSWRSVADMSYCRRNAGVVAHDGLLYVVGGDDGTSNLA-SVEVYCPDS  663

Query  591  DSWEIMSHLPS-ARSWLG  607
            DSW I+  L +  RS+ G
Sbjct  664  DSWRILPALMTIGRSYAG  681


 Score = 45.8 bits (107),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 47/98 (48%), Gaps = 3/98 (3%)

Query  514  ALDSCIYVLGGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGE  573
             +   + V+GG   + +    VE Y + E  W   + M  +R R G++V+  K+Y +GG 
Sbjct  400  GMPKILLVIGGQ--APKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVLGDKVYAVGGF  457

Query  574  EGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPL  611
             G      +++ YD   D W   S++ + RS LG   L
Sbjct  458  NGSLRVR-TVDVYDPATDQWANCSNMEARRSTLGVAVL  494


>Q9VGE5_DROME unnamed protein product
Length=575

 Score = 322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 197/555 (35%), Positives = 295/555 (53%), Gaps = 13/555 (2%)

Query  65   FNEARKNNEFCDVTLCVDGTKFPAHRVVLAASSPYFKAMFHSRCLEAKQNNIQMKGIDVE  124
            F E R+  + CDVTL V+   F AHRVVLAA+ PYF AMF +   E++   I MK   +E
Sbjct  29   FKEIRRMGKLCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIE  88

Query  125  MMTL--LLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDASNCLGIHC  182
               L  L+ Y YS ++ I   N Q L+  A+ LQ+  V+ A  +FL       N LGI  
Sbjct  89   PSALESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLISRFHPHNVLGIRT  148

Query  183  FAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKEEMLFQAV  242
            FA+   C +L + A  ++  NF+ V Q+EEFL+L   +L+EL   D L +  EE++F+A 
Sbjct  149  FADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEAC  208

Query  243  QRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVEEAKLFHL  302
             +W++Y    RS  FP VL  +RLP LSP FL D V +  +I+++ QC  L++EAK FHL
Sbjct  209  MKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHL  268

Query  303  LPDRRSAHITPRTKPRKSAGSINVIIAVGG-EDDKVVLRSVEGFCVKTKVWKTLSCLPFA  361
            +P+RR    + RT+ R        I AVGG       + +VE +   TK WK    +   
Sbjct  269  MPERRGLLQSFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMM  328

Query  362  ISKHGL-VVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNPRSELGIAMLD  420
             S+ G+ V++G+  +Y  GG F      ++V  YDP  + W +   +L  RS +G+A LD
Sbjct  329  RSRVGVAVLNGK--LYAFGG-FNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALD  385

Query  421  GFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILED  480
              +Y  GG+DG   L++VE Y P  N W  +  M    ++  V    G +Y  GG    D
Sbjct  386  DCIYVCGGYDGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGG---HD  442

Query  481  GDGI-EQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYH  539
            G  I + V+RY+   + W  ++PML  R    +  L+  IYV GG+  ++     VECY 
Sbjct  443  GLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNS-FLRSVECYD  501

Query  540  IAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHL  599
               +TW+  +PM  KR R  +A   GK++ +GG +G +    ++E YD + D W  M  +
Sbjct  502  PQTDTWKLVTPMNCKRSRVALAANMGKLWAIGGYDG-ESNLSTVEVYDPETDKWTFMPPM  560

Query  600  PSARSWLGCVPLQIH  614
             +    +G   ++I 
Sbjct  561  CAHSGGVGAGVIRIE  575



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02500.1.1 O-acyltransferase

Length=183
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960U8_DROME  unnamed protein product                                 280     6e-93
Q8ST50_DROME  unnamed protein product                                 280     6e-93
PORCN_DROME  unnamed protein product                                  33.5    0.046


>Q960U8_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>PORCN_DROME unnamed protein product
Length=525

 Score = 33.5 bits (75),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 48/107 (45%), Gaps = 14/107 (13%)

Query  56   NTDTFWRNWNMPIHQWAVRHLY---KPLVEQGYSRLTASSL-VFFISAFMHEYLVSVPLR  111
            +  +  R+WN+P+H+W  R++Y   KP       R+    L  + +S+ +H     + LR
Sbjct  348  SISSLVRSWNIPMHEWLKRYIYAPCKPTASTSRGRILVVVLSTYLVSSLLH----GMDLR  403

Query  112  TYKIWAFMGMMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLC  158
             Y +   +  + +   S+L R +         N  + ++L  G+  C
Sbjct  404  IYLVLISLAFLAEGE-SLLRRQLASLL-----NACITANLCPGKERC  444



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02510.1.1 O-acyltransferase

Length=183
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960U8_DROME  unnamed protein product                                 280     6e-93
Q8ST50_DROME  unnamed protein product                                 280     6e-93
PORCN_DROME  unnamed protein product                                  33.5    0.046


>Q960U8_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>PORCN_DROME unnamed protein product
Length=525

 Score = 33.5 bits (75),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 48/107 (45%), Gaps = 14/107 (13%)

Query  56   NTDTFWRNWNMPIHQWAVRHLY---KPLVEQGYSRLTASSL-VFFISAFMHEYLVSVPLR  111
            +  +  R+WN+P+H+W  R++Y   KP       R+    L  + +S+ +H     + LR
Sbjct  348  SISSLVRSWNIPMHEWLKRYIYAPCKPTASTSRGRILVVVLSTYLVSSLLH----GMDLR  403

Query  112  TYKIWAFMGMMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLC  158
             Y +   +  + +   S+L R +         N  + ++L  G+  C
Sbjct  404  IYLVLISLAFLAEGE-SLLRRQLASLL-----NACITANLCPGKERC  444



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02520.1.1 Kelch-like

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KLHDB_DROME  unnamed protein product                                  359     3e-116
KELC_DROME  unnamed protein product                                   362     2e-110
Q9VGE5_DROME  unnamed protein product                                 322     1e-102


>KLHDB_DROME unnamed protein product
Length=623

 Score = 359 bits (922),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 212/544 (39%), Positives = 310/544 (57%), Gaps = 13/544 (2%)

Query  56   EHPNQVLTGFNEARKNNEFCDVTLCVDGSKFPAHRVVLAASSPYFKAMFHSRCLEAKQNN  115
            +HP   LT  N  R++ E CDV L V G K  AHRV+L+A S YF AMF     E++Q  
Sbjct  53   KHPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTE  112

Query  116  IQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDAS  175
            + ++ ID   M LL+++CY++ I +  +N Q LL AA LLQ++ ++   C FL++ +D +
Sbjct  113  VTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPT  172

Query  176  NCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKE  235
            NCLGI  FA+ H+C EL   A  F   NF  V ++EEFL LP  +L+++  SD L +  E
Sbjct  173  NCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSE  232

Query  236  EMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVE  295
            E +F AV  WL+Y+V  R      VL+ +RLP LSP FL   V    +++++  C  LV+
Sbjct  233  EQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVD  292

Query  296  EAKLFHLLPDRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTKVWKTL  355
            EAK + LLP  R     PRT+PRK      V+ AVGG      + SVE F  +T  WK +
Sbjct  293  EAKNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMV  352

Query  356  SCLPFAISKHGLVVSGRN-TIYLVGGEFPDGNASA-SVWKYDPVLDHWQ-EVAPLLNPRS  412
            +  P +  + G+ V+  N  +Y VGG   DG +   S+ +YDP  + W  +VAP  + R+
Sbjct  353  A--PMSKRRCGVGVAVLNDLLYAVGGH--DGQSYLNSIERYDPQTNQWSCDVAPTTSCRT  408

Query  413  ELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYV  472
             +G+A+LDGF+YAVGG DG   L+ VERYDP +N+WS + PM       AV    G LY 
Sbjct  409  SVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYA  468

Query  473  TGGAILEDGD-GIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTEN  531
             GG+   DG   +  V+RY+P+ N+W  ++PM   R        ++ IY +GG     E 
Sbjct  469  IGGS---DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMEL  525

Query  532  TNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDND  591
            ++  E Y+   NTW     M  +R   G+AV++G++Y +GG +G   Y  +IE YD + +
Sbjct  526  SS-AERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDG-SAYLKTIEVYDPETN  583

Query  592  SWEI  595
             W +
Sbjct  584  QWRL  587


 Score = 114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 96/188 (51%), Gaps = 7/188 (4%)

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            ++AVGGW     + SVER+DP  N+W  + PM        V     +LY  GG    DG 
Sbjct  324  LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGG---HDGQ  380

Query  483  G-IEQVQRYNPKVNQWQ-DLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYHI  540
              +  ++RY+P+ NQW  D+AP    R+   +  LD  +Y +GG     +  N VE Y  
Sbjct  381  SYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGG-QDGVQCLNHVERYDP  439

Query  541  AENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLP  600
             EN W   +PM  +R    +AV+ G +Y +GG +G     +++E YD  ++ W  +S + 
Sbjct  440  KENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPL-NTVERYDPRHNKWVAVSPMS  498

Query  601  SARSWLGC  608
            + R  LGC
Sbjct  499  TRRKHLGC  506


 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 98/211 (46%), Gaps = 13/211 (6%)

Query  308  SAHITPRTKPRKSAGSI---NVIIAVGGEDDKVVLRSVEGFCVKTKVWKTLSCLPFAISK  364
            S  + P T  R S G       + AVGG+D    L  VE +  K   W  ++  P    +
Sbjct  397  SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVA--PMTTRR  454

Query  365  HGLVVSGRNT-IYLVGGEFPDGNASA-SVWKYDPVLDHWQEVAPLLNPRSELGIAMLDGF  422
             G+ V+     +Y +GG   DG     +V +YDP  + W  V+P+   R  LG A+ + +
Sbjct  455  LGVAVAVLGGFLYAIGGS--DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNY  512

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            +YAVGG D    L S ERY+P  N WS I  M    +   +    G LY  GG    DG 
Sbjct  513  IYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGF---DGS  569

Query  483  G-IEQVQRYNPKVNQWQDLAPMLIPRSGAAI  512
              ++ ++ Y+P+ NQW+    M   R G  +
Sbjct  570  AYLKTIEVYDPETNQWRLCGCMNYRRLGGGV  600


>KELC_DROME unnamed protein product
Length=1477

 Score = 362 bits (928),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 207/558 (37%), Positives = 313/558 (56%), Gaps = 12/558 (2%)

Query  52   FAETEHPNQVLTGFNEARKNNEFCDVTLCVDGSKFPAHRVVLAASSPYFKAMFHSRCLEA  111
            ++  +H  +     NE RK  + CDV L  D  +  AHR+VLA+ SPYF AMF S   E+
Sbjct  134  YSNEQHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTS-FEES  192

Query  112  KQNNIQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQH  171
            +Q  I ++ +D   + LL++Y Y++ + +  +N Q LL+AANLLQ+  V+ A C FLQ  
Sbjct  193  RQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQ  252

Query  172  MDASNCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLE  231
            +DASNCLGI  FA+ HAC EL N A+ ++  +F+ V Q +EFL+L   ++I L  +D + 
Sbjct  253  LDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLSHEQVISLIGNDRIS  312

Query  232  IDKEEMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCA  291
            +  EE +++ V  WL+YDV  R     L++E +RLP LS  ++   V++  +++ N  C 
Sbjct  313  VPNEERVYECVIAWLRYDVPMREQFTSLLMEHVRLPFLSKEYITQRVDKEILLEGNIVCK  372

Query  292  QLVEEAKLFHLLP-DRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTK  350
             L+ EA  +HLLP + +SA    RT PRK  G   +++ +GG+  K + RSVE + ++ +
Sbjct  373  NLIIEALTYHLLPTETKSA----RTVPRKPVGMPKILLVIGGQAPKAI-RSVEWYDLREE  427

Query  351  VWKTLSCLPFAISKHGLVVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNP  410
             W   + +P    + GL V G + +Y VGG F       +V  YDP  D W   + +   
Sbjct  428  KWYQAAEMPNRRCRSGLSVLG-DKVYAVGG-FNGSLRVRTVDVYDPATDQWANCSNMEAR  485

Query  411  RSELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGML  470
            RS LG+A+L+G +YAVGG+DG+  L S E YDP  + W +I  M    +S  V    G+L
Sbjct  486  RSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVVHGLL  545

Query  471  YVTGGAILEDGDGIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTE  530
            Y  GG        +  V+RYNP  + W ++A M   RSGA +  L++ +Y +GG H    
Sbjct  546  YAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGAGVGVLNNILYAVGG-HDGPM  604

Query  531  NTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDN  590
                VE Y    N+W   + M   R   G+   DG +YV+GG++G      S+E Y  D+
Sbjct  605  VRRSVEAYDCETNSWRSVADMSYCRRNAGVVAHDGLLYVVGGDDGTSNLA-SVEVYCPDS  663

Query  591  DSWEIMSHLPS-ARSWLG  607
            DSW I+  L +  RS+ G
Sbjct  664  DSWRILPALMTIGRSYAG  681


 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 47/98 (48%), Gaps = 3/98 (3%)

Query  514  ALDSCIYVLGGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGE  573
             +   + V+GG   + +    VE Y + E  W   + M  +R R G++V+  K+Y +GG 
Sbjct  400  GMPKILLVIGGQ--APKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVLGDKVYAVGGF  457

Query  574  EGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPL  611
             G      +++ YD   D W   S++ + RS LG   L
Sbjct  458  NGSLRVR-TVDVYDPATDQWANCSNMEARRSTLGVAVL  494


>Q9VGE5_DROME unnamed protein product
Length=575

 Score = 322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 197/555 (35%), Positives = 295/555 (53%), Gaps = 13/555 (2%)

Query  65   FNEARKNNEFCDVTLCVDGSKFPAHRVVLAASSPYFKAMFHSRCLEAKQNNIQMKGIDVE  124
            F E R+  + CDVTL V+   F AHRVVLAA+ PYF AMF +   E++   I MK   +E
Sbjct  29   FKEIRRMGKLCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIE  88

Query  125  MMTL--LLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDASNCLGIHC  182
               L  L+ Y YS ++ I   N Q L+  A+ LQ+  V+ A  +FL       N LGI  
Sbjct  89   PSALESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLISRFHPHNVLGIRT  148

Query  183  FAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKEEMLFQAV  242
            FA+   C +L + A  ++  NF+ V Q+EEFL+L   +L+EL   D L +  EE++F+A 
Sbjct  149  FADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEAC  208

Query  243  QRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVEEAKLFHL  302
             +W++Y    RS  FP VL  +RLP LSP FL D V +  +I+++ QC  L++EAK FHL
Sbjct  209  MKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHL  268

Query  303  LPDRRSAHITPRTKPRKSAGSINVIIAVGG-EDDKVVLRSVEGFCVKTKVWKTLSCLPFA  361
            +P+RR    + RT+ R        I AVGG       + +VE +   TK WK    +   
Sbjct  269  MPERRGLLQSFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMM  328

Query  362  ISKHGL-VVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNPRSELGIAMLD  420
             S+ G+ V++G+  +Y  GG F      ++V  YDP  + W +   +L  RS +G+A LD
Sbjct  329  RSRVGVAVLNGK--LYAFGG-FNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALD  385

Query  421  GFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILED  480
              +Y  GG+DG   L++VE Y P  N W  +  M    ++  V    G +Y  GG    D
Sbjct  386  DCIYVCGGYDGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGG---HD  442

Query  481  GDGI-EQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYH  539
            G  I + V+RY+   + W  ++PML  R    +  L+  IYV GG+  ++     VECY 
Sbjct  443  GLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNS-FLRSVECYD  501

Query  540  IAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHL  599
               +TW+  +PM  KR R  +A   GK++ +GG +G +    ++E YD + D W  M  +
Sbjct  502  PQTDTWKLVTPMNCKRSRVALAANMGKLWAIGGYDG-ESNLSTVEVYDPETDKWTFMPPM  560

Query  600  PSARSWLGCVPLQIH  614
             +    +G   ++I 
Sbjct  561  CAHSGGVGAGVIRIE  575



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02530.1.1 Interferon-inducible

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9MRT5_DROME  unnamed protein product                                 73.6    3e-14
Q4TZM6_DROME  unnamed protein product                                 73.6    4e-14
X2JAB1_DROME  unnamed protein product                                 73.2    5e-14


>M9MRT5_DROME unnamed protein product
Length=359

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  74   VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  131
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  132  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  178
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  179  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  238
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  239  AKMLVRLQE  247
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


>Q4TZM6_DROME unnamed protein product
Length=383

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  74   VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  131
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  132  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  178
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  179  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  238
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  239  AKMLVRLQE  247
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


>X2JAB1_DROME unnamed protein product
Length=418

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  74   VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  131
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  132  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  178
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  179  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  238
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  239  AKMLVRLQE  247
             +M +RLQE
Sbjct  310  HRMWMRLQE  318



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02540.1.1 Anoctamin

Length=984
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97132_DROME  unnamed protein product                                 207     1e-56
A0A0B4JCY1_DROME  unnamed protein product                             169     7e-43
Q9VDV4_DROME  unnamed protein product                                 169     9e-43


>O97132_DROME unnamed protein product
Length=646

 Score = 207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 147/509 (29%), Positives = 232/509 (46%), Gaps = 94/509 (18%)

Query  216  IPKCLSEGLISQMYPLHELDGLEQLRQNWVRTFVKKQPLDSVCKYFGVKIAMYFAWLGHY  275
            I   + +G I  M+PLH++  LE+   N  RT   K P++ +  YFG  I +YF ++  Y
Sbjct  164  IKSYVQKGYIEDMFPLHDILYLERFNWNLKRT---KLPIEDIRNYFGSSIGLYFGFIEFY  220

Query  276  TYMLIIPAFVGFIFWIGFGRGDQSSEDIGYVLFSLFNVVWFSIYLEAWKRYSSELAYKWG  335
            T  LI P+  G +         Q   D+   L   F VVW +I+LE WKR  +  +Y+WG
Sbjct  221  TKALIFPSLFGIL---------QYVFDLNISLVCSFYVVWTTIFLELWKRKCAGYSYRWG  271

Query  336  TLDQRHELLMEPRPLYSGNLVVSPVTGRLEPTYPSWKRHVFRYFVSVPIIALCLLVVLSV  395
            T++     L +PR  Y+G L   P+TG++   YP    ++  Y +S P++  C++     
Sbjct  272  TIEMSS--LDKPRSAYTGQLKPDPITGKMTLHYPMRYTYLQMYCISYPVVLGCVVAAGWF  329

Query  396  MIASLKVQDWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWLNDMGKC----  451
             +   +++    + + + G   WL YVP ++ +V+I +   AY K+A +L ++       
Sbjct  330  ALYQFQIE---AEVLADFGPDSWLLYVPVIVQSVLIAIFSWAYEKLATFLTNLENHRTRS  386

Query  452  ---------VGTFQFVNSFSSLFYIAFYLQDQERLKEQLATLLITRQLIGNIKESALPYV  502
                     +  F+ VN+F S FYIAF L D  +LK QL   L+  QL+   +E  +P  
Sbjct  387  QYDRHRVNKLMLFEIVNNFFSQFYIAFVLHDLRQLKYQLMMQLLVFQLLCIAQEIGIP--  444

Query  503  QEQFRLAKLSFDLYGALSPSEAKKSDGTTNDFDSASNGKSSSGGGNRNVSQAELESTLLK  562
                        L   L    A+            +  K  S        Q+  ES L +
Sbjct  445  ------------LLAVLRQKYAEFRH------REVAEEKLRSISDLPRYEQSFYESGLDE  486

Query  563  YEGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIP  622
            Y  T+ D+L++ IQ G+VVLF+   P AA+ ALLNN+  +  D +KLC IF+RPF +R  
Sbjct  487  YHSTYEDYLQVCIQFGFVVLFAAVAPFAAIGALLNNVFAVHIDMWKLCNIFKRPFARRAK  546

Query  623  NIGMWQ--------------------------------------------HIMFAVRFII  638
            NIG WQ                                            H++  ++F+I
Sbjct  547  NIGAWQLAFELLSVMSLLSNCGLLFLQPNVKDFFSHWLPSVPDLSFVIFEHLLLGLKFLI  606

Query  639  SCVIPDLPDWVATEMAKVEFARREALSRI  667
              VI + P WV   + K +F   +AL ++
Sbjct  607  HKVIHERPRWVRIGLLKADFETSQALKQL  635


>A0A0B4JCY1_DROME unnamed protein product
Length=1099

 Score = 169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 154/559 (28%), Positives = 235/559 (42%), Gaps = 141/559 (25%)

Query  179  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  234
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  351  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  400

Query  235  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  286
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  401  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  460

Query  287  FI------------------------------------FW-----IGFGRGDQSSEDIGY  305
             I                                    FW       + +     ++   
Sbjct  461  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  520

Query  306  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  359
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  521  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  577

Query  360  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV----Q  403
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV     
Sbjct  578  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPM  637

Query  404  DWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWL------NDMGKCVGTFQF  457
                  +       +++     +L  +   L E   ++ +W       + +   +   QF
Sbjct  638  TTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQF  697

Query  458  VNSFSSLFYIAF-----------------YLQDQ-------ERLKEQLATLLITRQLIGN  493
            VN ++S+FYIAF                 Y Q++         L  QLA +++ +Q    
Sbjct  698  VNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNT  757

Query  494  IKESALPYVQEQFRLAKLSFDLYGALSPSEAKKSDGT-TNDFDSASNGKSSSGGGNRNVS  552
            I E  LP    +    ++        +P+  K  D     DF     G            
Sbjct  758  ILEVYLPMFWRKVLAIQVGLSRLFNNTPNPDKAKDERWMRDFKLLDWGA-----------  806

Query  553  QAELESTLLKYEGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFI  612
                        G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL   
Sbjct  807  -----------RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTH  855

Query  613  FQRPFGQRIPNIGMWQHIM  631
             +RP  QR+ +IG+W  I+
Sbjct  856  HKRPVSQRVRDIGVWYRIL  874


>Q9VDV4_DROME unnamed protein product
Length=1075

 Score = 169 bits (427),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 154/559 (28%), Positives = 235/559 (42%), Gaps = 141/559 (25%)

Query  179  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  234
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  327  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  376

Query  235  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  286
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  377  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  436

Query  287  FI------------------------------------FW-----IGFGRGDQSSEDIGY  305
             I                                    FW       + +     ++   
Sbjct  437  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  496

Query  306  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  359
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  497  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  553

Query  360  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV----Q  403
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV     
Sbjct  554  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPM  613

Query  404  DWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWL------NDMGKCVGTFQF  457
                  +       +++     +L  +   L E   ++ +W       + +   +   QF
Sbjct  614  TTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQF  673

Query  458  VNSFSSLFYIAF-----------------YLQDQ-------ERLKEQLATLLITRQLIGN  493
            VN ++S+FYIAF                 Y Q++         L  QLA +++ +Q    
Sbjct  674  VNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNT  733

Query  494  IKESALPYVQEQFRLAKLSFDLYGALSPSEAKKSDGT-TNDFDSASNGKSSSGGGNRNVS  552
            I E  LP    +    ++        +P+  K  D     DF     G            
Sbjct  734  ILEVYLPMFWRKVLAIQVGLSRLFNNTPNPDKAKDERWMRDFKLLDWGA-----------  782

Query  553  QAELESTLLKYEGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFI  612
                        G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL   
Sbjct  783  -----------RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTH  831

Query  613  FQRPFGQRIPNIGMWQHIM  631
             +RP  QR+ +IG+W  I+
Sbjct  832  HKRPVSQRVRDIGVWYRIL  850



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02550.1.1 interferon-inducible

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q27IS7_DROME  unnamed protein product                                 38.9    0.004
Q27IS6_DROME  unnamed protein product                                 38.5    0.004
M9MRT5_DROME  unnamed protein product                                 38.5    0.004


>Q27IS7_DROME unnamed protein product
Length=407

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 38/72 (53%), Gaps = 4/72 (6%)

Query  293  KTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKKQA  349
            KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK+A
Sbjct  101  KTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKKEA  159

Query  350  KHKTAKNMLIEL  361
            KH  A+ ++ +L
Sbjct  160  KHAAARALIDKL  171


>Q27IS6_DROME unnamed protein product
Length=407

 Score = 38.5 bits (88),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 38/72 (53%), Gaps = 4/72 (6%)

Query  293  KTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKKQA  349
            KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK+A
Sbjct  101  KTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKKEA  159

Query  350  KHKTAKNMLIEL  361
            KH  A+ ++ +L
Sbjct  160  KHAAARALIDKL  171


>M9MRT5_DROME unnamed protein product
Length=359

 Score = 38.5 bits (88),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  291  STKTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKK  347
            + KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKK  190

Query  348  QAKHKTAKNMLIEL  361
            +AKH  A+ ++ +L
Sbjct  191  EAKHAAARALIDKL  204


 Score = 29.6 bits (65),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query  45   VFSYELNLFNGAYIAHGSGPNKKIAKQETAKNMLMQLSRDKSNVKALLDKNKIQEPSLCK  104
            +F+   ++ N  Y   G G +KKIAK+  A  M M+L          +D  KI + S+C 
Sbjct  282  LFTIACSILN--YREMGKGKSKKIAKRLAAHRMWMRLQETP------IDSGKISD-SICG  332

Query  105  SIDVEANDLGDLNK  118
             ++ E + + D+++
Sbjct  333  ELEGEVSIIQDIDR  346



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02560.1.1 Protein

Length=911
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MELT_DROME  unnamed protein product                                   632     0.0  


>MELT_DROME unnamed protein product
Length=994

 Score = 632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/880 (44%), Positives = 532/880 (60%), Gaps = 86/880 (10%)

Query  1    MHELFTQVLSNKDLSKAGDLFSVPDSSIINDLTEVVTKISEITSLPDYVNNNNDQSVVEI  60
            MHELF +VL+ +DLS+AGDLFSVPD+ I++D+TEV+++IS I S  DYV NNNDQSVVEI
Sbjct  1    MHELFNKVLAKRDLSRAGDLFSVPDADIVDDITEVLSEISPIISHADYVKNNNDQSVVEI  60

Query  61   CITRVTSAIRETDSIEQHAEALVGLLESCLNHNLKPS-PKDEDPPHAKISSDIISCIFLN  119
            C+TRV S IRET + E++  ALV LL +CL  NL+PS    E+PPHAKI++DIIS IFLN
Sbjct  61   CVTRVLSCIRETKTAERYCAALVDLLRTCLLWNLQPSGTTKEEPPHAKIAADIISSIFLN  120

Query  120  YNKKDVMKRALPVAVKLLHKGNRELSRNMASYLSLAVIHNAPLLSQHIQLIIDSVISGNY  179
            Y+KK++MK ALPVAV+ L KGNRELSRN+ASYLSLA I +A LLS H + +++S++SGNY
Sbjct  121  YDKKELMKIALPVAVQFLPKGNRELSRNLASYLSLAAIDHAGLLSPHTESVMESILSGNY  180

Query  180  PLCRVLPQIYAVTKDPIHEHAMALVSLLPQCDLSEKLALLQLFALVAHNKPLLLEASLPQ  239
             L RVL Q+Y V  + +  HA  L+ LLPQCD  E++A+ QL+ L+    P +LE+ +PQ
Sbjct  181  GLLRVLSQVYEVAPEAVTPHAPLLMPLLPQCDPQERMAVFQLYLLIVQKSPEVLESCVPQ  240

Query  240  LCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCITVQVVAAVGRL  299
            LC  L  + T   TMQI L L++  P LLVD+  +L+ A + N  T+ +  Q++   G  
Sbjct  241  LCGSLLDSDTSSITMQILLKLSQHSPSLLVDHFEQLRLAAKTNPGTIPLCAQIMTTAGIG  300

Query  300  NKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNSAQV  359
            +K+ AQ AL+F+L HLP     +Q++L +EAT LCS YPVL TDK+LA V Q  +N+A  
Sbjct  301  SKETAQQALDFVLEHLP-----TQALLQQEATRLCSAYPVLFTDKVLACVRQ--KNAALS  353

Query  360  NQSSNNNGVTIVTVGGC-----------------ESATPTTKSSSVESTNNIPPSSGGGG  402
            +Q    NG+   T GG                      P   ++ V+  + +  +     
Sbjct  354  SQQDVGNGLANKTSGGVTIVSLNSSSPSPPLKPVPVGAPAINTTIVQPASVVSATPTPPP  413

Query  403  GIYKTKNSTVISTHSTNTYTPNSKNQDSNNNSRIRPRIGADSRSTSRLN-SSAAHRSMTR  461
                   ++     S  T TP    Q +    R+  ++G DSRST RL+ +S  HRS+TR
Sbjct  414  SSASAPIASSTPV-SAATPTP----QHAGYTRRV--KLG-DSRSTGRLHPASNTHRSVTR  465

Query  462  LNIASSSRLGSVGGLHKSMTRLSTSSHINQPPSQSQPQPPGQQQASSQQPHSL-------  514
            LN+AS    GSVGGLHKSMTRLS S    QP   S      Q  A+ + P  L       
Sbjct  466  LNVAS----GSVGGLHKSMTRLSNSQINQQPGGSSNGNVVVQSGATPKTPTGLSNPPVTP  521

Query  515  --PYNRSVTSIHGTRHYNVAGNKVTSGGVTVTTSTRSPSPTKTITGSGGSGSALRDDSVI  572
              P + +V      RH    G  VTSGGVTVTT     SP+K    S G  + L   +V+
Sbjct  522  VPPLSNNVVITGHNRH----GIPVTSGGVTVTT-----SPSKVRPHSQGPSTLLNSSTVL  572

Query  573  VTPRYIQHTHTRPVSTLGGGSPLSQSIISQALSQS-SAANLH--SIARPFNSSSVTPRRH  629
            +  +Y      + V ++    P S ++ +   +Q+ +A ++H  S A P ++S+      
Sbjct  573  M--KYSTDALNQSVGSI--SIPQSAAVATLPSTQTQNAVSVHHASPALPQSASN-----G  623

Query  630  NANTSVTIINNSNSNV----PAANNSAIAAASQVSIINNSNSNVPAASQRISVFEPYP-M  684
            +A + + +  N NS V    P  N +   + +    + N+NS      QR+S FEPY  M
Sbjct  624  HAKSVMKLPVNGNSEVIVSGPTTNVAPRRSDNTSRTLLNANS---VMDQRMSTFEPYQIM  680

Query  685  RDTIQHFCEKHLDKIKSYMEKVSVRIPSPAKCTIE------ERRAKKMAKLHFACQGRGE  738
            RD +Q FCEK+ + IKSYM++VS  +P P +C+IE      ERR KK+AKLHFACQ RG 
Sbjct  681  RDPVQQFCEKNFNSIKSYMDEVSQHLPPPTRCSIEVSNEFAERRTKKVAKLHFACQIRGP  740

Query  739  HCLYSRALFTTRTRHPRAWIHLMFLSLQAR----SDSALSSRDSSVSSLKHCWDILKCEN  794
            HCLYS+  FT RTR+P+ WIH+MFL  Q R        LS+R+S +S+LK+ W ILKCEN
Sbjct  741  HCLYSKTCFTMRTRNPKTWIHMMFLDFQVRHFVKEKCVLSTRESGISNLKNIWQILKCEN  800

Query  795  KTFLTLVTSAFPCAKDQEAVLNELRHSGFCDVFEYGKEDK  834
            ++F  LVTS FP  KD+E ++NELRHSGF DVFE  K DK
Sbjct  801  RSFTELVTSQFPQVKDREILVNELRHSGFLDVFEVSKTDK  840


 Score = 114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)

Query  839  IDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEM  898
            IDV++IRSVKVSRGARNIPKAFEIFT D +LILKPK+GKNAE+WVQCLS+VVAHSQA++ 
Sbjct  915  IDVNQIRSVKVSRGARNIPKAFEIFTADQTLILKPKDGKNAEEWVQCLSIVVAHSQARDN  974

Query  899  PT  900
            PT
Sbjct  975  PT  976



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02570.1.1 Guanine

Length=1100
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPI9_DROME  unnamed protein product                                 801     0.0  
B7Z0R2_DROME  unnamed protein product                                 32.3    1.7  
A0A0B4KHD2_DROME  unnamed protein product                             32.3    1.8  


>Q9VPI9_DROME unnamed protein product
Length=2064

 Score = 801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/922 (46%), Positives = 616/922 (67%), Gaps = 50/922 (5%)

Query  173   SSRDSRVSSSGGDTPRGSWASFDLLNSKIQWGAFDQLRKRASD-SSTLTRRGSLERRSNS  231
             + RDS  ++ G     G+  S + L+ K    +FDQLR++A+D S TLTRRGSLER+   
Sbjct  419   AERDSFGNACGSSL--GTAPSSNSLDRKSSTSSFDQLRRKANDMSGTLTRRGSLERK---  473

Query  232   SDKRVSWNLDD----LDSFRPVTLTVSSFFKQESDKLRDEDLYKFLQDLKKPCSLLKKLK  287
              +K  SW+ DD    +++FRP+T+TV SFFKQE+DK++DEDLYK L +LK+P S++KK K
Sbjct  474   -EKHRSWSPDDFANVVENFRPITITVPSFFKQEADKMKDEDLYKILPELKRPSSVMKKYK  532

Query  288   SIPGCLKLDISPCPDEVKWCLTPELAEIVPRIGDKGRPIKEILEFPLRETNLPHYLYRNL  347
              IPG +KL+ISPC +E K  LTPELA I P+  D  RP+KEILEFP      PHY YRNL
Sbjct  533   CIPGSIKLEISPCVEEAKNALTPELAPINPQSADNVRPVKEILEFPQSAIYNPHYSYRNL  592

Query  348   LFVYPKEINFTGRTGSARNLTVKVQLMYGETPESALPAIFGKSSCPEFTTEAYTSVIYHN  407
             LFV PKE+NF+ R GSARN+ V+VQLM GETP+ A+ AI+GKSSCP+F+TEA+T+V YHN
Sbjct  593   LFVSPKELNFSSRAGSARNIAVRVQLMAGETPKDAVNAIYGKSSCPKFSTEAFTAVNYHN  652

Query  408   KCPYVSDEIKIQLPPTLEDKHHLLFTFYHISCQKKLE--QNTVETPVGYTWLPLLKDGQL  465
             KCP   DEIKI LP +++  HHLLFT YH+SCQKK +  Q +VETP+GYTWLPLL+DG+L
Sbjct  653   KCPSFYDEIKIALPASIKQHHHLLFTIYHVSCQKKPQDLQPSVETPIGYTWLPLLEDGKL  712

Query  466   QLNDFCLPVTLEAPPPNYSYITPDVLLPGLKWVDNHKSIFNVVLSAASSIHPQDTHIHEF  525
             +  +F LPV +E+PP NYS+I P+V LPG+KW+DNH+++F++ + A ++IH  D+ +  F
Sbjct  713   KFGEFNLPVMVESPPENYSFIPPNVHLPGIKWLDNHRAVFSINVEAVTAIHTLDSFLDRF  772

Query  526   LSICDKLETGGVVSNRLPEINFEAELRQKILNLVNCKLEPLIKFLTIILNKLIYLMTQPL  585
               IC+ L+T  + S+ + E N E EL++ +L++     EPL++ L ++L+KLI L+    
Sbjct  773   FLICEYLDTRNIPSH-IGENNIETELKKCLLDIEYANREPLVRHLPLVLDKLIELLVVTH  831

Query  586   CMNGQSLCISQTVFEVIGLIIKFVSAFSEDESDACGRHPLLTSYVTYQCCIPHPDLEQKR  645
              + GQ++ +  TVFEV+ L+   +S  ++D+ D  GR  LL++YV +QC IPHP   ++R
Sbjct  832   KVGGQAMSLGSTVFEVLCLVSSLLSILNDDQYDQYGRQSLLSTYVHFQCKIPHPFQSKQR  891

Query  646   SNMQRQKSSSNPDLQLDIEVQAYN-----ARGLDRTCSMKAGQCADNFASGSKLNL-CKI  699
                 R   S+  DLQL      Y+      R LDR          D   S +  ++  ++
Sbjct  892   LTCSR---STTEDLQLSESYTIYDNVLASGRSLDR-----KELSIDVLHSMAARDVQVRL  943

Query  700   LHEEIGLQWVVSSSTARENAMSHAWFFFDLMAKSMVEHLSITETMDSPRKMRFSDQYMED  759
             LHEE+ L WVV+S  A + AMS++WF F+L+ KSM+EHL  + T++ PRK RF  Q+ +D
Sbjct  944   LHEELALHWVVASGKAADLAMSNSWFLFELIVKSMIEHLHCSNTLNGPRKHRFPHQFNDD  1003

Query  760   IATLVTSFTSDIIAYCHKDYKLTRSMNTSLAFFLFDLFSFADRSFVFLLIKTYYKHVTAK  819
             ++TLV   T+ ++ Y   + KL +S+N SL FF+FD+ S  DR FVF LIKTY K + +K
Sbjct  1004  LSTLVHLVTTKVVGYHSNEPKLAQSLNASLGFFIFDILSIMDRGFVFGLIKTYTKVLISK  1063

Query  820   ISSLPDSIALSNLKLEFLRVVCSHEHFVPLNLPFGTVFTANSSSTSPSPSTNSSTSQSSY  879
              +S+PD   L N K++FLR+VCSHEHFV LNLPFGT +T     T+P  S   ST+ S+ 
Sbjct  1064  NASIPD---LMNYKIDFLRIVCSHEHFVALNLPFGTSYTM---VTAPC-SPTPSTTSSNS  1116

Query  880   MSSLISKDKSPFAELSLEFKQQHYLVGLILSEFAAMIEVQNHNFHNRIVTLITDLMASHD  939
              +S  S +++  A+LS EF QQH+LVGL+LS+ AA++EV N   H + +  I +LM SHD
Sbjct  1117  QTSCGSLERALHADLSQEFLQQHFLVGLVLSDLAAVMEVPNPQLHGKAIRCIRNLMTSHD  1176

Query  940   CDARFVEPEAKARVAALYLPYIALTMDMLPNLHS-GNDVSRIINPTSEESVE--------  990
              DAR+ E +A+ARVAALY+P +++ MD +P LH  G +  R+      E  +        
Sbjct  1177  LDARYSETDARARVAALYIPLLSIVMDCIPQLHQHGLEQDRLQQIGQLEDYQGPHQTITA  1236

Query  991   SGLNQSVAMAIAGTSMFGIKTDNYKLFQQTRKVNLSMDNTKNILICFLWILKNMDKDILK  1050
             S +N  VA AI+G+  +    +  K      K+ LS +NT+++L+CFLW+LKN+++++L 
Sbjct  1237  STINPEVAFAISGSRPYSYLNEQVK-----NKLPLSSENTRHLLVCFLWVLKNLERNVLY  1291

Query  1051  QWWAEMPVSRLNQLLQVLGSVC  1072
             +W  ++   R++Q+LQ + +VC
Sbjct  1292  RWLMDLSPHRVHQMLQGV-NVC  1312


 Score = 156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 132/212 (62%), Gaps = 20/212 (9%)

Query  1    MASFQRAFAQKLSGQNAADVRRQVSSVSGELPKSESRMSFIFTSITDVVDPIDYEDFILQ  60
            M+S QR+F QK+S Q+AADVR+ VS     L K+    S   +SI+   +P+DYE+F+ Q
Sbjct  1    MSSAQRSFVQKVSKQSAADVRKNVSGC--HLSKAMDP-SLCGSSISPT-EPLDYEEFLSQ  56

Query  61   QSLLIDRDPLKHLLEFPVDDIQVCVLPRKIRTVKPLLPKEPLSELEPHVRECIECYTRNW  120
               +I+RDPLKH+L+FP  D+ V ++PRKIRTV  ++P E LS+L  HV+EC+ CYTR W
Sbjct  57   HMNIINRDPLKHILDFPQGDVTVKIIPRKIRTVDHVVPNENLSDLPHHVQECVNCYTRPW  116

Query  121  IYVDYRYRHFSTSSWF---IDRTTLASNLPRQEFEVDMTPLPNGRVSPQPSYKSQ----S  173
              V+Y  RH S+S +    IDR T++ +  +QEFE+D             +YKS+    S
Sbjct  117  KVVEYAQRHLSSSCYIRERIDRGTISPSAYQQEFEIDKD---FSSFEEAFAYKSESCTPS  173

Query  174  SRDSRVS----SSGGD--TPRGSWASFDLLNS  199
            SR S  S    SS  D  TPRGSWASFDL  S
Sbjct  174  SRQSIASLASVSSCTDTLTPRGSWASFDLRRS  205


>B7Z0R2_DROME unnamed protein product
Length=2002

 Score = 32.3 bits (72),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 29/128 (23%), Positives = 53/128 (41%), Gaps = 11/128 (9%)

Query  345  RNLLFVYPKEINFT-GRTGSARNLTVKVQLM--YGETPESALPAIFGKSSCPEFTTEAYT  401
            RN LF+  +   F  G   + +N+ V V ++   G      L    G  S P++ +    
Sbjct  415  RNDLFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRS----  470

Query  402  SVIYHNKCPYVSDEIKIQLPPTLEDKHHLLFTFYHISCQKKLEQNTVETPVGYTWLPLLK  461
             ++YH   P  ++ +++ +P       H+ F F H S + K E         +++  L+ 
Sbjct  471  MILYHQNAPSWNEMLRLSVPIDKFSTAHVRFEFRHCSTRDKTEPKL----FAFSFARLMD  526

Query  462  DGQLQLND  469
             G   L D
Sbjct  527  TGGATLGD  534


>A0A0B4KHD2_DROME unnamed protein product
Length=2008

 Score = 32.3 bits (72),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 29/128 (23%), Positives = 53/128 (41%), Gaps = 11/128 (9%)

Query  345  RNLLFVYPKEINFT-GRTGSARNLTVKVQLM--YGETPESALPAIFGKSSCPEFTTEAYT  401
            RN LF+  +   F  G   + +N+ V V ++   G      L    G  S P++ +    
Sbjct  415  RNDLFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRS----  470

Query  402  SVIYHNKCPYVSDEIKIQLPPTLEDKHHLLFTFYHISCQKKLEQNTVETPVGYTWLPLLK  461
             ++YH   P  ++ +++ +P       H+ F F H S + K E         +++  L+ 
Sbjct  471  MILYHQNAPSWNEMLRLSVPIDKFSTAHVRFEFRHCSTRDKTEPKL----FAFSFARLMD  526

Query  462  DGQLQLND  469
             G   L D
Sbjct  527  TGGATLGD  534



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02580.1.1 anoctamin-8

Length=72
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ELYS_DROME  unnamed protein product                                   25.8    1.8  


>ELYS_DROME unnamed protein product
Length=2111

 Score = 25.8 bits (55),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  33    IASKQMEELNLTTGGELSPLSPNLQTNDSITSL  65
             I S   E+ N+++ G  +P+ P L T+D + S+
Sbjct  1486  IYSLSSEDSNVSSAGIRNPMLPTLHTDDPMYSI  1518



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02590.1.1 Anoctamin

Length=872
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97132_DROME  unnamed protein product                                 218     4e-61
A0A0B4JCY1_DROME  unnamed protein product                             110     9e-25
Q9VDV4_DROME  unnamed protein product                                 110     1e-24


>O97132_DROME unnamed protein product
Length=646

 Score = 218 bits (556),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 149/494 (30%), Positives = 243/494 (49%), Gaps = 39/494 (8%)

Query  210  IPKCLSEGLISQMYPLHELDGLEQLRQNWVRTFVKKQPLDSVCKYFGVKIAMYFAWLGHY  269
            I   + +G I  M+PLH++  LE+   N  RT   K P++ +  YFG  I +YF ++  Y
Sbjct  164  IKSYVQKGYIEDMFPLHDILYLERFNWNLKRT---KLPIEDIRNYFGSSIGLYFGFIEFY  220

Query  270  TYMLIIPAFVGFIFWIGFGRGDQSSEDIGYVLFSLFNVVWFSIYLEAWKRYSSELAYKWG  329
            T  LI P+  G +         Q   D+   L   F VVW +I+LE WKR  +  +Y+WG
Sbjct  221  TKALIFPSLFGIL---------QYVFDLNISLVCSFYVVWTTIFLELWKRKCAGYSYRWG  271

Query  330  TLDQRHELLMEPRPLYSGNLVVSPVTGRLEPTYPSWKRHVFRYFVSVPIIALCLLVVLSV  389
            T++     L +PR  Y+G L   P+TG++   YP    ++  Y +S P++  C++     
Sbjct  272  TIEMSS--LDKPRSAYTGQLKPDPITGKMTLHYPMRYTYLQMYCISYPVVLGCVVAAGWF  329

Query  390  MIASLKVQDWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWLNDMGIHVFVS  449
             +   +++    + + + G   WL YVP ++ +V+I +   AY K+A +L ++  H   S
Sbjct  330  ALYQFQIE---AEVLADFGPDSWLLYVPVIVQSVLIAIFSWAYEKLATFLTNLENHRTRS  386

Query  450  Q---QLATLLITRQLIGN-IKESALPYVQEQFRLAK-------LSFDLYGA--------L  490
            Q        L+  +++ N   +  + +V    R  K       L F L           L
Sbjct  387  QYDRHRVNKLMLFEIVNNFFSQFYIAFVLHDLRQLKYQLMMQLLVFQLLCIAQEIGIPLL  446

Query  491  SPSEAKKSDGTTNDFDSASNGKPSSGGGNRNVSQAELESTLLKYEGTFADHLEMFIQLGY  550
            +    K ++    +    +  K  S        Q+  ES L +Y  T+ D+L++ IQ G+
Sbjct  447  AVLRQKYAEFRHRE---VAEEKLRSISDLPRYEQSFYESGLDEYHSTYEDYLQVCIQFGF  503

Query  551  VVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIPNIGMWQNGMEVMSLVSV  610
            VVLF+   P AA+ ALLNN+  +  D +KLC IF+RPF +R  NIG WQ   E++S++S+
Sbjct  504  VVLFAAVAPFAAIGALLNNVFAVHIDMWKLCNIFKRPFARRAKNIGAWQLAFELLSVMSL  563

Query  611  LVNCALIGLSGQVHRMFPEMSRTQTILLIVALEHIMFAVRFIISCVIPDLPDWVATEMAK  670
            L NC L+ L   V   F     +   L  V  EH++  ++F+I  VI + P WV   + K
Sbjct  564  LSNCGLLFLQPNVKDFFSHWLPSVPDLSFVIFEHLLLGLKFLIHKVIHERPRWVRIGLLK  623

Query  671  VEFARREALSRISS  684
             +F   +AL ++  
Sbjct  624  ADFETSQALKQLKK  637


>A0A0B4JCY1_DROME unnamed protein product
Length=1099

 Score = 110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 90/295 (31%), Positives = 132/295 (45%), Gaps = 84/295 (28%)

Query  173  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  228
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  351  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  400

Query  229  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  280
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  401  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  460

Query  281  FI------------------------------------FW-----IGFGRGDQSSEDIGY  299
             I                                    FW       + +     ++   
Sbjct  461  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  520

Query  300  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  353
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  521  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  577

Query  354  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV  396
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV
Sbjct  578  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKV  632


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 0/89 (0%)

Query  535  EGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIPN  594
             G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL    +RP  QR+ +
Sbjct  807  RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRD  866

Query  595  IGMWQNGMEVMSLVSVLVNCALIGLSGQV  623
            IG+W   ++ +  +SV+ N  +I  +  +
Sbjct  867  IGVWYRILDCIGKLSVITNGFIIAFTSDM  895


>Q9VDV4_DROME unnamed protein product
Length=1075

 Score = 110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/295 (31%), Positives = 132/295 (45%), Gaps = 84/295 (28%)

Query  173  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  228
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  327  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  376

Query  229  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  280
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  377  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  436

Query  281  FI------------------------------------FW-----IGFGRGDQSSEDIGY  299
             I                                    FW       + +     ++   
Sbjct  437  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  496

Query  300  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  353
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  497  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  553

Query  354  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV  396
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV
Sbjct  554  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKV  608


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 0/89 (0%)

Query  535  EGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIPN  594
             G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL    +RP  QR+ +
Sbjct  783  RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRD  842

Query  595  IGMWQNGMEVMSLVSVLVNCALIGLSGQV  623
            IG+W   ++ +  +SV+ N  +I  +  +
Sbjct  843  IGVWYRILDCIGKLSVITNGFIIAFTSDM  871



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


Query= Dcitr00g02600.1.1 Interferon-inducible

Length=1276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJY9_DROME  unnamed protein product                                 73.2    3e-13
X2J5X6_DROME  unnamed protein product                                 72.8    3e-13
M9MRT5_DROME  unnamed protein product                                 68.6    5e-12


>Q9VJY9_DROME unnamed protein product
Length=465

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  608  VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  665
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  666  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  712
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  713  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  772
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  773  AKMLVRLQE  781
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


 Score = 38.1 bits (87),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  332  STKTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKK  388
            + KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKK  190

Query  389  QAKHKTAKNMLIEL  402
            +AKH  A+ ++ +L
Sbjct  191  EAKHAAARALIDKL  204


 Score = 35.4 bits (80),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query  108  VEANDLGDLNKKTPASILDEHLADQKEIPNYIFSETLDPSSSKTLQ-KCSLTLFDGLLSA  166
            V   D   L  KTP SIL E L+ +   P Y   +        T + + S    D   +A
Sbjct  123  VSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTA  182

Query  167  TGEGLTKKEAKQKTAESMLVKL  188
             G G +KKEAK   A +++ KL
Sbjct  183  MGAGRSKKEAKHAAARALIDKL  204


>X2J5X6_DROME unnamed protein product
Length=464

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  608  VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  665
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  666  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  712
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  713  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  772
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  773  AKMLVRLQE  781
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


 Score = 38.1 bits (87),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  332  STKTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKK  388
            + KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKK  190

Query  389  QAKHKTAKNMLIEL  402
            +AKH  A+ ++ +L
Sbjct  191  EAKHAAARALIDKL  204


 Score = 35.4 bits (80),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query  108  VEANDLGDLNKKTPASILDEHLADQKEIPNYIFSETLDPSSSKTLQ-KCSLTLFDGLLSA  166
            V   D   L  KTP SIL E L+ +   P Y   +        T + + S    D   +A
Sbjct  123  VSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTA  182

Query  167  TGEGLTKKEAKQKTAESMLVKL  188
             G G +KKEAK   A +++ KL
Sbjct  183  MGAGRSKKEAKHAAARALIDKL  204


>M9MRT5_DROME unnamed protein product
Length=359

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 58/198 (29%), Positives = 86/198 (43%), Gaps = 19/198 (10%)

Query  610  MKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFGGQ--YQSTGSGQSKKQ  667
            MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SKK+
Sbjct  133  MKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKKE  191

Query  668  AKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSSIKN---NS  714
            AKH AA  ++ KL          S   P +  L       +     T    +      N 
Sbjct  192  AKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVGNP  251

Query  715  IFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSAAK  774
            I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A +
Sbjct  252  IGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHR  311

Query  775  MLVRLQE---ELNKIAES  789
            M +RLQE   +  KI++S
Sbjct  312  MWMRLQETPIDSGKISDS  329


 Score = 37.0 bits (84),  Expect = 0.046, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query  108  VEANDLGDLNKKTPASILDEHLADQKEIPNYIFSETLDPSSSKTLQ-KCSLTLFDGLLSA  166
            V   D   L  KTP SIL E L+ +   P Y   +        T + + S    D   +A
Sbjct  123  VSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTA  182

Query  167  TGEGLTKKEAKQKTAESMLVKL  188
             G G +KKEAK   A +++ KL
Sbjct  183  MGAGRSKKEAKHAAARALIDKL  204


 Score = 37.0 bits (84),  Expect = 0.050, Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (51%), Gaps = 2/73 (3%)

Query  332  STKTPVSLLHEYLVDQKELPDYEFSKVDS--DPSSLWFHCKLKILNGRYFAEATGLTKKQ  389
            + KTPVS+L E L  +   P YE  +++      +  F    K  +  + A   G +KK+
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKE  191

Query  390  AKHKTAKNMLIEL  402
            AKH  A+ ++ +L
Sbjct  192  AKHAAARALIDKL  204


 Score = 30.4 bits (67),  Expect = 5.6, Method: Composition-based stats.
 Identities = 22/74 (30%), Positives = 39/74 (53%), Gaps = 9/74 (12%)

Query  45   VFSYELNLFNGAYIARGSGPNKKIAKQETAKNMLMQLSRDRSNVKALLDKNKIQEPSLCK  104
            +F+   ++ N  Y   G G +KKIAK+  A  M M+L       +  +D  KI + S+C 
Sbjct  282  LFTIACSILN--YREMGKGKSKKIAKRLAAHRMWMRLQ------ETPIDSGKISD-SICG  332

Query  105  SIEVEANDLGDLNK  118
             +E E + + D+++
Sbjct  333  ELEGEVSIIQDIDR  346



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2200100221


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g02610.1.1 Unknown

Length=203


***** No hits found *****



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02620.1.1 ethanolamine-phosphate

Length=90
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TAD2A_DROME  unnamed protein product                                  26.6    1.6  
Q9W279_DROME  unnamed protein product                                 26.6    1.9  
AGT2L_DROME  unnamed protein product                                  26.2    2.7  


>TAD2A_DROME unnamed protein product
Length=562

 Score = 26.6 bits (57),  Expect = 1.6, Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query  26  LTTENVLFIVSTL----NRILTSLQMDSSPAIMDLLLPRTSDTLVQQWPDSSGDSDASSP  81
            TT N LF V  L     R + + Q + +   M L  P T    +++  + + D ++S P
Sbjct  28  FTTLNCLFAVEPLGPQVKRFIHAHQNEHTRNSMVLYNPHTLHRYLEEMEEKTRDQNSSVP  87

Query  82  AASYNA  87
           +A+ +A
Sbjct  88  SATKDA  93


>Q9W279_DROME unnamed protein product
Length=417

 Score = 26.6 bits (57),  Expect = 1.9, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 9/41 (22%)

Query  46   QMDSSPAIMDLLL----PRTSDTLVQQWPDSSGDSDASSPA  82
            Q+   P+  DL++     +TSD     WP +SG SD  SPA
Sbjct  215  QLGLGPSDADLVVHDLGGKTSD-----WPAASGASDLESPA  250


>AGT2L_DROME unnamed protein product
Length=494

 Score = 26.2 bits (56),  Expect = 2.7, Method: Composition-based stats.
 Identities = 9/26 (35%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  5    KIIVANEGEYGNVLLFLPAMCLTTEN  30
            +++V+++G   NV+   P MC   EN
Sbjct  410  RVLVSSDGPNDNVIKLKPPMCFNREN  435



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02630.1.1 Solute

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVH9_DROME  unnamed protein product                                 703     0.0   
Q9W270_DROME  unnamed protein product                                 337     9e-106
Q9VK84_DROME  unnamed protein product                                 338     9e-106


>Q9VVH9_DROME unnamed protein product
Length=819

 Score = 703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/728 (51%), Positives = 480/728 (66%), Gaps = 62/728 (9%)

Query  7    DDEGRKNEAEYRLLPEKVNGNGN---LNVEFVNSSSHKNGNGYK--------SSYEVDED  55
            +D G        +L    NG GN   L+ ++ +  +   G GYK           + D D
Sbjct  86   EDLGHLKNGLGNILSSNNNGTGNGHSLSEKYAHEQAPLTG-GYKLPPRSSESEESDFDSD  144

Query  56   MK----------CGLGPCTPNWMQVFTNKKAFLFTFCITWVLQGMYYTYFVSVITTIEKL  105
            +           CGL  C P W + F +   F+  F + ++LQGMY TYFVSVITTIEKL
Sbjct  145  LNGGSSAESSSSCGLFGCRPRWARRFASTHVFMVVFLLAYILQGMYMTYFVSVITTIEKL  204

Query  106  FQVQSKTTGIIMSATEIGQIGSSLLLTYYGGQGHRPRWIAWGMVLFAASSFICALPHFIF  165
            FQ++SKTTGI++SA+E+GQI +++LLTY+ G+GHRPRWIA GMVLF+ ++F CALPHFIF
Sbjct  205  FQIKSKTTGILLSASEMGQICTAMLLTYFAGRGHRPRWIACGMVLFSIAAFSCALPHFIF  264

Query  166  GDQPLNKQNLIFQGDNGTIDLPPNLCY-----------IPPSLTLSGNITMHDTSLDQCH  214
            G+Q ++   ++ Q    T   PPN  +           + P+L + G    H  S  +C+
Sbjct  265  GEQLMHSSVILQQ----TQVSPPNNSFSSHWLNASSEQVNPNLCILGGNQTHSGS--ECN  318

Query  215  KEKWDEQQAQSQITTIVLVIFFISLLGVGMGQTAVYTLGIPYIDDNVANRESPLYFAITI  274
            +E+  EQ + S+IT IVL IFF SLL  G+GQTAV TLGIPYIDDNV +++SP+Y A+TI
Sbjct  319  EERQLEQASHSKITVIVLCIFFGSLLSSGIGQTAVATLGIPYIDDNVGSKQSPMYMAVTI  378

Query  275  GVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMF  334
            G+RILGP+ GFI GSFCTR YV+ S P     +DPRWIGAWWLG V +   ++LA++AMF
Sbjct  379  GMRILGPASGFIFGSFCTRWYVNFSNPG-FDATDPRWIGAWWLGPVAIGSLMLLASIAMF  437

Query  335  MFPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLH  394
             FPK L       G T     P + E   + P LKDFPK V+R L NDILM+RTAS V H
Sbjct  438  SFPKQLRGKQKPPGQTATPAAPVEPE---EKPKLKDFPKTVRRQLSNDILMFRTASCVFH  494

Query  395  ILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVA  454
            +LPIAGLYTFLPKY ETQFRL ++ ANM++   GILVMGIGI++SG+FILK KP AR VA
Sbjct  495  LLPIAGLYTFLPKYLETQFRLATYDANMIAAFCGILVMGIGIVISGLFILKRKPTARGVA  554

Query  455  AWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISS--FEPMCATTHGCECDHSKFNP  512
            AWIA TA++Y+ GM IL FIGC M+++AG   ++G S    EP C+    C CD   F P
Sbjct  555  AWIAFTALVYSAGMIILMFIGCSMNDFAGYKPSDGNSPALIEPTCSAALNCTCDKENFAP  614

Query  513  ICGGDGRTYFSACHAGCQNIS--SIDGK--FSNCTCMSGMWGNGTILPDPLATTASLGPC  568
            IC  DG+ Y SACHAGC + S    D +  +S+C C+            P A  A  G C
Sbjct  615  ICA-DGKMYISACHAGCSSSSLRPSDNRTLYSDCACI------------PDAPEAVNGYC  661

Query  569  ENDCVSVKWYIILFSFFVFIHSTSEVGSMLLILRCVDPSDKAMALGLIQFAIGLFGNVPC  628
            +N+C +  ++I++F+  VF+HSTSEVGSMLL++RC  P DKAMA+G+IQ AIGLFGNVPC
Sbjct  662  DNNCKNFIYFILIFAICVFMHSTSEVGSMLLVMRCTHPKDKAMAMGVIQSAIGLFGNVPC  721

Query  629  PIVYGAVVDSACLVWESVCGEKGACNLYDTDVFRVFYHGTTGFILLLAFFVDTIVWYKAG  688
            PI+YGAVVDSACL+W+SVCG+ GAC+LYD D FR ++ G T  I+ LAF +D +VW KA 
Sbjct  722  PIIYGAVVDSACLIWKSVCGKHGACSLYDADTFRQYFLGITAGIMFLAFLMDLVVWRKAH  781

Query  689  SINFADEE  696
             I+ A E+
Sbjct  782  RIDIAPED  789


>Q9W270_DROME unnamed protein product
Length=680

 Score = 337 bits (863),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 212/680 (31%), Positives = 330/680 (49%), Gaps = 49/680 (7%)

Query  54   EDMKCGLGPCTPNWMQVFTNKKAFLFTFCITWVLQGMYYTYFVSVITTIEKLFQVQSKTT  113
             D  CG        +Q F     F+  + I      M +TYF   ITT+EK F + +K +
Sbjct  31   SDTTCGFSIFRGPALQRFATAHMFVIVYGIASCFLAMAFTYFTGTITTMEKRFNIPTKIS  90

Query  114  GIIMSATEIGQIGSSLLLTYYGGQGHRPRWIAWGMVLFAASSFICALPHFIFGDQPLNKQ  173
            G+I    +I  + SS  L+YY  +GHRPRW+A G+++ A    +   PH  +G     ++
Sbjct  91   GLITVGNDISTVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTPHIFYGP---GEE  147

Query  174  NLIFQGDNGTIDLPPNLCYIPPSLTLSGNITMHDTSLDQCHKEKWDEQQAQSQITTIVLV  233
             L    + G          +  S   S NIT  + SL  CH++  +  +     T IVL 
Sbjct  148  ALRLTEEYG----------MSESFGASLNITEKNDSL--CHEKNSNCLERAGDYTPIVL-  194

Query  234  IFFISLLGVGMGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTR  293
             FFI+    G+G +  Y  G+ Y+DDN A+ ++P   + +  +R+LGP++GF + S C R
Sbjct  195  -FFIAQFIGGIGCSLFYAPGLSYMDDNSASSKTPAMLSWSSFLRMLGPAMGFSMVSLCLR  253

Query  294  LYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVA  353
            LY+D      IT +DPRW+GAWW+G +L+   L ++AV + MFPK + +A          
Sbjct  254  LYIDPFKKPLITTNDPRWMGAWWIGWILLTFILTISAVFVGMFPKEMPRAKARR------  307

Query  354  TLPTKKESNQKNP----SLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYF  409
                K +  +  P    S +D   ++KRL  N + +Y   +S+L++      + F PKY 
Sbjct  308  ---LKADGEEDIPLAGRSFQDMLDSLKRLASNKVYVYNMLASILYLFGYMPYWIFTPKYI  364

Query  410  ETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMG  469
            E Q+R  + T+ M +G   +     GI++SG  I K+KP+AR +AAW  +   L   GM 
Sbjct  365  EIQYRQSASTSTMATGTWALGFSAAGILISGYVISKYKPSARAMAAWNFVVDYLTVAGML  424

Query  470  ILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGC  529
                +GC   +      AN +S      + +  C C++  + P+C  +  T+ SACHAGC
Sbjct  425  CYVLVGCDESD-----RANSLSIVPTGDSCSASCVCEYVYYAPVCSPENITFISACHAGC  479

Query  530  QNISSID-GK--FSNCTCMSGM-----WGNGTILPDPLATTASLGPCENDCVSVKWYIIL  581
             + +  + GK  ++ C CM  +       N T L    +  A  G C  DC   K ++I 
Sbjct  480  TDKAINELGKTIYTGCRCMGNVSSIISLSNVTSLASQ-SQIAMDGACPVDC--NKQFLIF  536

Query  582  FS---FFVFIHSTSEVGSMLLILRCVDPSDKAMALGLIQFAIGLFGNVPCPIVYGAVVDS  638
             +   F  F+ +T    ++LL LRCV   DK  +LG       +   +P PIV+G ++DS
Sbjct  537  LAVMCFLKFVGATGRSSNLLLALRCVPSKDKTFSLGFGSMVYSVLAFIPSPIVFGWMLDS  596

Query  639  ACLVWESVCGEKGACNLYDTDVFRVFYHGTTGFILLLAFFVDTIVWYKAGSINFADEETN  698
             CLVW   C  KG C +YDT   R   +     ++ L  F +  VWY A  +   DE+  
Sbjct  597  YCLVWGKTCSSKGNCWIYDTKSLRYTMNLVCASLIFLGSFWNIGVWYHAKDMKVFDEDEK  656

Query  699  TPEDDEMQAMTEKIKPETCV  718
            T +  +   +  K KP   V
Sbjct  657  TVQAKQSDDIELKEKPNDVV  676


>Q9VK84_DROME unnamed protein product
Length=745

 Score = 338 bits (868),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 221/741 (30%), Positives = 344/741 (46%), Gaps = 106/741 (14%)

Query  58   CGLGPCTPNWMQVFTNKKAFLFTFCITWVLQGMYYTYFVSVITTIEKLFQVQSKTTGIIM  117
            CG+    P W+Q +   K F+  + +   +Q M Y YF+  +TT+EK F++ S+TTGII+
Sbjct  18   CGMANWHPPWLQKYATTKMFMGVYGLLGTIQAMSYMYFIVTLTTLEKRFKIPSQTTGIIL  77

Query  118  SATEIGQIGSSLLLTYYGGQGHRPRWIAWGMVLFAASSFICALPHFIFG------DQPLN  171
            S  EI QI  SL+L+Y GGQ +RPRWIAWG+V    S +I  LPHFI+G           
Sbjct  78   SGNEISQIMLSLILSYIGGQRNRPRWIAWGIVFCGLSCYILVLPHFIYGAGHEVLQFTKE  137

Query  172  KQNLIFQGDNGTIDLPPNLCYIPPSLTLSGNITMHDTSLDQCHKEKWDEQQAQSQITTIV  231
             Q+ +  G  G+     N+  +      +  +   D + D C              + + 
Sbjct  138  YQDSLLNGTTGSDHSFQNISSVK-----TERLCGVDKTEDDC----------DDLFSYVP  182

Query  232  LVIFFISLLGVGMGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFC  291
            LV+ F+S   +G+G T  Y+LG  Y+DDN     +PL  A+ + +R++GP +GF  G   
Sbjct  183  LVLIFLSQFVLGVGNTLYYSLGQTYLDDNTKKTNTPLMLAVAMALRMIGPVVGFFFGFIS  242

Query  292  TRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTK--ASPVNGT  349
               ++D +    I   DPRW+GAWWLG V++   + L +  + +FPK L K  AS  N  
Sbjct  243  LNTFIDPTKTPLIDSKDPRWLGAWWLGWVILGTLMCLFSGLIGLFPKQLPKVNASRTNSH  302

Query  350  TTVATLPTKKE---------------------------SNQKNPSLKDFPKAVKRLLKND  382
              +A   TK+E                           +N   P LKDFP+A+ RLL+N 
Sbjct  303  LPLALRQTKEELKREENLSLSSRFSSNAALDTIGAAAGANADLPKLKDFPRALMRLLRNK  362

Query  383  ILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVF  442
            +L++   S+V +IL  +G  TFL KY E QF   + +A ++ G   I+ M +G+I SG+ 
Sbjct  363  LLIFNILSAVFYILGASGFMTFLTKYMEVQFHKDAQSATIIVGPISIMGMVVGLIGSGMV  422

Query  443  ILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHG  502
            + K KP+   V  W  I   +  LG     F+ CP      +T A G  +    C     
Sbjct  423  LSKKKPSVSKVLMWNVIVGGISILGQISYAFLYCP--NTFSMTQA-GQLNLTSNC--NMN  477

Query  503  CECDHSKFNPICGG-DGRTYFSACHAGCQNISSIDGKFSNCTCM----------------  545
            C C+   + P+C      T+FSACHAGC+  ++    + +C+C+                
Sbjct  478  CSCEGISYTPVCHEPTDTTFFSACHAGCRGYNATSKLYEDCSCVVNDPAPKSAAQRLLNL  537

Query  546  ---------------------------SGMWGNGTILPDPLATTASL---GPCENDCVSV  575
                                       +G + +  +     +T+ S+   G C  +C   
Sbjct  538  LQPTPEPELDTTTYFDEYLSGVPLLDDNGDFDDQLLSRTRRSTSDSVIRPGICTKNCNWS  597

Query  576  KWYIILFSFFV-FIHSTSEVGSMLLILRCVDPSDKAMALGLIQFAIGLFGNVPCPIVYGA  634
             W   + S  V +  S+  VG++L+  R V   DK+ A GL    I L   +P PI++G 
Sbjct  598  FWAFSITSMIVSWFGSSGRVGNVLVNYRAVAHEDKSFAQGLALMMISLLALIPGPIIFGR  657

Query  635  VVDSACLVWESVCGEKGACNLYDTDVFRVFYHGTTGFILLLAFFVDTIVWYKAGSIN-FA  693
            ++DS CLVW   C   G C LYD   FR   +  +  +  +    D +VWY   +++ + 
Sbjct  658  LIDSTCLVWTKTCNGNGNCQLYDQTRFRYSLNFLSCLLTFMGLLFDYLVWYYGRNLDIYG  717

Query  694  DEETNTPEDDEMQAMTEKIKP  714
            D+E    E++      + I P
Sbjct  718  DKEAK--EEERANRKDQPITP  736



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02640.1.1 Unknown

Length=127
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3H9_DROME  unnamed protein product                                 26.9    3.1  
Q9W4B8_DROME  unnamed protein product                                 26.2    5.3  
Q7K3N8_DROME  unnamed protein product                                 26.2    6.0  


>Q9V3H9_DROME unnamed protein product
Length=1004

 Score = 26.9 bits (58),  Expect = 3.1, Method: Composition-based stats.
 Identities = 25/90 (28%), Positives = 40/90 (44%), Gaps = 13/90 (14%)

Query  35   SCSSQFAEFYEEEL-------YELEDLCYMYQYENAKSGKNVSSCLFSECRNYKSKPWNR  87
            +C+ QF E+Y            +  D C MY +   K      +C+  +C NY +    R
Sbjct  864  NCTKQFCEYYHPTAPCKSFPNCKFADKC-MYSHPKCKFDM---ACMSIDC-NY-AHGGQR  917

Query  88   DNITYHLAAHKLSTYLFVDKNYRMTAINVT  117
            D     LAA  LS+++   +NY+  +  VT
Sbjct  918  DLSHVQLAAPPLSSHVIPVQNYKSISAPVT  947


>Q9W4B8_DROME unnamed protein product
Length=611

 Score = 26.2 bits (56),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 25/53 (47%), Gaps = 3/53 (6%)

Query  40   FAEFYEEELYELEDLCYMYQYENAKSGKNVSSCLFSECRNYKSKPWNRDNITY  92
            F E+Y  EL ELE+    Y  E+   G + S  L +    +   PW   NITY
Sbjct  180  FKEYYWRELSELEEKIMSYGSED--DGFD-SGDLVTRIPPFWMMPWPNGNITY  229


>Q7K3N8_DROME unnamed protein product
Length=560

 Score = 26.2 bits (56),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 25/53 (47%), Gaps = 3/53 (6%)

Query  40   FAEFYEEELYELEDLCYMYQYENAKSGKNVSSCLFSECRNYKSKPWNRDNITY  92
            F E+Y  EL ELE+    Y  E+   G + S  L +    +   PW   NITY
Sbjct  129  FKEYYWRELSELEEKIMSYGSED--DGFD-SGDLVTRIPPFWMMPWPNGNITY  178



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02650.1.1 major

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I0B7_DROME  unnamed protein product                                 29.3    1.6  
MRJP1_APIME  unnamed protein product                                  28.9    2.3  
Q9VBV8_DROME  unnamed protein product                                 28.5    3.1  


>Q8I0B7_DROME unnamed protein product
Length=563

 Score = 29.3 bits (64),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query  18   CPAKIIQYDVWFSSFVKQRVLDTIDNHHLNSLILDTHSDVLYISDAGDCSILVMKPTDLE  77
            CP + + YD  FS  V  +    I+N  L   I    S   ++ DA    + V KP D E
Sbjct  112  CPLRNL-YDPLFSEIVA-KAEGAIENGVLPERIYQGSSGSYFVKDASHQCLAVFKPKDEE  169

Query  78   -YTRCYARYNEYI  89
             Y R   ++ +++
Sbjct  170  PYGRLNPKWTKWM  182


>MRJP1_APIME unnamed protein product
Length=432

 Score = 28.9 bits (63),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 105/260 (40%), Gaps = 42/260 (16%)

Query  4    KAKFLFVLDTG-----SKKCPAKIIQYDVWFSSFVKQ-------RVLDTIDNHHLNSLIL  51
            K   L+VLD+G        C  K++ +D+  S  +KQ        V  T     L+SL +
Sbjct  131  KCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAV  190

Query  52   -----DTHSDVL-YISDAGDCSILVMKPTDLEYTRCYARYNEYIVPVLTLGACNGHLYMT  105
                 +T+SD + YI+D     ++V   +D  + R  +   +Y  P  T    +G  Y T
Sbjct  191  QSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYD-PKFTKMTIDGESY-T  248

Query  106  SYDSDMLFTLSARDIQKRLSAASNMS---SLTLQTRFLGYK------------LGISSGL  150
            + D      LS        S  ++ S     T Q R   Y+            L   S  
Sbjct  249  AQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSA  308

Query  151  YCDEPDGLLYY-LIRDYAIVRWSLNTPLIAENHLVLVQSEQVFPYVSEFFKEKSSDHVFA  209
                  G+L++ L+ D A+  W+ +  L   N   + QS++    ++    +++  HV  
Sbjct  309  KVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHV--  366

Query  210  LNSIYNRY--HKYTVKLQNR  227
               I++RY   +Y + L N+
Sbjct  367  --PIFDRYINREYILVLSNK  384


>Q9VBV8_DROME unnamed protein product
Length=623

 Score = 28.5 bits (62),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 22/97 (23%), Positives = 40/97 (41%), Gaps = 1/97 (1%)

Query  45   HLNSLILDTHSDVLYISDAGDCSILVM-KPTDLEYTRCYARYNEYIVPVLTLGACNGHLY  103
             + S++    + V Y+  +   +ILVM   T L  +R +A Y  Y  P+  +   N    
Sbjct  411  RMKSVVFKIKAGVHYLDHSMFIAILVMVTSTLLGLSRVFALYRNYHAPMDLMLELNQFKA  470

Query  104  MTSYDSDMLFTLSARDIQKRLSAASNMSSLTLQTRFL  140
               YD D+++ +       R   +    +   + RFL
Sbjct  471  TPQYDPDVIYNVCIGKDWHRYPGSFFFPAKNFRLRFL  507



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02660.1.1 Ubiquitin

Length=389
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDD8_DROME  unnamed protein product                                 118     5e-29
Q8MQX4_DROME  unnamed protein product                                 118     7e-29
H1UUC2_DROME  unnamed protein product                                 114     9e-29


>Q9VDD8_DROME unnamed protein product
Length=896

 Score = 118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886


>Q8MQX4_DROME unnamed protein product
Length=896

 Score = 118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 90/170 (53%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WKCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 114 bits (286),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  212  LNQCMDMYFSGERI---HGWNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  267

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  268  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  308

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  309  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  357



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02670.1.1 Ubiquitin

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H1UUC2_DROME  unnamed protein product                                 115     8e-30
Q9VDD8_DROME  unnamed protein product                                 117     1e-29
Q8MQX4_DROME  unnamed protein product                                 117     2e-29


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 115 bits (287),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  212  LNQCMDMYFSGERI---HGWNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  267

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  268  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  308

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  309  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  357


>Q9VDD8_DROME unnamed protein product
Length=896

 Score = 117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886


>Q8MQX4_DROME unnamed protein product
Length=896

 Score = 117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 90/170 (53%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WKCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02680.1.1 Ubiquitin

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H1UUC2_DROME  unnamed protein product                                 119     9e-30
Q8MQX4_DROME  unnamed protein product                                 121     5e-29
Q9VDD8_DROME  unnamed protein product                                 121     5e-29


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 106/192 (55%), Gaps = 19/192 (10%)

Query  153  GVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQ  212
            G+ GL+N GNTC++N+ILQCLS+T  L EY + D+YK  +SR NK       T G+V E+
Sbjct  32   GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNK-------TNGQVIEE  84

Query  213  LAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATK  272
            +A L+K +W+  Y    S   + ++ +Y   +RG +Q D+ EFL  L+D +H DL T   
Sbjct  85   VAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTL--  142

Query  273  KKYKTIKNSFGRPDEVVAAETMA--NHVRCNNSFVHSVFQAQFRSSLTCPRCQRQSNTFD  330
                       R  E+++A   A     +   S +  +F  Q +S++ C  C ++S T++
Sbjct  143  --------HVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYE  194

Query  331  PFLCVSVPVPRN  342
             F  +S+ +P N
Sbjct  195  SFSNLSLELPPN  206


>Q8MQX4_DROME unnamed protein product
Length=896

 Score = 121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 106/192 (55%), Gaps = 19/192 (10%)

Query  153  GVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQ  212
            G+ GL+N GNTC++N+ILQCLS+T  L EY + D+YK  +SR NK       T G+V E+
Sbjct  561  GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNK-------TNGQVIEE  613

Query  213  LAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATK  272
            +A L+K +W+  Y    S   + ++ +Y   +RG +Q D+ EFL  L+D +H DL T   
Sbjct  614  VAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTL--  671

Query  273  KKYKTIKNSFGRPDEVVAAETMA--NHVRCNNSFVHSVFQAQFRSSLTCPRCQRQSNTFD  330
                       R  E+++A   A     +   S +  +F  Q +S++ C  C ++S T++
Sbjct  672  --------HVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYE  723

Query  331  PFLCVSVPVPRN  342
             F  +S+ +P N
Sbjct  724  SFSNLSLELPPN  735


>Q9VDD8_DROME unnamed protein product
Length=896

 Score = 121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 106/192 (55%), Gaps = 19/192 (10%)

Query  153  GVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQ  212
            G+ GL+N GNTC++N+ILQCLS+T  L EY + D+YK  +SR NK       T G+V E+
Sbjct  561  GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNK-------TNGQVIEE  613

Query  213  LAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATK  272
            +A L+K +W+  Y    S   + ++ +Y   +RG +Q D+ EFL  L+D +H DL T   
Sbjct  614  VAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTL--  671

Query  273  KKYKTIKNSFGRPDEVVAAETMA--NHVRCNNSFVHSVFQAQFRSSLTCPRCQRQSNTFD  330
                       R  E+++A   A     +   S +  +F  Q +S++ C  C ++S T++
Sbjct  672  --------HVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYE  723

Query  331  PFLCVSVPVPRN  342
             F  +S+ +P N
Sbjct  724  SFSNLSLELPPN  735



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02690.1.1 Unknown

Length=182


***** No hits found *****



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02700.1.1 Vacuolar

Length=229
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VR38_DROME  unnamed protein product                                 176     1e-52
Q8MRZ0_DROME  unnamed protein product                                 175     7e-52
TRIMR_BOMMO  unnamed protein product                                  26.9    9.1  


>Q9VR38_DROME unnamed protein product
Length=528

 Score = 176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 136/254 (54%), Gaps = 56/254 (22%)

Query  1    MKKYNLRPMDIHLILNL--------------------FDASGYLYSHVSYLADDCAACLL  40
            MKKY++ P D+ LI NL                    FD +GYL++HVSYLADDC ACLL
Sbjct  305  MKKYSIHPADLRLIFNLVECSESFKSSENWSPICLPKFDMNGYLHAHVSYLADDCQACLL  364

Query  41   MLTVDKNLFFTLSEAKQVITEKLRRAKLLDEINTALSS--SHSLLTSSLNITSLRHFVYK  98
            +L+VD++ FFTL+EAK  ITEKLR++  L+ IN  L    +  L    + I  LRHF+YK
Sbjct  365  LLSVDRDAFFTLAEAKAKITEKLRKSHCLEAINEELQQPFNAKLYQQVVGIPELRHFLYK  424

Query  99   CKQTSQLICPQYEAPYVANSNFGSASIQSSVASSPSWMPSASIVARCDRTVLEYYSHLYC  158
             K T+QL+CP    PY +                               T LE    +YC
Sbjct  425  PKSTAQLLCPMLRHPYKS------------------------------LTELERLEAIYC  454

Query  159  D----IHRQSRHLKLYFQSRDTETLLGWTTAGFELYLIFEPLITKPSATNAVNKLLRWIK  214
            D    IH  SR LKL ++ ++ E +L W T  +ELY IFEP++ K +    V+KL++WI+
Sbjct  455  DLLHRIHNSSRPLKLIYEMKEREVVLAWATGTYELYAIFEPVVDKATVIKYVDKLIKWIE  514

Query  215  KEEDKMFMLNNYTL  228
            KE D  F+ N+ T 
Sbjct  515  KEYDVYFIRNHATF  528


>Q8MRZ0_DROME unnamed protein product
Length=528

 Score = 175 bits (443),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 135/254 (53%), Gaps = 56/254 (22%)

Query  1    MKKYNLRPMDIHLILNL--------------------FDASGYLYSHVSYLADDCAACLL  40
            MKKY++ P D+ LI NL                    FD +GYL++HVSYLADDC ACLL
Sbjct  305  MKKYSIHPADLRLIFNLVECSESFKSSENWSPICLPKFDMNGYLHAHVSYLADDCQACLL  364

Query  41   MLTVDKNLFFTLSEAKQVITEKLRRAKLLDEINTALSS--SHSLLTSSLNITSLRHFVYK  98
            +L+VD++ FFTL+EAK  ITEKLR++  L+ IN  L    +  L    + I  LRHF+YK
Sbjct  365  LLSVDRDAFFTLAEAKAKITEKLRKSHCLEAINEELQQPFNAKLYQQVVGIPELRHFLYK  424

Query  99   CKQTSQLICPQYEAPYVANSNFGSASIQSSVASSPSWMPSASIVARCDRTVLEYYSHLYC  158
             K T+QL+CP    PY +                               T LE    +YC
Sbjct  425  PKSTAQLLCPMLRHPYKS------------------------------LTELERLEAIYC  454

Query  159  D----IHRQSRHLKLYFQSRDTETLLGWTTAGFELYLIFEPLITKPSATNAVNKLLRWIK  214
            D    IH  SR LKL ++ ++ E +L W T  +ELY IFEP++ K +    V KL++WI+
Sbjct  455  DLLHRIHNSSRPLKLIYEMKEREVVLAWATGTYELYAIFEPVVDKATVIKYVVKLIKWIE  514

Query  215  KEEDKMFMLNNYTL  228
            KE D  F+ N+ T 
Sbjct  515  KEYDVYFIRNHATF  528


>TRIMR_BOMMO unnamed protein product
Length=532

 Score = 26.9 bits (58),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 8/73 (11%)

Query  18   FDASGYLYSHVSYLADDCAACLLMLTVDKNLFFTLSEAKQVITEKLRRAKLLDEINTALS  77
            FD + ++Y  + YL+    A L    ++ NLF  +SE+ +   EK        +IN   S
Sbjct  117  FDFNKFIYEGLPYLSKSDEALLNRYRIENNLFDYVSESLEFDEEK--------QINQCSS  168

Query  78   SSHSLLTSSLNIT  90
                 L+SS+  T
Sbjct  169  EVSKWLSSSIEDT  181



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02710.1.1 Coiled-coil

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPEN_DROME  unnamed protein product                                   33.1    0.41 


>SPEN_DROME unnamed protein product
Length=5560

 Score = 33.1 bits (74),  Expect = 0.41, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 48/84 (57%), Gaps = 8/84 (10%)

Query  205   REQEEIKKKLQFQSLTKQIQLNKDLREMAVYALEKETRRLRQVEENRQKELENKKKLKLM  264
             R++E+ +K+++ + L ++ Q  +D RE  +   +   + +R+ +E R+KEL         
Sbjct  1996  RDKEQKEKEIREKDLREKEQRERDNREKELRDKDLREKEMRE-KEQREKELHR-------  2047

Query  265   EQEKRKREIEETNQALRKLKEEQK  288
             E+++R+RE  E  Q+ R +  EQ+
Sbjct  2048  EKDQREREHREKEQSRRAMDVEQE  2071


 Score = 29.3 bits (64),  Expect = 6.6, Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 43/73 (59%), Gaps = 6/73 (8%)

Query  248   EENRQKELENKKKLKLMEQEKRKREIEETNQALRKLKEEQKEQKMLMNLKIQNILKEKIE  307
             +E R+K+L  K++    E++ R++E+ + +   ++++E+++ +K L   K Q   +E+  
Sbjct  2003  KEIREKDLREKEQ---RERDNREKELRDKDLREKEMREKEQREKELHREKDQ---REREH  2056

Query  308   AEEQQEREKKQIQ  320
              E++Q R    ++
Sbjct  2057  REKEQSRRAMDVE  2069



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02720.1.1 protein

Length=168


***** No hits found *****



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02730.1.1 Transposon

Length=116
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

JHAMT_BOMMO  unnamed protein product                                  25.4    7.6  


>JHAMT_BOMMO unnamed protein product
Length=278

 Score = 25.4 bits (54),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 13/17 (76%), Gaps = 0/17 (0%)

Query  63   HWSDAQEQAFQNLKNIL  79
            HW   QE+AF+N+ N+L
Sbjct  114  HWIRDQERAFRNIFNLL  130



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02740.1.1 RING/U-box

Length=285
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T089_DROME  unnamed protein product                                 61.6    6e-11
Q9VI20_DROME  unnamed protein product                                 61.6    8e-11
Q8SX72_DROME  unnamed protein product                                 56.2    7e-09


>Q8T089_DROME unnamed protein product
Length=352

 Score = 61.6 bits (148),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 2/74 (3%)

Query  185  LSTDKIKQIPVAHITKAQIDSNLQ-CSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWL-QL  242
            L    +K++PV   TK   ++    C +C E F  D+ +R LPC H YHT CI+PWL + 
Sbjct  26   LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTEN  85

Query  243  HGTCPICRQTLHSE  256
               CPIC++ + ++
Sbjct  86   RRVCPICKRKVFTK  99


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 61.6 bits (148),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 2/74 (3%)

Query  185  LSTDKIKQIPVAHITKAQIDSNLQ-CSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWL-QL  242
            L    +K++PV   TK   ++    C +C E F  D+ +R LPC H YHT CI+PWL + 
Sbjct  210  LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTEN  269

Query  243  HGTCPICRQTLHSE  256
               CPIC++ + ++
Sbjct  270  RRVCPICKRKVFTK  283


>Q8SX72_DROME unnamed protein product
Length=868

 Score = 56.2 bits (134),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query  164  EGLDAIVTQLLNQMDGSGPPPLSTDKIKQIPVAHIT-KAQIDSNLQCSVCWEQFTLDEAV  222
            E  +A+++ L  ++  + P  L+ ++I Q+P      +        C VC   F L + +
Sbjct  727  ENYEALLS-LAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLL  785

Query  223  RKLPCDHFYHTPCIEPWLQLHGTCPICR  250
            R LPC H +H  C++ WL+ + TCPICR
Sbjct  786  RVLPCSHEFHAKCVDKWLRSNRTCPICR  813



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02750.1.1 RING/U-box

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T089_DROME  unnamed protein product                                 62.4    6e-11
Q9VI20_DROME  unnamed protein product                                 62.4    9e-11
Q8SX72_DROME  unnamed protein product                                 56.6    7e-09


>Q8T089_DROME unnamed protein product
Length=352

 Score = 62.4 bits (150),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 2/74 (3%)

Query  185  LSTDKIKQIPVAHITKAQIDSNLQ-CSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWL-QL  242
            L    +K++PV   TK   ++    C +C E F  D+ +R LPC H YHT CI+PWL + 
Sbjct  26   LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTEN  85

Query  243  HGTCPICRQTLHSE  256
               CPIC++ + ++
Sbjct  86   RRVCPICKRKVFTK  99


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 62.4 bits (150),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 2/74 (3%)

Query  185  LSTDKIKQIPVAHITKAQIDSNLQ-CSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWL-QL  242
            L    +K++PV   TK   ++    C +C E F  D+ +R LPC H YHT CI+PWL + 
Sbjct  210  LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTEN  269

Query  243  HGTCPICRQTLHSE  256
               CPIC++ + ++
Sbjct  270  RRVCPICKRKVFTK  283


>Q8SX72_DROME unnamed protein product
Length=868

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query  164  EGLDAIVTQLLNQMDGSGPPPLSTDKIKQIPVAHIT-KAQIDSNLQCSVCWEQFTLDEAV  222
            E  +A+++ L  ++  + P  L+ ++I Q+P      +        C VC   F L + +
Sbjct  727  ENYEALLS-LAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLL  785

Query  223  RKLPCDHFYHTPCIEPWLQLHGTCPICR  250
            R LPC H +H  C++ WL+ + TCPICR
Sbjct  786  RVLPCSHEFHAKCVDKWLRSNRTCPICR  813



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02760.1.1 Mediator

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED31_DROME  unnamed protein product                                  195     1e-64
ICE2_DROME  unnamed protein product                                   29.3    0.84 
A0A0B4LGX5_DROME  unnamed protein product                             28.5    1.3  


>MED31_DROME unnamed protein product
Length=204

 Score = 195 bits (496),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 106/145 (73%), Gaps = 0/145 (0%)

Query  4    KGGPETEDQQRLRFQIELEFIQCLANPNYLNFLAQRGYLKDEAFVNYLKYLLYWKEPQYA  63
            K   E+E+ Q+ R+QIELEF+QCL+NPNYLNFLAQRG+ KD++F+NYLKYL YWKEP YA
Sbjct  9    KTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYA  68

Query  64   KYLKYPMCLYFLDLLQYEHFRREIVNSQCAKFIDDQQVLLWQHYTRKRTKLLNEAAQNNI  123
            KYL YPMCLYFLDLLQYEHFRREIVNSQC KFIDDQ +L WQHYTRKR KL+        
Sbjct  69   KYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQ  128

Query  124  SGVGRDSLQNNGNGANNGTTIKSES  148
                    Q   NG    T  +S +
Sbjct  129  QQQQLQQQQQQANGMEAATGGESAA  153


>ICE2_DROME unnamed protein product
Length=684

 Score = 29.3 bits (64),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 0/37 (0%)

Query  75   LDLLQYEHFRREIVNSQCAKFIDDQQVLLWQHYTRKR  111
            L+L Q     R ++  QC++ +D+Q +++WQ   +KR
Sbjct  109  LNLKQQAACMRVLLAWQCSQPVDEQDIVVWQATEKKR  145


>A0A0B4LGX5_DROME unnamed protein product
Length=755

 Score = 28.5 bits (62),  Expect = 1.3, Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 22/33 (67%), Gaps = 3/33 (9%)

Query  69   PMCLYFLDLLQYEHF--RREIVNSQCA-KFIDD  98
            P  L+F+ +  +EHF  +R+++  QCA +F+ D
Sbjct  261  PALLFFISIFGWEHFTGKRDLLPGQCAVQFLKD  293



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02770.1.1 DALR

Length=392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

L2CC_DROME  unnamed protein product                                   31.2    0.78 
Q95RB1_DROME  unnamed protein product                                 28.9    4.4  


>L2CC_DROME unnamed protein product
Length=276

 Score = 31.2 bits (69),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (49%), Gaps = 6/72 (8%)

Query  43   ISILKRPLNDCIENVDALIEESKSKWCLP------LKAVNISTDYIHLFFNKDIVFRKTL  96
            + IL RP+ D +  +  ++ +   +  LP      LKAV    D   L   +++V ++  
Sbjct  92   LRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVS  151

Query  97   QEVQNKNKSYGF  108
            QE+  + K +GF
Sbjct  152  QELTVRAKQFGF  163


>Q95RB1_DROME unnamed protein product
Length=418

 Score = 28.9 bits (63),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 29/59 (49%), Gaps = 8/59 (14%)

Query  192  PEEYFSLKSSEVNSMSNGMDSASSSEHLVDTSVKFNLFHASV-------ASSSRLSASG  243
            P +YF+L+  ++N M  GM       +LV  S  + ++           A+S+ LS+SG
Sbjct  331  PNDYFNLRQEQINVMPAGMKLHQLPSNLVPASA-YQMYGQPTYAAPYGNATSTALSSSG  388



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02780.1.1 Retrovirus-related

Length=137
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PIPA_DROME  unnamed protein product                                   27.3    2.9  
IPPK_DROME  unnamed protein product                                   26.2    6.8  


>PIPA_DROME unnamed protein product
Length=1095

 Score = 27.3 bits (59),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (51%), Gaps = 2/51 (4%)

Query  84   RLFNLEK--KKMMLSRDVVFKENEFPFKDQYNPEGNDDENIEDCNLDLIKG  132
            R F  EK  K+    RD +FK +E+ F   +  EG D + IE C +  I+ 
Sbjct  25   RWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRA  75


>IPPK_DROME unnamed protein product
Length=621

 Score = 26.2 bits (56),  Expect = 6.8, Method: Composition-based stats.
 Identities = 21/89 (24%), Positives = 37/89 (42%), Gaps = 3/89 (3%)

Query  2    YDEKIQLKDYFIKFENVIRDLKD---SGIVMEEKEIICNLLMSMPKSYDTVTATLETMGG  58
            Y  +I+ K  +++  + + DL D   SG V + KE  CN   + P + D       +M  
Sbjct  238  YAIEIKPKQGWLQLASDVNDLFDLMPSGAVTKPKETTCNQEENEPSARDKCWCRFCSMQL  297

Query  59   MGQERSKIDSRSQKCVLIGYAQNGYRLFN  87
            +     KI      C L  ++    R+ +
Sbjct  298  LKMHNGKIKRLGHYCPLDLFSGTPSRMLD  326



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02790.1.1 39S

Length=216
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U4K9_DROME  unnamed protein product                                 27.7    6.0  
PPN_DROME  unnamed protein product                                    27.3    6.2  
INT2_DROME  unnamed protein product                                   27.3    6.8  


>Q9U4K9_DROME unnamed protein product
Length=1752

 Score = 27.7 bits (60),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 7/50 (14%)

Query  69    SDAIRHGDTHKETMDMADFWIEEKNIVHKLFKVLVPRFQNTTVSYTRAYN  118
             ++A R  D H+  +D ADFW       HKL  ++V        SY    N
Sbjct  1075  NEAKRAPDDHEPKLDSADFW-------HKLIALIVSVIDEDKNSYGTGLN  1117


>PPN_DROME unnamed protein product
Length=2898

 Score = 27.3 bits (59),  Expect = 6.2, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 8/58 (14%)

Query  157  LIQNVLLDEAKKEYRAQKYAEIAQDLESRANADSSAKSEKLAQNNSQTPSETTTETET  214
            LI + L D+ K        +E   DLE  A  +++ ++E L Q++S TP +    T T
Sbjct  722  LISDGLSDDEK--------SEDVIDLEGTAKTETTPEAEDLMQSDSPTPYDEFESTGT  771


>INT2_DROME unnamed protein product
Length=1105

 Score = 27.3 bits (59),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 47/103 (46%), Gaps = 16/103 (16%)

Query  1    MNQAEVTK-LVSRLRIP---ILAKHRRLRNPEGPQGRVKKLRS--IVTAL-LKYERIEVY  53
            +NQ EVT  L ++L +    +L +  RL N     GR +K  S   +  L LKY   + +
Sbjct  600  LNQIEVTCPLTAQLLMIYYLMLYEDTRLMNLSALGGRKQKEYSNNFLGGLPLKYLLQKAH  659

Query  54   HYDGDEARGY--VERLISDAIRHGDTHKETMDMADFWIEEKNI  94
            HY  D    +  + RLI     H       + M D W+EE N+
Sbjct  660  HYHNDYLSLFHPLLRLIISNYPH-------LSMVDDWLEEHNL  695



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02800.1.1 conserved

Length=119
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GR59C_DROME  unnamed protein product                                  28.9    0.50 
A0A0B4K7P8_DROME  unnamed protein product                             26.6    3.4  
A0A0B4KFR5_DROME  unnamed protein product                             26.6    3.9  


>GR59C_DROME unnamed protein product
Length=397

 Score = 28.9 bits (63),  Expect = 0.50, Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (55%), Gaps = 4/55 (7%)

Query  29   QKRTAIRWMNKILSLKSEDPQVKK----NRNCFLKYYLTLLKNTSEAVSEQSREK  79
            Q+   IR  N+IL+L  + PQV +     R+  LK+   +L ++   +S+ S ++
Sbjct  100  QRSRFIRIWNQILALVRDRPQVVRGRWYRRSIILKFVFCVLSDSLHTISDVSAQR  154


>A0A0B4K7P8_DROME unnamed protein product
Length=5394

 Score = 26.6 bits (57),  Expect = 3.4, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  15  EKAVMYISEIGDKTQKRTAIRWMNKILSLKSEDPQVKKNR  54
           ++AV+ I++  D  QK+T  +W+NK   LK      K NR
Sbjct  25  DRAVLRIADERDAIQKKTFTKWVNK--HLKKHWKYAKANR  62


>A0A0B4KFR5_DROME unnamed protein product
Length=1957

 Score = 26.6 bits (57),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (56%), Gaps = 1/36 (3%)

Query  70    EAVSEQSREKPLDIMSQW-SLDKKTYVAIKPLPNEG  104
             E  +EQ RE+ L ++ QW SL ++    + P P  G
Sbjct  1092  EEKNEQERERELSLVHQWVSLTEERNAVLVPAPGSG  1127



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02810.1.1 Unknown

Length=161
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WDR59_DROME  unnamed protein product                                  29.6    0.63 
Q9VFQ9_DROME  unnamed protein product                                 26.2    9.2  


>WDR59_DROME unnamed protein product
Length=969

 Score = 29.6 bits (65),  Expect = 0.63, Method: Composition-based stats.
 Identities = 15/41 (37%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  79   HVNNIAILTELRSEINNKILLLDFHSRRNKRSLLPILGKGI  119
            H N I +LT     +NNK L L  H+    R+   I G G+
Sbjct  579  HFNAIGMLTTFAQPVNNKRLTLRQHTALTPRTFSSINGSGL  619


>Q9VFQ9_DROME unnamed protein product
Length=508

 Score = 26.2 bits (56),  Expect = 9.2, Method: Composition-based stats.
 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  96   KILLLDFHSRRNKRSLLPILGKGIKFITGNLD  127
            +I+ L++   +  R  L ++GKG+ + TG  D
Sbjct  235  RIIFLEYKPPKPARKTLMLVGKGVTYDTGGAD  266



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02820.1.1 RNA-directed

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6NR50_DROME  unnamed protein product                                 32.7    0.13 
A0A0B4KH60_DROME  unnamed protein product                             32.7    0.13 
Q9VGI1_DROME  unnamed protein product                                 32.3    0.14 


>Q6NR50_DROME unnamed protein product
Length=1186

 Score = 32.7 bits (73),  Expect = 0.13, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>A0A0B4KH60_DROME unnamed protein product
Length=1330

 Score = 32.7 bits (73),  Expect = 0.13, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>Q9VGI1_DROME unnamed protein product
Length=1354

 Score = 32.3 bits (72),  Expect = 0.14, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02820.1.2 RNA-directed

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGI1_DROME  unnamed protein product                                 33.5    0.073
Q6NR50_DROME  unnamed protein product                                 32.7    0.13 
A0A0B4KH60_DROME  unnamed protein product                             32.3    0.14 


>Q9VGI1_DROME unnamed protein product
Length=1354

 Score = 33.5 bits (75),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>Q6NR50_DROME unnamed protein product
Length=1186

 Score = 32.7 bits (73),  Expect = 0.13, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>A0A0B4KH60_DROME unnamed protein product
Length=1330

 Score = 32.3 bits (72),  Expect = 0.14, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02820.1.3 RNA-directed

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGI1_DROME  unnamed protein product                                 33.5    0.073
Q6NR50_DROME  unnamed protein product                                 32.7    0.13 
A0A0B4KH60_DROME  unnamed protein product                             32.3    0.14 


>Q9VGI1_DROME unnamed protein product
Length=1354

 Score = 33.5 bits (75),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>Q6NR50_DROME unnamed protein product
Length=1186

 Score = 32.7 bits (73),  Expect = 0.13, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>A0A0B4KH60_DROME unnamed protein product
Length=1330

 Score = 32.3 bits (72),  Expect = 0.14, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02830.1.1 Ubiquitin

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKZ8_DROME  unnamed protein product                                 216     9e-67
H1UUC2_DROME  unnamed protein product                                 59.7    5e-10
Q8MQX4_DROME  unnamed protein product                                 59.7    7e-10


>Q9VKZ8_DROME unnamed protein product
Length=475

 Score = 216 bits (551),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/329 (35%), Positives = 187/329 (57%), Gaps = 25/329 (8%)

Query  8    IKPGHLFMVIGAAGPLPSAPTEKVVFMEDLDDKQLSQALKNPVGLTNLGNTCYLNSSIQV  67
            IK G + +++G+   +P  P   V F+ED+++ + + A++ P GLTNLGNTCY+N+++Q 
Sbjct  62   IKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQC  121

Query  68   LRAIPELQSNLNNSQNNG---------LSRSLEALFSSLNNSTDAITPTSFLTTLRSNYQ  118
            L A+PEL++ L+   N+G         +S +++++F+ +   T  +TP   L  L     
Sbjct  122  LNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGT-TVTPIVLLQALHRASP  180

Query  119  QFTERDRFGQFAQQDAEEAWGAILSSL-----------AGTTGMEGKSFVDQYMRGSYVK  167
            QF +    G + QQDA E W  IL  L           + T      SF+DQ+  G++  
Sbjct  181  QFAQTGENGTYRQQDANECWAEILKMLQQKLRPKNQEPSNTVQKRHSSFIDQFFGGTFEV  240

Query  168  EMSTPEAPEEEPTYSIEEFTKLGCNISSNTNYLQQGLSEGLDEQIEKYSGTLNRNAQYVQ  227
            +MS+ E P+E  T + E F +L C IS +  Y+Q GL   + EQ+ K S TL R+A+Y++
Sbjct  241  KMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIR  300

Query  228  KSRINRLPSYLTVHLVRFYWRADLGKKAKILRKVKFPMEYDASELVSDDLKAKINPVNKK  287
               ++RLP+YLTV  VRF ++   G  AK+L+ +KFP+++DA EL + +L+ K+ P+  K
Sbjct  301  TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSK  360

Query  288  LYSINKDREERRRLRKRIKTRNDLEEKAN  316
                 KD E+++     +K     EEK +
Sbjct  361  F----KDLEDKKMEVDVVKRNEPNEEKKD  385


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 59.7 bits (143),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 131/325 (40%), Gaps = 62/325 (19%)

Query  13   LFMVIGAAGPLPSAPTEKVVFMEDLDDKQLSQALKNPVGLTNLGNTCYLNSSIQVLRAIP  72
            +  V G    LP+AP    ++      ++     +   GL NLGNTCY+NS +Q L   P
Sbjct  1    MICVAGVRLQLPTAPPTYSIYSSIFPLRRG----RGLTGLKNLGNTCYMNSILQCLSNTP  56

Query  73   EL-QSNLNNSQNNGLSRS----------LEALFSSLNNSTDAITPTSFLTTLRSNYQQFT  121
            +L +  +++   N +SRS          + AL   L N       +  L  +   YQ+  
Sbjct  57   QLTEYCISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKI-  115

Query  122  ERDRFGQFAQQDAEEAWGAILSSL---------------------AGTTGMEGK-SFVDQ  159
                F    QQD+ E    ++  L                     A     + K S +  
Sbjct  116  ----FRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILH  171

Query  160  YMRGSYVKEMSTPEAPEEEPTYSIEEFTKLGCNISSNTNYLQQGLSEGLD-----EQIEK  214
               G     +      +E  TY  E F+ L   +  N+N  Q  L++ +D     E+I  
Sbjct  172  LFYGQMKSTVKCVACHKESATY--ESFSNLSLELPPNSNVCQ--LNQCMDMYFSGERIHG  227

Query  215  Y---SGTLNRNAQYVQKSRINRLPSYLTVHLVRFYWRADLGKKAKILRK---VKFPME-Y  267
            +   S    R+A  ++K  I++LP  L VHL RFY  AD       ++K   ++FP+E  
Sbjct  228  WNCPSCKTKRDA--IKKLDISKLPPVLVVHLKRFY--ADPSNSGSYMKKQNYLRFPLENL  283

Query  268  DASELVSDDLKAKINPVNKKLYSIN  292
            D +  ++      + P   +LY+++
Sbjct  284  DMNPYIARAESRAVTPKTYQLYAVS  308


>Q8MQX4_DROME unnamed protein product
Length=896

 Score = 59.7 bits (143),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 118/287 (41%), Gaps = 58/287 (20%)

Query  51   GLTNLGNTCYLNSSIQVLRAIPEL-QSNLNNSQNNGLSRS----------LEALFSSLNN  99
            GL NLGNTCY+NS +Q L   P+L +  +++   N +SRS          + AL   L N
Sbjct  564  GLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTNGQVIEEVAALIKELWN  623

Query  100  STDAITPTSFLTTLRSNYQQFTERDRFGQFAQQDAEEAWGAILSSL--------------  145
                   +  L  +   YQ+      F    QQD+ E    ++  L              
Sbjct  624  GQYKCVASRDLRYVVGQYQKI-----FRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQRE  678

Query  146  -------AGTTGMEGK-SFVDQYMRGSYVKEMSTPEAPEEEPTYSIEEFTKLGCNISSNT  197
                   A     + K S +     G     +      +E  TY  E F+ L   +  N+
Sbjct  679  MISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATY--ESFSNLSLELPPNS  736

Query  198  NYLQQGLSEGLD-----EQIEKY---SGTLNRNAQYVQKSRINRLPSYLTVHLVRFYWRA  249
            N  Q  L++ +D     E+I  +   S    R+A  ++K  I++LP  L VHL RFY  A
Sbjct  737  NVCQ--LNQCMDMYFSGERIHGWKCPSCKTKRDA--IKKLDISKLPPVLVVHLKRFY--A  790

Query  250  DLGKKAKILRK---VKFPME-YDASELVSDDLKAKINPVNKKLYSIN  292
            D       ++K   ++FP+E  D +  ++      + P   +LY+++
Sbjct  791  DPSNSGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVS  837



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02840.1.1 rRNA

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPP6_DROME  unnamed protein product                                   81.3    5e-19
PP2A_DROME  unnamed protein product                                   74.3    2e-16
PP4C_DROME  unnamed protein product                                   67.4    6e-14


>PPP6_DROME unnamed protein product
Length=303

 Score = 81.3 bits (199),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 50/64 (78%), Gaps = 0/64 (0%)

Query  93   DPQQWLDTILSGKYLAESQIKMLCDVVLGLLVEESNIQPVSSPVTVCGDIHGQFWDLLEL  152
            D  +W++ +   KYL E+++K LC++V  +L+EE+NI PVS+PVTVCGDIHGQF+DL +L
Sbjct  3    DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQL  62

Query  153  LRVG  156
             R G
Sbjct  63   FRTG  66


>PP2A_DROME unnamed protein product
Length=309

 Score = 74.3 bits (181),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)

Query  93   DPQQWLDTILSGKYLAESQIKMLCDVVLGLLVEESNIQPVSSPVTVCGDIHGQFWDLLEL  152
            D  QW++ +     L E+Q++ LCD    +L +ESN+Q V  PVTVCGD+HGQF DL+EL
Sbjct  9    DLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMEL  68

Query  153  LRVG  156
             R+G
Sbjct  69   FRIG  72


>PP4C_DROME unnamed protein product
Length=307

 Score = 67.4 bits (163),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)

Query  107  LAESQIKMLCDVVLGLLVEESNIQPVSSPVTVCGDIHGQFWDLLELLRVG  156
            + E+++K LC     +LVEE N+Q V SPVTVCGDIHGQF+DL EL +VG
Sbjct  20   IKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVG  69



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02850.1.1 Phosphatidyl-N-methylethanolamine

Length=203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7YU60_DROME  unnamed protein product                                 31.2    0.34 
Q23975_DROME  unnamed protein product                                 29.6    1.1  
A1Z7L9_DROME  unnamed protein product                                 29.6    1.1  


>Q7YU60_DROME unnamed protein product
Length=595

 Score = 31.2 bits (69),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 9/43 (21%)

Query  88   DYFGIL---MSHRVTSFPFNVVEDPMYIGSTL--CFFGTSIWY  125
            +Y G+L   + HR+TS+ F  +     +G+TL  CF GTS WY
Sbjct  200  NYSGVLPDYVPHRLTSWEFVAI----ILGATLFICFTGTSTWY  238


>Q23975_DROME unnamed protein product
Length=601

 Score = 29.6 bits (65),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 6/32 (19%)

Query  96   HRVTSFPFNVVEDPMYIGSTL--CFFGTSIWY  125
            HR+TS+ F  +     +G+TL  CF GTS WY
Sbjct  217  HRLTSWEFVAI----ILGATLFICFTGTSTWY  244


>A1Z7L9_DROME unnamed protein product
Length=601

 Score = 29.6 bits (65),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 6/32 (19%)

Query  96   HRVTSFPFNVVEDPMYIGSTL--CFFGTSIWY  125
            HR+TS+ F  +     +G+TL  CF GTS WY
Sbjct  217  HRLTSWEFVAI----ILGATLFICFTGTSTWY  244



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02860.1.1 Electron

Length=906
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KLW5_DROME  unnamed protein product                                 77.0    5e-15
Q7KN94_DROME  unnamed protein product                                 76.6    5e-15
GLD2B_DROME  unnamed protein product                                  75.1    1e-13


>Q7KLW5_DROME unnamed protein product
Length=340

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 1/64 (2%)

Query  1    MTVTARPDLGSASRVISGGRALKSAENFNQIIEPLADKLGAAIGASRAAVDSGYADNSLQ  60
            +T + RP+L  A  ++SGGR LKS +NF +++  LADK GAA+GASRAAVD+G+  N LQ
Sbjct  214  LTKSDRPELAGAKVIVSGGRGLKSGDNF-KLLYDLADKFGAAVGASRAAVDAGFVPNDLQ  272

Query  61   VGQT  64
            +GQT
Sbjct  273  IGQT  276


>Q7KN94_DROME unnamed protein product
Length=330

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 1/64 (2%)

Query  1    MTVTARPDLGSASRVISGGRALKSAENFNQIIEPLADKLGAAIGASRAAVDSGYADNSLQ  60
            +T + RP+L  A  ++SGGR LKS +NF +++  LADK GAA+GASRAAVD+G+  N LQ
Sbjct  204  LTKSDRPELAGAKVIVSGGRGLKSGDNF-KLLYDLADKFGAAVGASRAAVDAGFVPNDLQ  262

Query  61   VGQT  64
            +GQT
Sbjct  263  IGQT  266


>GLD2B_DROME unnamed protein product
Length=1373

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 60/106 (57%), Gaps = 6/106 (6%)

Query  359   LPKARIPIIKLTLAPTPALPYGIACDIGFGGQLALENTRLLLGYASIDPPRLRTLVLFIK  418
             L +AR+PI++        +  GI  D+ F   + ++NT LL  YA +D  R R LV+ +K
Sbjct  1083  LIEARVPILRFK-----DISNGIEVDLNFNNCVGIKNTYLLQLYAQMDW-RTRPLVVIVK  1136

Query  419   VWSKRRKINSAYRGTLSSYGFTLLVIFFLAHVKQPPVLPNLQRIPP  464
             +W++   IN A R T+SSY   L+V+ +L H   P VLP L  + P
Sbjct  1137  LWAQYHDINDAKRMTISSYSLVLMVLHYLQHACVPHVLPCLHSLYP  1182



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02870.1.1 Electron

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KN94_DROME  unnamed protein product                                 106     9e-28
Q7KLW5_DROME  unnamed protein product                                 106     1e-27


>Q7KN94_DROME unnamed protein product
Length=330

 Score = 106 bits (264),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query  10   FSATSRRTFSTS---RTKLDALVYLEHRDGKINPGSLSALTAAQKVDGKVVGLVAGSENV  66
            F++ +R    +S   R K   LV  EH +  +NP +L+ ++AA+K+ G V  LVAG++  
Sbjct  2    FASNTRNLMRSSILQRCK-STLVVAEHNNEVLNPITLNTISAAKKIGGDVTVLVAGTKCG  60

Query  67   DSVVEEAKKLPVNKLLLAKSDIYNHHSPSTLAPLLKSIVENDSAITHLFAVHSAVGKNVL  126
             +    +K   V K+L+A++  +N  +  +L PL+ +  ++    TH+ A  SA GKNVL
Sbjct  61   PASEALSKVDGVTKVLVAENAAFNGFTAESLTPLVLA-AQSQFKFTHILAGASAFGKNVL  119

Query  127  PRAAALLDTSIIADILNLENGGSEFTRGIYAGNAISTIKSDEPKKVVTVRGTAFDAAVAG  186
            PR AA LD S I++I+++++  + F R IYAGNAI T+KS +  KV+TVR T F  A   
Sbjct  120  PRVAAKLDVSPISEIIDVKSDDT-FVRTIYAGNAILTLKSKDAVKVITVRSTNFPPAATS  178

Query  187  SSEVAVEEIAAVD  199
                AVE+  A D
Sbjct  179  GGSGAVEQAPAGD  191


>Q7KLW5_DROME unnamed protein product
Length=340

 Score = 106 bits (264),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query  10   FSATSRRTFSTS---RTKLDALVYLEHRDGKINPGSLSALTAAQKVDGKVVGLVAGSENV  66
            F++ +R    +S   R K   LV  EH +  +NP +L+ ++AA+K+ G V  LVAG++  
Sbjct  12   FASNTRNLMRSSILQRCK-STLVVAEHNNEVLNPITLNTISAAKKIGGDVTVLVAGTKCG  70

Query  67   DSVVEEAKKLPVNKLLLAKSDIYNHHSPSTLAPLLKSIVENDSAITHLFAVHSAVGKNVL  126
             +    +K   V K+L+A++  +N  +  +L PL+ +  ++    TH+ A  SA GKNVL
Sbjct  71   PASEALSKVDGVTKVLVAENAAFNGFTAESLTPLVLA-AQSQFKFTHILAGASAFGKNVL  129

Query  127  PRAAALLDTSIIADILNLENGGSEFTRGIYAGNAISTIKSDEPKKVVTVRGTAFDAAVAG  186
            PR AA LD S I++I+++++  + F R IYAGNAI T+KS +  KV+TVR T F  A   
Sbjct  130  PRVAAKLDVSPISEIIDVKSDDT-FVRTIYAGNAILTLKSKDAVKVITVRSTNFPPAATS  188

Query  187  SSEVAVEEIAAVD  199
                AVE+  A D
Sbjct  189  GGSGAVEQAPAGD  201



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02880.1.1 Glycine-tRNA

Length=431
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961R8_DROME  unnamed protein product                                 394     8e-132
Q9VUK8_DROME  unnamed protein product                                 395     5e-131


>Q961R8_DROME unnamed protein product
Length=679

 Score = 394 bits (1012),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 265/418 (63%), Gaps = 29/418 (7%)

Query  1    MLEVDTTAVTLGEVLKTSGHVDKFTDWMTRDTKTGDIFRADHLIEAVLEARLKGDKEARG  60
            MLEVD + +T   VLK SGHV++F D M +D KTG+ FR DHLI+  LE +L   K+A  
Sbjct  121  MLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKQALE-KLSKAKDATP  179

Query  61   VQQTEQPKXXXXXXXXXVKSTAVKLDDAVVQQYETILAQIDNFDGEGLADLIAKHTIKSP  120
              Q E                            E I+ ++D  + + LA ++AK+ IKSP
Sbjct  180  ALQAE---------------------------CEDIIIKLDGLNKQELAGVLAKYNIKSP  212

Query  121  ETQNDLTKPVEFNLMFESSIGPTGQVKGYLRPETAQGHFVNFARLLEFNNGRVPFASAQI  180
             T NDLT+P+EFNLMF + IGPTG VKG+LRPETAQG FVNF RLLEFN G++PFA AQI
Sbjct  213  LTGNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQI  272

Query  181  GKSFRNEISPKQGLLRVREFLMAEIEHYVDPLKKDHPRFSEVENVELQILPKEVQVEGKT  240
            G SFRNEISP+ GL+RVREF MAEIEH+ DP+ KDHP+F  +++ +L +     Q++GK+
Sbjct  273  GNSFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKS  332

Query  241  DLTTITVGEAVKKGIIDNQTLGYFVARINLFLQKIGINKDRLRFRQHMSNEMAHYASDCW  300
                + +GEAV   ++ N+TLGY++ARI  FL  IGI  + LRFRQHMSNEMAHYA DCW
Sbjct  333  -AAQVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCW  391

Query  301  DAEIHTSYGWIECVGCADRSAYDLTVHAVRTGQPLVVREPLPEIKIEEKWAPEINKKKFG  360
            DAEI TSYGW+ECVGCADRSAYDL  H   TG  LV  + LP  K  E      NK+  G
Sbjct  392  DAEILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALG  451

Query  361  PTFRANQKIVESTIFALDQPRLECIKKEFDEQGKSDVQAADGNKYELTPELLTIEKKT  418
             TF+   K +   +  L    +  ++++    G+  +  ADG  ++L  + ++++  T
Sbjct  452  KTFKKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHST  509


>Q9VUK8_DROME unnamed protein product
Length=765

 Score = 395 bits (1014),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 265/418 (63%), Gaps = 29/418 (7%)

Query  1    MLEVDTTAVTLGEVLKTSGHVDKFTDWMTRDTKTGDIFRADHLIEAVLEARLKGDKEARG  60
            MLEVD + +T   VLK SGHV++F D M +D KTG+ FR DHLI+  LE +L   K+A  
Sbjct  207  MLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKQALE-KLSKAKDATP  265

Query  61   VQQTEQPKXXXXXXXXXVKSTAVKLDDAVVQQYETILAQIDNFDGEGLADLIAKHTIKSP  120
              Q E                            E I+ ++D  + + LA ++AK+ IKSP
Sbjct  266  ALQAE---------------------------CEDIIIKLDGLNKQELAGVLAKYNIKSP  298

Query  121  ETQNDLTKPVEFNLMFESSIGPTGQVKGYLRPETAQGHFVNFARLLEFNNGRVPFASAQI  180
             T NDLT+P+EFNLMF + IGPTG VKG+LRPETAQG FVNF RLLEFN G++PFA AQI
Sbjct  299  LTGNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQI  358

Query  181  GKSFRNEISPKQGLLRVREFLMAEIEHYVDPLKKDHPRFSEVENVELQILPKEVQVEGKT  240
            G SFRNEISP+ GL+RVREF MAEIEH+ DP+ KDHP+F  +++ +L +     Q++GK+
Sbjct  359  GNSFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKS  418

Query  241  DLTTITVGEAVKKGIIDNQTLGYFVARINLFLQKIGINKDRLRFRQHMSNEMAHYASDCW  300
                + +GEAV   ++ N+TLGY++ARI  FL  IGI  + LRFRQHMSNEMAHYA DCW
Sbjct  419  -AAQVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCW  477

Query  301  DAEIHTSYGWIECVGCADRSAYDLTVHAVRTGQPLVVREPLPEIKIEEKWAPEINKKKFG  360
            DAEI TSYGW+ECVGCADRSAYDL  H   TG  LV  + LP  K  E      NK+  G
Sbjct  478  DAEILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALG  537

Query  361  PTFRANQKIVESTIFALDQPRLECIKKEFDEQGKSDVQAADGNKYELTPELLTIEKKT  418
             TF+   K +   +  L    +  ++++    G+  +  ADG  ++L  + ++++  T
Sbjct  538  KTFKKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHST  595



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02890.1.1 Acetolactate

Length=198
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SP28D_DROME  unnamed protein product                                  28.1    3.5  
Q8IPG9_DROME  unnamed protein product                                 26.2    10.0 


>SP28D_DROME unnamed protein product
Length=536

 Score = 28.1 bits (61),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 0/52 (0%)

Query  89   SEVQEDLTKMSLSEALRTKHAHLSALKNLAEQFSGKLVDVSSDSVIVEVTGK  140
            S VQ DL+ ++ +EA RT     ++L+NL  Q         SD V+ ++  K
Sbjct  425  SAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHK  476


>Q8IPG9_DROME unnamed protein product
Length=265

 Score = 26.2 bits (56),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (44%), Gaps = 12/119 (10%)

Query  32   TNTSVIERELLLVKVSLLGPEYFNEHFKPSSSDPSFSLESARTYDEAITQFSNTQRPSEV  91
            +NT+V+E E + V  S++G        KP  +    ++      D  I +  +   P+ +
Sbjct  126  SNTAVVEGEKMSVTCSVVGT-------KPELTWTFANVTLTNATDRFILKPDDNGVPNAI  178

Query  92   QEDLTKMSLSEALRTKHAHLSALKNLAEQFSGKLVDVSSDSVIVEVTGKSTRLDAFLGL  150
               LT  +++   R ++  +   +N A  + G     +SD   V V GK   L  FLG+
Sbjct  179  ---LTLDNVTLDDRGEYKCIG--RNAANVYGGNTTTPASDVTTVRVKGKFAALWPFLGI  232



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02900.1.1 Actin-related

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97182_DROME  unnamed protein product                                 339     9e-115
CIAO1_DROME  unnamed protein product                                  52.0    2e-07 
SEC13_DROME  unnamed protein product                                  46.2    1e-05 


>O97182_DROME unnamed protein product
Length=377

 Score = 339 bits (869),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 237/372 (64%), Gaps = 22/372 (6%)

Query  15   VTAYAFNADRSQLAVCPNSNVLQIYQKSANTWTLSAELKEHDKLITSVDWAPQSNRIVTC  74
            +T +A+N DR+Q+A+ PN++ + IY +  + W L+  L +HD  +  +DWA  +NRIV+C
Sbjct  14   ITCHAWNKDRTQIALSPNNHEIHIYSREGSDWKLADVLNQHDLRVMGIDWAKNTNRIVSC  73

Query  75   SQDRNAYVWTF-QAGQWKPTLVLLRINRSATFVRWSPLENKFAVASGARAIAVCSFDPES  133
            + DRNAYVWT    G+WKP LVLLRINR+AT V+WSP ENKFAV SGAR I+VC F+ E+
Sbjct  74   AADRNAYVWTQGDDGKWKPALVLLRINRAATCVKWSPAENKFAVGSGARLISVCYFESEN  133

Query  134  DWWVAKHIKKPLRSTVLSLDWHPNNVLLVAGSADSRARVFSAYIKDVDSKPAPSVWGERL  193
            DWWV+KHIKKP+RSTV SLDWHPNNVLL+AGS D + RVFSA+IKD++  P P+ WG R 
Sbjct  134  DWWVSKHIKKPIRSTVTSLDWHPNNVLLLAGSTDYKVRVFSAFIKDIEEPPTPTPWGNRK  193

Query  194  PFNTICGEY---ASPASGWIHSVSFTPSGNAIAFVSHDSNLSIIYPTGVDNPPSVFNVRL  250
            P   +  E+    +   GWI+SVSF+  GN + +V HDS +SI   T   N  +V   R 
Sbjct  194  PLGQLMAEFRNSQTSGGGWINSVSFSSDGNKVCWVGHDSCVSIADAT---NGNTVIRCRT  250

Query  251  ASLPHTSVTFLTEDSLIAAGHDCQPMLYRLINNNSWEFVKSLDDATGASQSNKASVAGRL  310
              LP  S  +++  S++ AG+ C P+LY L  +        LD      +S K   +G  
Sbjct  251  GYLPFLSCEWVSPTSVVVAGYSCVPLLYSLTADGKLVLSGKLD------KSQKKESSGI-  303

Query  311  NNTAFNAFKAADSMGATGGVTGVGAGDTVLTTVHQNTITSVRPFAGVPGNITHVSTAGRD  370
              TA   F++ D    T         DTV+ ++HQN ITSVR +AG   + T VST+G D
Sbjct  304  --TAMRIFQSMDRNMRTENT------DTVVDSIHQNAITSVRLYAGDKASATKVSTSGVD  355

Query  371  GKIVIWDINSGG  382
            G++VIW++  GG
Sbjct  356  GQLVIWNVEQGG  367


>CIAO1_DROME unnamed protein product
Length=335

 Score = 52.0 bits (123),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 67/140 (48%), Gaps = 1/140 (1%)

Query  38   IYQKSANTWTLSAELKEHDKLITSVDWAPQSNRIVTCSQDRNAYVWTFQA-GQWKPTLVL  96
            I+ KS+  +  +A L+ H+  + SV W+     + TCS+D++ ++W      +++   VL
Sbjct  85   IWSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAGDDEFECAAVL  144

Query  97   LRINRSATFVRWSPLENKFAVASGARAIAVCSFDPESDWWVAKHIKKPLRSTVLSLDWHP  156
                +    V W P ++  A AS    I + + +P  + W          STV  +D+  
Sbjct  145  NPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGIDFDA  204

Query  157  NNVLLVAGSADSRARVFSAY  176
            +   LV+ S D+  +++ AY
Sbjct  205  DGERLVSCSDDTTIKIWRAY  224


 Score = 47.0 bits (110),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 65/156 (42%), Gaps = 2/156 (1%)

Query  27   LAVCPNSNVLQIYQKSANTWTLSAELKE-HDKLITSVDWAPQSNRIVTCSQDRNAYVWTF  85
             A C     ++I+  + NTW+    L + H + I  + W+P    + + S D    +W+ 
Sbjct  29   FASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREIRWSPCGQYLASASFDATTAIWSK  88

Query  86   QAGQWKPTLVLLRINRSATFVRWSPLENKFAVASGARAIAVCSFDPESDWWVAKHIKKPL  145
             +G+++    L         V WS      A  S  +++ +     + ++  A  +  P 
Sbjct  89   SSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAGDDEFECAA-VLNPH  147

Query  146  RSTVLSLDWHPNNVLLVAGSADSRARVFSAYIKDVD  181
               V  + WHP   +L + S D+  ++F+    D D
Sbjct  148  TQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDND  183


 Score = 42.0 bits (97),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 73/195 (37%), Gaps = 19/195 (10%)

Query  48   LSAELKEHDKLITSVDWAPQSNRIVTCSQDRNAYVWTFQAGQWKPTLVLLRIN-RSATFV  106
            L   L+ H   I  V W P+ N   +C +D+   +W+     W    +L   + R+   +
Sbjct  6    LEHTLQGHKGRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREI  65

Query  107  RWSPLENKFAVASGARAIAVCSFDPESDWWVAKHIKKPLRSTVLSLDWHPNNVLLVAGSA  166
            RWSP     A AS     A+  +   S  +      +   + V S+ W  +  LL   S 
Sbjct  66   RWSPCGQYLASASFDATTAI--WSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSR  123

Query  167  DSRARVFSAYIKDVDSKPAPSVWGERLPFNTICGEYASPASGWIHSVSFTPSGNAIAFVS  226
            D    ++     D               F   C    +P +  +  V + P+ + +A  S
Sbjct  124  DKSVWIWEVAGDD--------------EFE--CAAVLNPHTQDVKRVVWHPTKDILASAS  167

Query  227  HDSNLSIIYPTGVDN  241
            +D+ + +     +DN
Sbjct  168  YDNTIKMFAEEPIDN  182


 Score = 28.1 bits (61),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (3%)

Query  48   LSAELKEHDKLITSVDWAP-QSNRIVTCSQDRNAYVW  83
            ++AE   HD+ + SV W P  + ++++CS D    +W
Sbjct  295  ITAEEGAHDQDVNSVQWNPVVAGQLISCSDDGTIKIW  331


>SEC13_DROME unnamed protein product
Length=356

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query  34   NVLQIYQKSANTWTLSAELKEHDKLITSVDWAPQ----SNRIVTCSQDRNAYVWTFQA--  87
            N+++I+++  + W     L+ H   +  V WAP      ++I T SQDR+  VW+  A  
Sbjct  190  NLVKIWREDNDRWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVIVWSSNADL  249

Query  88   GQWKPTLVLLRINRSATFVRWSPLENKFAVASGARAIAVCSFDPESDW  135
             +W  T VL   + +   + WS   N  AV  G   + +   + E  W
Sbjct  250  SEWTST-VLHTFDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQW  296


 Score = 37.4 bits (85),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 58/135 (43%), Gaps = 6/135 (4%)

Query  27   LAVCPNSNVLQIYQKSANTWTLSAELKEHDKLITSVDWA-PQ-SNRIVTCSQDRNAYVW-  83
            LA C +   ++I+    N   L AELK H   +  V WA P+  N + +CS DR   VW 
Sbjct  28   LATCSSDGSVRIFHSRKNNKAL-AELKGHQGPVWQVAWAHPKFGNILASCSYDRKVIVWK  86

Query  84   TFQAGQWKPTLVLLRINRSATFVRWSPLENK--FAVASGARAIAVCSFDPESDWWVAKHI  141
            +     W         + S   V ++P E     A AS   +++V + + E   W AK I
Sbjct  87   STTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVLACASSDGSVSVLTCNTEYGVWDAKKI  146

Query  142  KKPLRSTVLSLDWHP  156
                   V ++ W P
Sbjct  147  PNAHTIGVNAISWCP  161



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02910.1.1 Cyclin

Length=349


***** No hits found *****



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02920.1.1 Phosphoglycerate

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SHARK_DROME  unnamed protein product                                  27.7    2.1  
FER_DROME  unnamed protein product                                    26.9    3.4  
ATM_DROME  unnamed protein product                                    26.9    3.5  


>SHARK_DROME unnamed protein product
Length=939

 Score = 27.7 bits (60),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 0/40 (0%)

Query  93   AQEVNGHPCDTGSEPDNLISDPEFKGLDFKDVHPGWTNKK  132
            A EV         EP+ L+ D E    +F  VH GW  +K
Sbjct  645  ATEVEAAKLRFFIEPEKLVLDREIGHGEFGSVHSGWLLRK  684


>FER_DROME unnamed protein product
Length=1325

 Score = 26.9 bits (58),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 10/43 (23%)

Query  39   SSRLNPLTEETIQKTAELLVSSPLRRPMQTMLEGYPNLVKRLE  81
            ++RLN LT+E ++K +E           Q  LEGY  L  R E
Sbjct  123  AARLNHLTDEVVRKKSE----------YQKHLEGYKALRTRFE  155


>ATM_DROME unnamed protein product
Length=2767

 Score = 26.9 bits (58),  Expect = 3.5, Method: Composition-based stats.
 Identities = 17/78 (22%), Positives = 31/78 (40%), Gaps = 0/78 (0%)

Query  25    TIPDAPLTQLGREQSSRLNPLTEETIQKTAELLVSSPLRRPMQTMLEGYPNLVKRLESEG  84
             T+P         + ++RLN      ++   +LLV      P  T  + YP +   L+ E 
Sbjct  2264  TVPSYKFICAANQLTARLNSKNTSLLKGLTDLLVQCGKDHPYHTFYQLYPLVFAHLDGEN  2323

Query  85    KPPILLTIAQEVNGHPCD  102
                    IA+++    C+
Sbjct  2324  SNTERSGIARKIIAMICE  2341



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02930.1.1 Tryptophan

Length=112
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ELBA3_DROME  unnamed protein product                                  28.1    0.97 
A0A0B4K614_DROME  unnamed protein product                             28.1    1.1  
A0A0B4LH20_DROME  unnamed protein product                             28.1    1.1  


>ELBA3_DROME unnamed protein product
Length=379

 Score = 28.1 bits (61),  Expect = 0.97, Method: Composition-based stats.
 Identities = 26/97 (27%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query  7    DTFTECHKKGRPAFVTFMTAGYPY-----KNSTVDLMLSLEKGGADII--ELGVPYGEEK  59
            DT+        P  V +    Y       +N   D++  ++  G+DI+   + + YG++K
Sbjct  208  DTWMLVQYSPEPEMVVYQVVQYRQTVWRKENLFKDVIAYMQLPGSDIVLQAVVISYGQDK  267

Query  60   AVKDAKDAGASGYIM-VDLP-PEEAIKFRNICTSEGL  94
             V+DAK      +   +D P PEE  K  +  TS  L
Sbjct  268  EVQDAKYEELQRFSFDIDFPLPEELEKHPDHMTSTAL  304


>A0A0B4K614_DROME unnamed protein product
Length=4716

 Score = 28.1 bits (61),  Expect = 1.1, Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 26/45 (58%), Gaps = 1/45 (2%)

Query  58    EKAVKDAKDAGASGYIMVDLPPEEAIKFR-NICTSEGLSYIPLVA  101
             +K V++A+       I+ DLPPE +I+ + + CT E L  + + A
Sbjct  2537  QKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFA  2581


>A0A0B4LH20_DROME unnamed protein product
Length=4724

 Score = 28.1 bits (61),  Expect = 1.1, Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 26/45 (58%), Gaps = 1/45 (2%)

Query  58    EKAVKDAKDAGASGYIMVDLPPEEAIKFR-NICTSEGLSYIPLVA  101
             +K V++A+       I+ DLPPE +I+ + + CT E L  + + A
Sbjct  2545  QKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFA  2589



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02940.1.1 Tryptophan

Length=159
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LSDA_DROME  unnamed protein product                                   26.9    5.4  
PEB3_DROME  unnamed protein product                                   25.4    8.2  
Q9W1H6_DROME  unnamed protein product                                 25.8    9.6  


>LSDA_DROME unnamed protein product
Length=890

 Score = 26.9 bits (58),  Expect = 5.4, Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (55%), Gaps = 4/51 (8%)

Query  105  AKRLGKKRIIAETGAGQHGVATATVCARFGMECHVFMGAEDVRRQGLNVFR  155
            AK+LGK  +I   GAG  G+A A    +FGM+  + + A D     ++ FR
Sbjct  261  AKKLGKVIVI---GAGISGLAVAHQLQQFGMDV-IVLEARDRVGGRISTFR  307


>PEB3_DROME unnamed protein product
Length=126

 Score = 25.4 bits (54),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 22/38 (58%), Gaps = 5/38 (13%)

Query  44   NDPEFWKELESYYEYMGRPSYLY-EATRLTEEAGGARI  80
            N PE WK+L++ Y+    P  +Y +  R T EA G ++
Sbjct  93   NKPEEWKQLQAKYD----PDEIYIKRYRATAEASGIKV  126


>Q9W1H6_DROME unnamed protein product
Length=260

 Score = 25.8 bits (55),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 29/75 (39%), Gaps = 3/75 (4%)

Query  46   PEFWKELESYYEYMGRPSYLYEATRL---TEEAGGARIWLKREDLNHTGSHKINNAVGQI  102
            PEF  E++S YE    PS  Y +  L   T    G    + +  LN   SH+    +   
Sbjct  81   PEFRNEIDSTYESSTEPSKQYSSLALINPTIATTGDYKCVVQTSLNTFSSHQRVQVIDLR  140

Query  103  LLAKRLGKKRIIAET  117
                 L  K I  ET
Sbjct  141  NYTLELSHKTIHNET  155



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


Query= Dcitr00g02950.1.1 Unknown

Length=273
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRSN_PIERA  unnamed protein product                                   31.2    0.64 
Q9VBA0_DROME  unnamed protein product                                 29.6    1.5  
Q8IMQ8_DROME  unnamed protein product                                 29.6    1.6  


>PRSN_PIERA unnamed protein product
Length=850

 Score = 31.2 bits (69),  Expect = 0.64, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query  83   AGSVWELVGDTLKKCRNVQHVKLRAMGLWHEDRRGLVEGLGAID  126
            A S+WELV D+ KK  N+    +  +G  ++++   V+ LG ID
Sbjct  748  ASSIWELVYDSSKKAYNIYSSDINNLGWIYQNKNFFVK-LGNID  790


>Q9VBA0_DROME unnamed protein product
Length=368

 Score = 29.6 bits (65),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 68/173 (39%), Gaps = 29/173 (17%)

Query  62   KNVPLELLSKVKTLHLNLPSAAGSVWELVGD--------TLKKCRNVQHVKLRAMGLWHE  113
            +N  +EL+ +    HL L S +  + E+ GD        T K+  N  H  +  +G    
Sbjct  49   RNSNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYK--  106

Query  114  DRRGLVEG--LGAIDPVSFEWT--SPDPPHHVSLSLVTPCLTILLHQL-----------P  158
                L  G  L  I   S+ ++     P   VS  + TP ++IL+H++           P
Sbjct  107  ----LPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDP  162

Query  159  KWTRLESLTLSHMQFPQCAHPDRYLPMILSPTVRFVKLGQAIRAPAKMLAGIA  211
             + R+ +     +        +  L   L  +  F  LG+ I  PAK+   +A
Sbjct  163  VFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLA  215


>Q8IMQ8_DROME unnamed protein product
Length=347

 Score = 29.6 bits (65),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 66/168 (39%), Gaps = 29/168 (17%)

Query  62   KNVPLELLSKVKTLHLNLPSAAGSVWELVGD--------TLKKCRNVQHVKLRAMGLWHE  113
            +N  +EL+ +    HL L S +  + E+ GD        T K+  N  H  +  +G    
Sbjct  28   RNSNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYK--  85

Query  114  DRRGLVEG--LGAIDPVSFEWT--SPDPPHHVSLSLVTPCLTILLHQL-----------P  158
                L  G  L  I   S+ ++     P   VS  + TP ++IL+H++           P
Sbjct  86   ----LPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDP  141

Query  159  KWTRLESLTLSHMQFPQCAHPDRYLPMILSPTVRFVKLGQAIRAPAKM  206
             + R+ +     +        +  L   L  +  F  LG+ I  PAK+
Sbjct  142  VFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKL  189



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 902331980


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g02960.1.1 Peptidase

Length=866
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IDE_DROME  unnamed protein product                                    45.1    2e-04
Q9VYT3_DROME  unnamed protein product                                 40.4    0.004


>IDE_DROME unnamed protein product
Length=990

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/224 (25%), Positives = 91/224 (41%), Gaps = 34/224 (15%)

Query  81   GCPHTLEHLVFLGSKLYPYKGVLDTLANRAFAAGTNAWTDTDQTVYTLQTAGYEGFLRML  140
            G  H  EH++FLG++ YP++    T  +++    +NA T    T Y    A  +     L
Sbjct  78   GLAHFCEHMLFLGTEKYPHENGYTTYLSQS-GGSSNAATYPLMTKYHFHVAP-DKLDGAL  135

Query  141  PVYMDHLLRPTITDAGYTTEIHHINEAGEDAGVVYSEMQGRSTAPFDLMEDK--HRALMY  198
              +    + P  T +    EI+ +N   E               P DL   K  +R L  
Sbjct  136  DRFAQFFIAPLFTPSATEREINAVNSEHE------------KNLPSDLWRIKQVNRHLAK  183

Query  199  PEQSAYRSETGGRMDALRVLTADK---VRD----FHKKYYAPHNLSLVVTGDIPTDKLLD  251
            P+  AY     G    L  +   K   VRD    FHK++Y+ + + L V G     + LD
Sbjct  184  PDH-AYSKFGSGNKTTLSEIPKSKNIDVRDELLKFHKQWYSANIMCLAVIG----KESLD  238

Query  252  VMQNVIEPRLIDDAKERGIELGIKPRGWKR-PFVETASAEPLKI  294
             ++ ++  +  +   +      +K  GW R P+ E    + +KI
Sbjct  239  ELEGMVLEKFSEIENK-----NVKVPGWPRHPYAEERYGQKVKI  277


>Q9VYT3_DROME unnamed protein product
Length=1147

 Score = 40.4 bits (93),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (52%), Gaps = 4/62 (6%)

Query  70   FVVPTEIFDDSGCPHTLEHLVFLGSKLYPYKGVLDTLANRAFAAGTNAWTDTDQTVYTLQ  129
            F  PT+     G  H LEH++F+GS+ YP + + D    +      NA TD + T++  +
Sbjct  147  FAEPTKY---QGLAHFLEHMIFMGSEKYPKENIFDAHIKKC-GGFANANTDCEDTLFYFE  202

Query  130  TA  131
             A
Sbjct  203  VA  204



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g02970.1.1 Ohcu

Length=176


***** No hits found *****



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g02980.1.1 Glucose-6-phosphate

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3D1_DROME  unnamed protein product                                 125     2e-34
Q8IP67_DROME  unnamed protein product                                 124     4e-34
X2JAD3_DROME  unnamed protein product                                 123     1e-33


>Q9V3D1_DROME unnamed protein product
Length=297

 Score = 125 bits (313),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/277 (34%), Positives = 138/277 (50%), Gaps = 23/277 (8%)

Query  11   IVHSSGN--SVVINKLGATITSFKDAHQKEHLFLSN--KLIPGKAIRGGIPIAFPVFGKP  66
            +V   GN  +  IN  GAT+ S++  + +E LF+S        KAIRGGIP  FP FG  
Sbjct  14   VVLDRGNNTTCTINLHGATVVSWR-VNNQEQLFVSKLASFDGKKAIRGGIPFVFPQFG--  70

Query  67   PTSGAYSDLPQHGYARISEWTYDETP-VMDNDDGVSVRFILDSPPKLP----PARLVYTV  121
                A+S  PQHG+ARI+ W  +  P  + N D  ++  ++D+           R+ Y +
Sbjct  71   ----AWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQFRITYRL  126

Query  122  TLTAHQLTSTLHVKNTSSTDVLPFQALLHTYY-AGNPNEVGVKGLNGVRYSDKTTGGETR  180
             L   +L   + V N S      F  LLHTY    +     + GL G  + DKT      
Sbjct  127  ILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKTRENALY  186

Query  181  IESNDVVYANKNTDSVYMNTTDEIHLTN---GIKIR--KHNLPDTVIWNPS-EGAKSMAD  234
             E  +VV  N+ TD +Y +T  E  +TN   G K+R  K+N PDTVIWNP  + ++ M+D
Sbjct  187  QEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDRSREMSD  246

Query  235  MHEGGWNEFICVEPGHVRDFYDLVPGKEWIGFQVITI  271
              +  +   +CVE G+V     L+PG  +   Q++ I
Sbjct  247  FGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQILQI  283


>Q8IP67_DROME unnamed protein product
Length=289

 Score = 124 bits (311),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 138/277 (50%), Gaps = 23/277 (8%)

Query  11   IVHSSGN--SVVINKLGATITSFKDAHQKEHLFLSN--KLIPGKAIRGGIPIAFPVFGKP  66
            +V   GN  +  IN  GAT+ S++  + +E LF+S        KAIRGGIP  FP FG  
Sbjct  14   VVLDRGNNTTCTINLHGATVVSWR-VNNQEQLFVSKLASFDGKKAIRGGIPFVFPQFG--  70

Query  67   PTSGAYSDLPQHGYARISEWTYDETP-VMDNDDGVSVRFILDSPPKLP----PARLVYTV  121
                A+S  PQHG+ARI+ W  +  P  + N D  ++  ++D+           R+ Y +
Sbjct  71   ----AWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQFRITYRL  126

Query  122  TLTAHQLTSTLHVKNTSSTDVLPFQALLHTYY-AGNPNEVGVKGLNGVRYSDKTTGGETR  180
             L   +L   + V N S      F  LLHTY    +     + GL G  + DKT      
Sbjct  127  ILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKTRENALY  186

Query  181  IESNDVVYANKNTDSVYMNTTDEIHLTN---GIKIR--KHNLPDTVIWNPS-EGAKSMAD  234
             E  +VV  N+ TD +Y +T  E  +TN   G K+R  K+N PDTVIWNP  + ++ M+D
Sbjct  187  QEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDRSREMSD  246

Query  235  MHEGGWNEFICVEPGHVRDFYDLVPGKEWIGFQVITI  271
              +  +   +CVE G+V     L+PG  +   Q++ +
Sbjct  247  FGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQILQV  283


>X2JAD3_DROME unnamed protein product
Length=308

 Score = 123 bits (309),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 137/275 (50%), Gaps = 23/275 (8%)

Query  11   IVHSSGN--SVVINKLGATITSFKDAHQKEHLFLSN--KLIPGKAIRGGIPIAFPVFGKP  66
            +V   GN  +  IN  GAT+ S++  + +E LF+S        KAIRGGIP  FP FG  
Sbjct  14   VVLDRGNNTTCTINLHGATVVSWR-VNNQEQLFVSKLASFDGKKAIRGGIPFVFPQFG--  70

Query  67   PTSGAYSDLPQHGYARISEWTYDETP-VMDNDDGVSVRFILDSPPKLP----PARLVYTV  121
                A+S  PQHG+ARI+ W  +  P  + N D  ++  ++D+           R+ Y +
Sbjct  71   ----AWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQFRITYRL  126

Query  122  TLTAHQLTSTLHVKNTSSTDVLPFQALLHTYY-AGNPNEVGVKGLNGVRYSDKTTGGETR  180
             L   +L   + V N S      F  LLHTY    +     + GL G  + DKT      
Sbjct  127  ILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKTRENALY  186

Query  181  IESNDVVYANKNTDSVYMNTTDEIHLTN---GIKIR--KHNLPDTVIWNPS-EGAKSMAD  234
             E  +VV  N+ TD +Y +T  E  +TN   G K+R  K+N PDTVIWNP  + ++ M+D
Sbjct  187  QEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDRSREMSD  246

Query  235  MHEGGWNEFICVEPGHVRDFYDLVPGKEWIGFQVI  269
              +  +   +CVE G+V     L+PG  +   Q++
Sbjct  247  FGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQIL  281



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g02990.1.1 Protein

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

2AAA_DROME  unnamed protein product                                   558     0.0  
Q9VN44_DROME  unnamed protein product                                 39.7    0.004
Q9VPR5_DROME  unnamed protein product                                 35.4    0.075


>2AAA_DROME unnamed protein product
Length=591

 Score = 558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/578 (50%), Positives = 410/578 (71%), Gaps = 9/578 (2%)

Query  1    MDEQLFPVALLLDELKSDDVTLRLNAIHRISTIALALGPDRTRDELIPFLQDSLDDEDEV  60
            +D+ L+P+A+L+DELK++DV LRLN+I ++STIALALG +RTR ELIPFL +++ DEDEV
Sbjct  8    VDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGEERTRSELIPFLTETIYDEDEV  67

Query  61   LLALAEELGSFTEYVGGKEYAHVTLAPLESLAGMEETLVRDKACESINKIAVELSSEQIE  120
            LLALA++LG+FT  VGG E+A   + PLESLA +EET+VRDKA ES+  +A E S++ +E
Sbjct  68   LLALADQLGNFTSLVGGPEFAMYLIPPLESLATVEETVVRDKAVESLRTVAAEHSAQDLE  127

Query  121  KYYLPELQRLTNGDWFTPRTSACALFASVYDQSNTAARQELRNLYKKLSNDDTPMVRRSA  180
             + +P LQRL +GDWFT RTSAC LF+  Y +     + ELR  ++KL  D+TPMVRR+A
Sbjct  128  IHVVPTLQRLVSGDWFTSRTSACGLFSVCYPRVTQPVKAELRANFRKLCQDETPMVRRAA  187

Query  181  AKNMADFVKVLPPQEILDDILPLYKKLSIDDQDSVRLLTVEALIAIMQKLDKQQVLTDLL  240
            A  + +F KV+  + +  D++P + +L+ DDQDSVRLL VEA ++I Q L +  V   +L
Sbjct  188  ANKLGEFAKVVETEYLKSDLIPNFVQLAQDDQDSVRLLAVEACVSIAQLLPQDDVEHLVL  247

Query  241  PCVRSACNDASWRVRFMVGQKFVEVAECVTQDVIRDELIQAFVNLLKDNEAEVRTASSSQ  300
            P +R   +D+SWRVR+MV +KFV++ + V  ++ R +L+ AF  LLKD EAEVR A +++
Sbjct  248  PTLRQCASDSSWRVRYMVAEKFVDLQKAVGPEITRVDLVPAFQYLLKDAEAEVRAAVATK  307

Query  301  IPGISKFVDQ----EIILAKILPVVREIAGDQSQHVRAAVGNELSGLAPLLGKEETVENL  356
            +      +D+    +IIL+ ILP VR++  D + HV++A+ + + GL+P+LG  +TVE L
Sbjct  308  VKDFCANLDKVNQVQIILSSILPYVRDLVSDPNPHVKSALASVIMGLSPMLGAYQTVEQL  367

Query  357  LPIFLQLLKDEFPDVRLNIISRLDKVNEVIGIDYLSKALLPAIFELAEDKQWRVRQAIIE  416
            LP+FL  LKDE P+VRLNIIS LD VN+VIGI  LS++LLPAI ELAED +WRVR AIIE
Sbjct  368  LPLFLIQLKDECPEVRLNIISNLDCVNDVIGIQQLSQSLLPAIVELAEDSKWRVRLAIIE  427

Query  417  YIPLLAKQLGVEFFNEQLGNLCMSWLGDTVFSIRDAATINLKNLTEVFGSEWASQTVVPK  476
            Y+P LA QLG EFF+++L  LCM WL D V++IR+AAT+N+K L E FG+ WA Q ++P 
Sbjct  428  YMPALAGQLGQEFFDQKLRGLCMGWLNDHVYAIREAATLNMKKLVEQFGAPWAEQAIIPM  487

Query  477  VVAMGNHSNYLYRMTTVFAITTMSPALEPKVIQEQILSIILSLTTDPIPNVRFNVAKCLE  536
            ++ M  + NYL+RMT +F +  ++      +  + +L  +L L  DP+ NVRFNVAK L+
Sbjct  488  ILVMSRNKNYLHRMTCLFCLNVLAEVCGTDITTKLLLPTVLLLAADPVANVRFNVAKTLQ  547

Query  537  VLSGNLQQTPEGQEVIQREILPAVEKLKEDQDADVRFF  574
             +S  L+ +     VI  ++ P ++KL  D D DV+ F
Sbjct  548  KISPFLEAS-----VIDAQVKPTLDKLNTDTDVDVKHF  580


 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 119/267 (45%), Gaps = 9/267 (3%)

Query  322  REIAGDQSQHVRAAVGNELSGLAPLLGKEETVENLLPIFLQLLKDEFPDVRLNIISRLDK  381
            R++  D++  VR A  N+L   A ++  E    +L+P F+QL +D+   VRL  +     
Sbjct  173  RKLCQDETPMVRRAAANKLGEFAKVVETEYLKSDLIPNFVQLAQDDQDSVRLLAVEACVS  232

Query  382  VNEVIGIDYLSKALLPAIFELAEDKQWRVRQAIIEYIPLLAKQLGVEFFNEQLGNLCMSW  441
            + +++  D +   +LP + + A D  WRVR  + E    L K +G E     L       
Sbjct  233  IAQLLPQDDVEHLVLPTLRQCASDSSWRVRYMVAEKFVDLQKAVGPEITRVDLVPAFQYL  292

Query  442  LGDTVFSIRDAATINLK----NLTEVFGSEWASQTVVPKVVAMGNHSNYLYRMTTVFAIT  497
            L D    +R A    +K    NL +V   +    +++P V  + +  N   +      I 
Sbjct  293  LKDAEAEVRAAVATKVKDFCANLDKVNQVQIILSSILPYVRDLVSDPNPHVKSALASVIM  352

Query  498  TMSPALEPKVIQEQILSIILSLTTDPIPNVRFNVAKCLEVLSGNLQQTPEGQEVIQREIL  557
             +SP L      EQ+L + L    D  P VR N+   L+ ++  +     G + + + +L
Sbjct  353  GLSPMLGAYQTVEQLLPLFLIQLKDECPEVRLNIISNLDCVNDVI-----GIQQLSQSLL  407

Query  558  PAVEKLKEDQDADVRFFANKAIESITG  584
            PA+ +L ED    VR    + + ++ G
Sbjct  408  PAIVELAEDSKWRVRLAIIEYMPALAG  434


>Q9VN44_DROME unnamed protein product
Length=1105

 Score = 39.7 bits (91),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 52/104 (50%), Gaps = 8/104 (8%)

Query  469  ASQTVVPKVV----AMGNHSNYLYRMTTVFAITTMSPALEPKV--IQEQILSIILSLTTD  522
              + V+P V+     M  H+++ +R   + AI+ +      ++  I ++++S +L+  +D
Sbjct  352  GGKIVLPLVMNALPVMLGHADWKHRFAALMAISAIGEGCHKQMEAILDEVMSGVLNFLSD  411

Query  523  PIPNVRFNVAKCLEVLSGNLQQTPEGQEVIQREILPAVEKLKED  566
            P P VR+     +  +S +  QT E +     +++P +  L +D
Sbjct  412  PHPRVRYAACNAIGQMSTDFAQTFEKK--FHSQVIPGLLSLLDD  453


>Q9VPR5_DROME unnamed protein product
Length=1340

 Score = 35.4 bits (80),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 123/258 (48%), Gaps = 28/258 (11%)

Query  193   PQEILDDILPLY------KKLSIDDQDSVRLLTVEALIAIMQKLDKQQVLTDLLPCVRSA  246
             PQ I ++ILP +       ++++D ++  +L  V+  + I  K+   +++  ++  ++  
Sbjct  839   PQYIKEEILPHFFKFFWNHRMALDRRNYRQL--VDTTVEIANKVGASEIINRVVDDLK--  894

Query  247   CNDASWRVRFMVGQKFVEVAECVTQDVIRDELIQAFVNLLKDNEAEVRTASSSQIPGISK  306
               D + + R MV +   ++   +    I   L +  ++ +     E  T     + G   
Sbjct  895   --DENEQYRKMVMETVEKIMGNLGAADIDSRLEEQLIDGILYAFQEQTTEDVVMLNGFGT  952

Query  307   FVDQEIILAKILPVVREIAG-------DQSQHVRAAVGNELSGLAPLLG---KEETVENL  356
              V+Q  +  ++ P + +I G       ++S  VR    + +S +A ++    +E+ + +L
Sbjct  953   IVNQ--LGKRVKPYLPQICGTILWRLNNKSAKVRQQAADLISRIAVVMKTCQEEKLMGHL  1010

Query  357   LPIFLQLLKDEFPDVRLNIISRLDKVNEVIGIDYLS---KALLPAIFELAEDKQWRVRQA  413
               +  + L +E+P+V  +I+  L  +  VIG+  ++   K LLP +  + +++  +V++ 
Sbjct  1011  GVVLYEYLGEEYPEVLGSILGALKAIVNVIGMTKMTPPIKDLLPRLTPILKNRHEKVQEN  1070

Query  414   IIEYIPLLAKQLGVEFFN  431
              I+ +  +A + G E+ +
Sbjct  1071  CIDLVGRIADR-GPEYVS  1087


 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  171  DDTPMVRRSAAKNMADFVKVLPPQEILDDILPLYKKLSIDDQDSVRLLTVEALIAIMQKL  230
            + +P +R+SA + + D  +      + + ILPL    +++DQ+  R L V+ +  ++ KL
Sbjct  542  NGSPPMRKSALRQITDKAREFGAGPLFNQILPLLMSPTLEDQE--RHLLVKVIDRVLYKL  599

Query  231  D  231
            D
Sbjct  600  D  600



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03000.1.1 L-threonine

Length=393
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K2J4_DROME  unnamed protein product                                 28.9    4.4  
SET1_DROME  unnamed protein product                                   28.9    6.1  


>Q7K2J4_DROME unnamed protein product
Length=603

 Score = 28.9 bits (63),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (54%), Gaps = 11/63 (17%)

Query  296  YFTSELGLQLSVPTETNMVVI----DLE--AAGIPPRVFRHRLLQFGVRVFEQGRLVFHN  349
            YF  +     ++PT T    +    DLE  A+  PP+   H +L+ G+R  +QG  +++N
Sbjct  282  YFNKDF---YTLPTTTKRPTLAISSDLEDSASNSPPQ--NHMVLRKGIRKIKQGMKMYNN  336

Query  350  QIT  352
            Q++
Sbjct  337  QLS  339


>SET1_DROME unnamed protein product
Length=1641

 Score = 28.9 bits (63),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 28/102 (27%)

Query  88    GTQANQISLRTHLHQPPHSV-LCDHRS-------HIYCWESGAISVLSQAQST-PVIPR-  137
              +QA+Q++L      PPHSV L D+ S       +I   E+  I+++SQ   T P  PR 
Sbjct  1226  ASQASQVALEHCYSLPPHSVSLGDYPSGKVNETKNILKREAENIAIVSQMTRTGPGRPRK  1285

Query  138   -------NKHHLT--LEDVANSMIPDG---------NIHFAP  161
                     K  L   + +V + M P+G         N+HF P
Sbjct  1286  DPICIQKKKRDLAPRMSNVKSKMTPNGDEWPDLAHKNVHFVP  1327



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03010.1.1 60S

Length=188
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RL38_DROME  unnamed protein product                                   80.5    1e-20
A8JTM7_DROME  unnamed protein product                                 27.3    5.8  
Q95SN5_DROME  unnamed protein product                                 26.9    6.4  


>RL38_DROME unnamed protein product
Length=70

 Score = 80.5 bits (197),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 9/68 (13%)

Query  118  EIKDIKNFLEIARRKDARSARIKKTKTIGAKGESAQLTKFKIRCSRYLYTLVVSDAEKAE  177
            EIK++K+FL  ARR DAR+ +IKK  T          TKFKIRCSR+LYTLVV D EKA+
Sbjct  4    EIKEVKDFLNKARRSDARAVKIKKNPTN---------TKFKIRCSRFLYTLVVQDKEKAD  54

Query  178  KLKQSLPP  185
            K+KQSLPP
Sbjct  55   KIKQSLPP  62


>A8JTM7_DROME unnamed protein product
Length=4769

 Score = 27.3 bits (59),  Expect = 5.8, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 16/32 (50%), Gaps = 0/32 (0%)

Query  75    NIDIVEPSDNCTFCSKCGIVGGGKTCALVDAN  106
             N  +  P DN T    C +V GG  CA  DA+
Sbjct  4482  NTSLPNPCDNSTCSHLCLLVPGGHRCACPDAS  4513


>Q95SN5_DROME unnamed protein product
Length=1952

 Score = 26.9 bits (58),  Expect = 6.4, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 16/32 (50%), Gaps = 0/32 (0%)

Query  75    NIDIVEPSDNCTFCSKCGIVGGGKTCALVDAN  106
             N  +  P DN T    C +V GG  CA  DA+
Sbjct  1665  NTSLPNPCDNSTCSHLCLLVPGGHRCACPDAS  1696



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03020.1.1 ABC

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF20_DROME  unnamed protein product                                 494     8e-163
MDR49_DROME  unnamed protein product                                  233     6e-64 
MDR65_DROME  unnamed protein product                                  223     8e-61 


>Q9VF20_DROME unnamed protein product
Length=866

 Score = 494 bits (1272),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 257/572 (45%), Positives = 364/572 (64%), Gaps = 12/572 (2%)

Query  243  FKRMYDLGDILWPRNSVYLQSVAFFCLGLLVAGRYINLVVPIQLGKVIQDLTAFSSP---  299
            ++++  +   LWP+ ++ LQ     C+ LL+AGR I L +PI   K++  LT   +P   
Sbjct  229  WRKLRTVFPYLWPKKNIALQIAVIVCIILLLAGRVIKLFLPIYRKKLVDSLTI--APIVF  286

Query  300  -WKHLALYLVLRFFQGSG----GLLQVIQSVAWIPITQWTDQKMSTHCFTHLLNLSLAFH  354
             W  + +Y+ L F QG G    GL   +++  WI + Q+T +++    F HL  LSL +H
Sbjct  287  RWDFVLIYVALSFLQGGGTGSMGLFNNLRTFLWIRVQQYTTREIEIELFRHLHQLSLRWH  346

Query  355  THRKTGEILRILDKGA-ALNGFFQILLFNIFPTIADILVALGYFFFKFGPLLSIIIATVM  413
              RKTGE+LR++D+G  ++N     ++F+I PTI D+LVA+ YF + F     +I+   M
Sbjct  347  LQRKTGEVLRVMDRGTDSINNLLNYIVFSIAPTILDLLVAVAYFVYAFNWWFGLIVFLTM  406

Query  414  FLYGFISIVITRWRTEQRRDYVAKDNATKAIYTDALLNYDTIKYFTAEDNEINRYTRAFK  473
            FLY   +I IT WRT+ +R     DN  +A   D+LLN++T+KY+ AE  E++ Y  A  
Sbjct  407  FLYIASTIAITEWRTKYQRRMNLADNEQRARSVDSLLNFETVKYYGAEHYEVDCYREAIL  466

Query  474  DFQAVEKKVIASLYLLNMAQNIIIVSGIATGTAVVCAGIIKNKA-EAAELVVFLTFLQQL  532
             +Q  E   + +L +LN AQNII+  G+  G+ +    ++ ++     + V+F T+L +L
Sbjct  467  KYQKEEFLSMLTLNMLNTAQNIILCLGLLAGSLLCVYLVVHHQTLTVGDFVLFSTYLMEL  526

Query  533  YVPLNNLGSIYRAINTSLVDSERLMQLLAEPTDINDKPNAITLETRQPVIKFENVGFSYD  592
            Y+PLN  G+ YRAI  + VD E +  LL E  +I D P    L T    I+F NV F Y 
Sbjct  527  YMPLNWFGTYYRAIQKNFVDMENMFDLLKEEEEIVDAPGCSPLLTAGGGIEFSNVTFGYS  586

Query  593  TTNDALSGLSFDVPTGKTVALVGESGSGKSTILRLLYRFYDIKEGSINIDGIDIRDMKQQ  652
                 L  +SF VP GKTVA+VG SG+GKSTI+RLL+RFYD++ G+I IDG +I+ ++QQ
Sbjct  587  PEKIVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQ  646

Query  653  SLRKHIAIIPQDCALFNETIAFNLKYGKENASEEEIMNAARAAQMHERVLSFSNGYDTRV  712
            SLRK I ++PQD  LFN TI +N++Y K  AS+E +  AARAA +HER+L F   Y+T+V
Sbjct  647  SLRKAIGVVPQDTVLFNNTIFYNIEYAKLGASDEAVYEAARAADIHERILGFPEKYETKV  706

Query  713  GERGVRLSGGEKQRIAIARALLKDAPILCLDEATSALDTNTEREIQSAFNELSQGRTTII  772
            GERG+RLSGGEKQR+AIAR LLK   I+ LDEATSALDT+TER IQ+A   +   RTTII
Sbjct  707  GERGLRLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCANRTTII  766

Query  773  IAHRLSTIAKADKILFIQNGRVTESGTHSELL  804
            +AHRLSTI  AD+IL +Q G + E G H EL+
Sbjct  767  VAHRLSTIIHADEILVLQQGSIAERGRHEELV  798


>MDR49_DROME unnamed protein product
Length=1302

 Score = 233 bits (593),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 158/227 (70%), Gaps = 2/227 (1%)

Query  582  IKFENVGFSYDTTNDA--LSGLSFDVPTGKTVALVGESGSGKSTILRLLYRFYDIKEGSI  639
            I+FE + F Y    D   L GL+ DV  G+TVA VG SG GKST+++L+ RFYD + GS+
Sbjct  402  IRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSV  461

Query  640  NIDGIDIRDMKQQSLRKHIAIIPQDCALFNETIAFNLKYGKENASEEEIMNAARAAQMHE  699
             +DG D+R +    LR  I ++ Q+  LF  TI  N++YG+ +A++ +I  AARAA  H+
Sbjct  462  KLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHD  521

Query  700  RVLSFSNGYDTRVGERGVRLSGGEKQRIAIARALLKDAPILCLDEATSALDTNTEREIQS  759
             +     GYDT+VGE+G ++SGG+KQRIAIARAL++   +L LDEATSALD  +E+ +QS
Sbjct  522  FITRLPKGYDTQVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQS  581

Query  760  AFNELSQGRTTIIIAHRLSTIAKADKILFIQNGRVTESGTHSELLSQ  806
            A    SQG TT+++AHRLSTI  ADKI+F+++G V E GTH EL+ +
Sbjct  582  ALELASQGPTTLVVAHRLSTITNADKIVFLKDGVVAEQGTHEELMER  628


 Score = 209 bits (533),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 168/267 (63%), Gaps = 8/267 (3%)

Query  546   INTSLVDSERLMQLLAEPTDINDKPNAI--TLETRQPVIKFENVGFSYDTTNDA--LSGL  601
             +N +++ + RLM L    +   + P +   T+E  +  I +ENVGF Y T      L GL
Sbjct  1021  VNDAILSAGRLMDLFKRTSTQPNPPQSPYNTVEKSEGDIVYENVGFEYPTRKGTPILQGL  1080

Query  602   SFDVPTGKTVALVGESGSGKSTILRLLYRFYDIKEGSINIDGIDIRDMKQQSLRKHIAII  661
             +  +    TVALVG SGSGKST ++LL R+YD   GS+N+ G+   +    +LR  + ++
Sbjct  1081  NLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLV  1140

Query  662   PQDCALFNETIAFNLKYG---KENASEEEIMNAARAAQMHERVLSFSNGYDTRVGERGVR  718
              Q+  LF+ TIA N+ YG   +++ S +EI+ AA+ + +H  + +   GYDTR+G+   +
Sbjct  1141  SQEPVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTS-Q  1199

Query  719   LSGGEKQRIAIARALLKDAPILCLDEATSALDTNTEREIQSAFNELSQGRTTIIIAHRLS  778
             LSGG+KQRIAIARAL+++  IL LDEATSALD  +E+ +Q A +E   GRT + IAHRL+
Sbjct  1200  LSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRLT  1259

Query  779   TIAKADKILFIQNGRVTESGTHSELLS  805
             T+  AD I  ++ G V E GTH EL++
Sbjct  1260  TVRNADLICVLKRGVVVEHGTHDELMA  1286


>MDR65_DROME unnamed protein product
Length=1302

 Score = 223 bits (569),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 173/272 (64%), Gaps = 10/272 (4%)

Query  545   AINTSLVDSERLMQLLAEPTDINDKPNAI--TLETRQPV---IKFENVGFSYDTTNDA--  597
             A + +L+   RL Q+L     I      I  TL  +  +   +++  + F Y T  DA  
Sbjct  1017  AFSAALIAGHRLFQILDRKPKIQSPMGTIKNTLAKQLNLFEGVRYRGIQFRYPTRPDAKI  1076

Query  598   LSGLSFDVPTGKTVALVGESGSGKSTILRLLYRFYDIKEGSINIDGIDIR-DMKQQSLRK  656
             L+GL  +V  G+TVALVG SG GKST ++LL R+YD  EG+I+ID  DI+ D+    +R 
Sbjct  1077  LNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDGVRT  1136

Query  657   HIAIIPQDCALFNETIAFNLKYG--KENASEEEIMNAARAAQMHERVLSFSNGYDTRVGE  714
              + I+ Q+  LF  +IA N+ YG  + + S  EI+ AA++A  H  ++S  NGYDTR+G 
Sbjct  1137  KLGIVSQEPTLFERSIAENIAYGDNRRSVSMVEIIAAAKSANAHSFIISLPNGYDTRMGA  1196

Query  715   RGVRLSGGEKQRIAIARALLKDAPILCLDEATSALDTNTEREIQSAFNELSQGRTTIIIA  774
             RG +LSGG+KQRIAIARAL+++  IL LDEATSALD  +E+ +Q A +    GRT I+IA
Sbjct  1197  RGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDLQSEQLVQQALDTACSGRTCIVIA  1256

Query  775   HRLSTIAKADKILFIQNGRVTESGTHSELLSQ  806
             HRLST+  AD I  IQNG+V E G H +L+SQ
Sbjct  1257  HRLSTVQNADVICVIQNGQVVEQGNHMQLISQ  1288


 Score = 216 bits (549),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 158/226 (70%), Gaps = 2/226 (1%)

Query  582  IKFENVGFSYDTTNDAL--SGLSFDVPTGKTVALVGESGSGKSTILRLLYRFYDIKEGSI  639
            ++F++V F Y +  + +   GL+  +  G+TVALVG SG GKST ++LL RFYD   GS+
Sbjct  405  VEFQDVFFRYPSRPEVIVHRGLNIRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPVFGSV  464

Query  640  NIDGIDIRDMKQQSLRKHIAIIPQDCALFNETIAFNLKYGKENASEEEIMNAARAAQMHE  699
             +D +DIR    Q LR +IA++ Q+  LF  TIA N+ YGK  A+++EI  AA  A  HE
Sbjct  465  LLDDLDIRKYNIQWLRSNIAVVGQEPVLFLGTIAQNISYGKPGATQKEIEAAATQAGAHE  524

Query  700  RVLSFSNGYDTRVGERGVRLSGGEKQRIAIARALLKDAPILCLDEATSALDTNTEREIQS  759
             + +    Y + +GERG +LSGG+KQRIAIARAL+++  IL LDEATSALD  +E+++Q 
Sbjct  525  FITNLPESYRSMIGERGSQLSGGQKQRIAIARALIQNPKILLLDEATSALDYQSEKQVQQ  584

Query  760  AFNELSQGRTTIIIAHRLSTIAKADKILFIQNGRVTESGTHSELLS  805
            A +  S+GRTTI+++HRLS I  ADKI+FI +G+V E G+H +L++
Sbjct  585  ALDLASKGRTTIVVSHRLSAIRGADKIVFIHDGKVLEEGSHDDLMA  630



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03030.1.1 Methylcrotonoyl-CoA

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCCB_DROME  unnamed protein product                                   632     0.0  
Q7JV23_DROME  unnamed protein product                                 33.5    0.24 
A1Z784_DROME  unnamed protein product                                 33.5    0.24 


>MCCB_DROME unnamed protein product
Length=578

 Score = 632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/431 (71%), Positives = 353/431 (82%), Gaps = 17/431 (4%)

Query  1    MLVRDRIDALIDPGSPFLELSQLAAHQMY-ENQSPSAGIITGIGTIHGTECMIVANDATV  59
            +L R+RI+ L+D GSPFLELS LA H++Y E    S GI+TG+G + GTEC++VANDATV
Sbjct  80   LLARERINLLLDKGSPFLELSALAGHELYGEEVVNSGGIVTGVGRVCGTECLVVANDATV  139

Query  60   KGGTYYPMTAKKHLRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQAN  119
            KGG+YYP+T KKHLRAQEIA EN LPCIYLVDSGGANL  QA+ FPDK HFGRIF+NQAN
Sbjct  140  KGGSYYPITVKKHLRAQEIAQENRLPCIYLVDSGGANLPRQADVFPDKLHFGRIFYNQAN  199

Query  120  MSAKGIPQIAVVLGLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEEL  179
            MSA+GIPQIAVV+G CTAGGAYVPAM+D+SIIVK QGTI+LAGPPLV+AATGE VSAE+L
Sbjct  200  MSAQGIPQIAVVMGSCTAGGAYVPAMADESIIVKKQGTIFLAGPPLVKAATGEEVSAEDL  259

Query  180  GGADLHCRTSGVTDHYALNDHHALDLTRDIFKT-SLS-RNSLSDLCPH------------  225
            GGADLHC+TSGVTDHYAL+D HAL L R I    +LS  NS +D   H            
Sbjct  260  GGADLHCKTSGVTDHYALDDEHALYLARQIVSNLNLSATNSYNDQLMHSSQVNFQTATPP  319

Query  226  --FEEPLYPAEELYGIVGTDLKKSFDVKEVIMRIVDGSKFSEFKPLYGESLVTAFANIYG  283
               EEP Y AEELYGIVG +L KSFDV+EVI RIVDGS+F+EFK LYGE+LV  FA +YG
Sbjct  320  SAVEEPRYDAEELYGIVGPNLTKSFDVREVIARIVDGSRFTEFKKLYGETLVCGFAKLYG  379

Query  284  IKCGIVANNGVLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAK  343
               GIV NNGVLFSESALKG+HFI+LC QRKIPL+F+QNITGFMVG+DAE  GIAKNGAK
Sbjct  380  HTVGIVGNNGVLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAK  439

Query  344  MVTAVACAKVPKITLIIGGSYGAGNYGMCGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQ  403
            MVTAVACA VPK T+IIGGSYGAGNYGMCGR YSPRFL+ WPNS+I+VMGG QAA V+AQ
Sbjct  440  MVTAVACANVPKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAANVMAQ  499

Query  404  VTRENRRRVWK  414
            +T + R+R  K
Sbjct  500  ITEDQRKRAGK  510


>Q7JV23_DROME unnamed protein product
Length=2323

 Score = 33.5 bits (75),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 59/155 (38%), Gaps = 27/155 (17%)

Query  259   DGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNG-------------------------  293
             D   +SE    + +++VT  A + G+  G++A                            
Sbjct  1928  DRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAG  1987

Query  294   -VLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAK  352
              V + +S+ K +  I+   + ++PLI   N  GF  G       I K GA +V  +   K
Sbjct  1988  QVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYK  2047

Query  353   VPK-ITLIIGGSYGAGNYGMCGRPYSPRFLFTWPN  386
              P  I L        G + +     +PR++ T+ +
Sbjct  2048  KPVLIYLPPNAELRGGAWAVLDSLINPRYMETYAD  2082


>A1Z784_DROME unnamed protein product
Length=2482

 Score = 33.5 bits (75),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 59/155 (38%), Gaps = 27/155 (17%)

Query  259   DGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNG-------------------------  293
             D   +SE    + +++VT  A + G+  G++A                            
Sbjct  2087  DRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAG  2146

Query  294   -VLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAK  352
              V + +S+ K +  I+   + ++PLI   N  GF  G       I K GA +V  +   K
Sbjct  2147  QVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYK  2206

Query  353   VPK-ITLIIGGSYGAGNYGMCGRPYSPRFLFTWPN  386
              P  I L        G + +     +PR++ T+ +
Sbjct  2207  KPVLIYLPPNAELRGGAWAVLDSLINPRYMETYAD  2241



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03040.1.1 Pancreatic

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8T1_DROME  unnamed protein product                                 126     1e-34
Q7K3Z8_DROME  unnamed protein product                                 98.6    2e-24
Q9VX69_DROME  unnamed protein product                                 98.6    4e-24


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 126 bits (316),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 113/206 (55%), Gaps = 10/206 (5%)

Query  5    VGILAAEMVNKLVELNFTQYDRIHMIGHSLGAHVSGATGTYCKE-KMARITGLDPAGPGF  63
            V    A+++  L+E    + + +H+IG  LGAHV+G  G +  E K+  IT LDPA P +
Sbjct  123  VARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFY  182

Query  64   MVLMGNDMRLDMSDAQFVDVIHTAAGVAGYYGVLGHADFYPNSGKPPQPGCVELSLNVYK  123
            MV     ++LD +DA+FVDV+HT   + G    +GH DFY N G   QP C  ++     
Sbjct  183  MV-KDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVS-QPNCGPIN-----  235

Query  124  VVSSGFGCSHMRSYELYTESIVNPKAFKSIKCDSWYDYESKTYCNESDIQYMGDPVQPTA  183
             + + F C H R+ + Y ESI +P  F    C ++  +       + +I+ MG  V P A
Sbjct  236  KMETHF-CYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKA  294

Query  184  RGVYYLATGDKPPYSLIDNMTDSISR  209
            RG Y+L T + PPY+  +N T SISR
Sbjct  295  RGRYFLDTNNGPPYAKGENFT-SISR  319


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 98.6 bits (244),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 99/203 (49%), Gaps = 16/203 (8%)

Query  4    QVGILAAEMVNKLVELNFTQYDRIHMIGHSLGAHVSGATG------TYCKEKMARITGLD  57
            Q+G   A+++ K+ +      ++ H++GHS+G  ++G  G      T    K+ RI+ LD
Sbjct  115  QLGPELAKVLLKMFDHGL-DIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALD  173

Query  58   PAGPGFMVLMGNDMRLDMSDAQFVDVIHTAAGVAGYYGVLGHADFYPNSGKPPQPGCVEL  117
            PA P F         L  +DA+FVDVIHT A + G     G ADF+PN G   QPGC + 
Sbjct  174  PAFPLFY----PGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKR  229

Query  118  SLNVYKVVSSGFGCSHMRSYELYTESIVN--PKAFKSIKCDSWYDYESKTYCNESDIQYM  175
            +   YK++S     SH RS+  + ES+ +  P  F ++    W D++            M
Sbjct  230  N---YKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVM  286

Query  176  GDPVQPTARGVYYLATGDKPPYS  198
            G     T  G +YL T    P++
Sbjct  287  GHHCPTTIHGDFYLQTNGHTPFA  309


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 98.6 bits (244),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 106/221 (48%), Gaps = 33/221 (15%)

Query  2    THQVGILAAEMVNKLVELNFTQYDRIHMIGHSLGAHVSGATGTYCK----EKMARITGLD  57
            T ++G   A  + KL++L     + IH+IGHSLGAH+ G+ G + +    + + RITGLD
Sbjct  185  TEEIGENIALGLVKLLDL--VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLD  242

Query  58   PAGPGF---MVLMGNDMRLDMSDAQFVDVIHTAAGVAGYYGVLGHADFYPNSGKPPQPGC  114
            PA P F     L G    L   DA FVDVIH+  GV G    +G  DFYP    P   GC
Sbjct  243  PAKPCFNEGEALSG----LMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGC  298

Query  115  VELSLNVYKVVSSGFGCSHMRSYELYTESIV--NPKAFKSIKCDSWYDYESKTYCNESDI  172
              ++            C+H RS+E + E++   N + F + +C+S      + +    D 
Sbjct  299  FSVT------------CAHARSWEYFAETVFPGNERNFMATRCNSISKL--RDFRCPGDE  344

Query  173  QYMGDPVQPTARGVYYLATGDKPPYSLIDNMTDSISRAASL  213
              MG  V    +G Y+L      P+     M  S+ R+A L
Sbjct  345  VPMGYAVPQNIKGNYFLEVSASAPFG----MHASVVRSAHL  381



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03050.1.1 Lipase

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8T1_DROME  unnamed protein product                                 161     2e-45
Q7K3Z8_DROME  unnamed protein product                                 150     2e-41
Q9VX69_DROME  unnamed protein product                                 137     6e-36


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 160/321 (50%), Gaps = 27/321 (8%)

Query  173  NQQVSFWLYTRYNPQCKQILYVNDPDSILDSY-FSSDKKTVVLVHGWLNAGNMSFSQTLK  231
            N  +SFWLYT+ N +  ++         L+ + F   K   VL+HG+    + S +  L+
Sbjct  35   NANISFWLYTKENQEGTKLSVFE-----LNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLR  89

Query  232  NSYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLV  291
              +L   DYN+I +D+  LA    Y  A    KY+ +  A +L  +  +        HL+
Sbjct  90   PLFLT-QDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLI  148

Query  292  GHSLGAHVCGIAGENIAHGKIGRITGLDPALPLF-SSNITGRLDSTDATFVDIIHTCGGY  350
            G  LGAHV G  G+ +   K+  IT LDPA P +   +   +LD TDA FVD++HT    
Sbjct  149  GLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTM  208

Query  351  LGYYQPCGHVDFYPNGGTFIQPGCG----WDIGTCSHTRSYMFFTESIRTKIGFYARQCN  406
            LG     GHVDFY N G   QP CG     +   C H R+  ++ ESI +  GFY   C 
Sbjct  209  LGLLDAVGHVDFYLNMGV-SQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCP  267

Query  407  SWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYALGRYFPQPKHDTFPSSR  466
            ++  + KG C    +++ LMG HV+  ARG+Y+L T +  PYA G        + F S  
Sbjct  268  NFKSFAKGICIPD-KNIELMGFHVDPKARGRYFLDTNNGPPYAKG--------ENFTSIS  318

Query  467  GQLRGHLRTYRKYVNSVLIKE  487
             QL+G     R +VN  +I +
Sbjct  319  RQLKG-----RTFVNDDIIDK  334


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 146/302 (48%), Gaps = 24/302 (8%)

Query  168  SKSELNQQVSFWLYTRYNPQCKQILYVNDPDSIL-DSYFSSDKKTVVLVHGWLNAGNMSF  226
            SK++L     F LY         I  + D  S+L D +    K TV+ +HG+L   ++  
Sbjct  18   SKADLTT-AKFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVES  76

Query  227  SQTLKNSYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWC  286
               +  +YLE  D N+I +DW  LA       A   +K +G  LA +L  +    G D  
Sbjct  77   IHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKM-FDHGLDIE  135

Query  287  MFHLVGHSLGAHVCGIAGENIAHG-----KIGRITGLDPALPLFSSNITGRLDSTDATFV  341
             FH+VGHS+G  + G+ G  I        KI RI+ LDPA PLF       L + DA FV
Sbjct  136  KFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT--HLSANDAEFV  193

Query  342  DIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGW-------DIGTCSHTRSYMFFTESI  394
            D+IHT     G     G  DF+PNGG  +QPGC         D    SH RS+ F+ ES+
Sbjct  194  DVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESV  253

Query  395  --RTKIGFYARQCNSWSDYKKGHCKGSVEDM--ILMGEHVNTSARGKYYLMTASSKPYAL  450
              R  IGF A     WSD+K+      VE+   ++MG H  T+  G +YL T    P+A 
Sbjct  254  SDRYPIGFDAVPAKKWSDFKQNKI---VENCPPVVMGHHCPTTIHGDFYLQTNGHTPFAR  310

Query  451  GR  452
            G+
Sbjct  311  GK  312


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 142/271 (52%), Gaps = 18/271 (7%)

Query  189  KQILYVNDPDSILDS-YFSSDKKTVVLVHGWLNAGNMSFS-QTLKNSYLELHDYNIICVD  246
            K+   +  P+S+  S  F   KK V+L  GW    N S + +    +Y    D N + VD
Sbjct  110  KKNFPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVD  169

Query  247  WSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGHSLGAHVCGIAGEN  306
             +    + LY  + +  + IG+++A  L  +      +    HL+GHSLGAH+ G AG +
Sbjct  170  AARFV-DTLYTWSAFNTEEIGENIALGLVKLLDLVPVE--NIHLIGHSLGAHIVGSAGRH  226

Query  307  IAH---GKIGRITGLDPALPLFSSN--ITGRLDSTDATFVDIIHTCGGYLGYYQPCGHVD  361
            + H     I RITGLDPA P F+    ++G L   DA FVD+IH+  G LG   P G VD
Sbjct  227  LQHLTNQTIPRITGLDPAKPCFNEGEALSG-LMRGDAHFVDVIHSNPGVLGKRDPVGDVD  285

Query  362  FYPNGGTFIQPGCGWDIGTCSHTRSYMFFTESI--RTKIGFYARQCNSWSDYKKGHCKGS  419
            FYP G + +  GC + + TC+H RS+ +F E++    +  F A +CNS S  +   C G 
Sbjct  286  FYPGGMSPLAAGC-FSV-TCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCPG-  342

Query  420  VEDMILMGEHVNTSARGKYYLMTASSKPYAL  450
              D + MG  V  + +G Y+L  ++S P+ +
Sbjct  343  --DEVPMGYAVPQNIKGNYFLEVSASAPFGM  371



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03050.1.2 Lipase

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8T1_DROME  unnamed protein product                                 127     3e-35
Q7K3Z8_DROME  unnamed protein product                                 116     5e-31
Q8SXG0_DROME  unnamed protein product                                 117     7e-31


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 127 bits (320),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 108/205 (53%), Gaps = 20/205 (10%)

Query  16   FHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLF-SSNITGRLDSTDATFVDIIHT  74
             HL+G  LGAHV G  G+ +   K+  IT LDPA P +   +   +LD TDA FVD++HT
Sbjct  145  LHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHT  204

Query  75   CGGYLGYYQPCGHVDFYPNGGTFIQPGCG----WDIGTCSHTRSYMFFTESIRTKIGFYA  130
                LG     GHVDFY N G   QP CG     +   C H R+  ++ ESI +  GFY 
Sbjct  205  DVTMLGLLDAVGHVDFYLNMGV-SQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYG  263

Query  131  RQCNSWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYALGRYFPQPKHDTF  190
              C ++  + KG C    +++ LMG HV+  ARG+Y+L T +  PYA G        + F
Sbjct  264  FYCPNFKSFAKGICIPD-KNIELMGFHVDPKARGRYFLDTNNGPPYAKG--------ENF  314

Query  191  PSSRGQLRGHLRTYRKYVNSVLIKE  215
             S   QL+G     R +VN  +I +
Sbjct  315  TSISRQLKG-----RTFVNDDIIDK  334


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 116 bits (291),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 95/187 (51%), Gaps = 21/187 (11%)

Query  10   GYDWCMFHLVGHSLGAHVCGIAGENIAHG-----KIGRITGLDPALPLFSSNITGRLDST  64
            G D   FH+VGHS+G  + G+ G  I        KI RI+ LDPA PLF       L + 
Sbjct  131  GLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT--HLSAN  188

Query  65   DATFVDIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGW-------DIGTCSHTRSYMF  117
            DA FVD+IHT     G     G  DF+PNGG  +QPGC         D    SH RS+ F
Sbjct  189  DAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWF  248

Query  118  FTESI--RTKIGFYARQCNSWSDYKKGHCKGSVED--MILMGEHVNTSARGKYYLMTASS  173
            + ES+  R  IGF A     WSD+K+      VE+   ++MG H  T+  G +YL T   
Sbjct  249  WAESVSDRYPIGFDAVPAKKWSDFKQNKI---VENCPPVVMGHHCPTTIHGDFYLQTNGH  305

Query  174  KPYALGR  180
             P+A G+
Sbjct  306  TPFARGK  312


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 117 bits (293),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 96/169 (57%), Gaps = 11/169 (7%)

Query  16   FHLVGHSLGAHVCGIAGENIAH---GKIGRITGLDPALPLFSS-NITGRLDSTDATFVDI  71
             HL+GHSLGAH+ G AG ++ H     I RITGLDPA P F+       L   DA FVD+
Sbjct  208  IHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDV  267

Query  72   IHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGWDIGTCSHTRSYMFFTESI--RTKIGFY  129
            IH+  G LG   P G VDFYP G + +  GC + + TC+H RS+ +F E++    +  F 
Sbjct  268  IHSNPGVLGKRDPVGDVDFYPGGMSPLAAGC-FSV-TCAHARSWEYFAETVFPGNERNFM  325

Query  130  ARQCNSWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYAL  178
            A +CNS S  +   C G   D + MG  V  + +G Y+L  ++S P+ +
Sbjct  326  ATRCNSISKLRDFRCPG---DEVPMGYAVPQNIKGNYFLEVSASAPFGM  371



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03060.1.1 Methylcrotonoyl-CoA

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCCB_DROME  unnamed protein product                                   751     0.0  
Q7JV23_DROME  unnamed protein product                                 33.5    0.29 
A1Z784_DROME  unnamed protein product                                 33.5    0.32 


>MCCB_DROME unnamed protein product
Length=578

 Score = 751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/549 (66%), Positives = 441/549 (80%), Gaps = 18/549 (3%)

Query  14   FYSKINTKSSQFQQNHDDMVQLVEILKSNVRKIVQGDA-RSQEKHLKKGKMLVRDRIDAL  72
             +S+++ +S+++++N  +M  LV  L++   ++++G   ++ E+H  +GK+L R+RI+ L
Sbjct  30   LHSEVDKQSAEYKENAREMASLVGDLRNFTSQVLKGGGQKAIERHTSRGKLLARERINLL  89

Query  73   IDPGSPFLELSQLAAHQMY-ENQSPSAGIITGIGTIHGTECMIVANDATVKGGTYYPMTA  131
            +D GSPFLELS LA H++Y E    S GI+TG+G + GTEC++VANDATVKGG+YYP+T 
Sbjct  90   LDKGSPFLELSALAGHELYGEEVVNSGGIVTGVGRVCGTECLVVANDATVKGGSYYPITV  149

Query  132  KKHLRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQANMSAKGIPQIA  191
            KKHLRAQEIA EN LPCIYLVDSGGANL  QA+ FPDK HFGRIF+NQANMSA+GIPQIA
Sbjct  150  KKHLRAQEIAQENRLPCIYLVDSGGANLPRQADVFPDKLHFGRIFYNQANMSAQGIPQIA  209

Query  192  VVLGLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEELGGADLHCRTS  251
            VV+G CTAGGAYVPAM+D+SIIVK QGTI+LAGPPLV+AATGE VSAE+LGGADLHC+TS
Sbjct  210  VVMGSCTAGGAYVPAMADESIIVKKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCKTS  269

Query  252  GVTDHYALNDHHALDLTRDIFKT-SLS-RNSLSDLC--------------PDFEEPLYPA  295
            GVTDHYAL+D HAL L R I    +LS  NS +D                   EEP Y A
Sbjct  270  GVTDHYALDDEHALYLARQIVSNLNLSATNSYNDQLMHSSQVNFQTATPPSAVEEPRYDA  329

Query  296  EELYGIVGTDLKKSFDVKEVIMRIVDGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNG  355
            EELYGIVG +L KSFDV+EVI RIVDGS+F+EFK LYGE+LV  FA +YG   GIV NNG
Sbjct  330  EELYGIVGPNLTKSFDVREVIARIVDGSRFTEFKKLYGETLVCGFAKLYGHTVGIVGNNG  389

Query  356  VLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAKV  415
            VLFSESALKG+HFI+LC QRKIPL+F+QNITGFMVG+DAE  GIAKNGAKMVTAVACA V
Sbjct  390  VLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAKMVTAVACANV  449

Query  416  PKITLIIGGSYGAGNYGMCGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQVTRENRRRVG  475
            PK T+IIGGSYGAGNYGMCGR YSPRFL+ WPNS+I+VMGG QAA V+AQ+T + R+R G
Sbjct  450  PKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAANVMAQITEDQRKRAG  509

Query  476  KPWTEEDETKLKSPIIKKFDQESDCYYATARLWDDGIIDPADTRKVLGLSLSVALKSPIE  535
            K ++EE+  KLK+PI++ F+ E   YY+TARLWDDGIIDPA+TR++LGLSL  AL +  +
Sbjct  510  KEFSEEEAQKLKAPIVEMFEAEGSPYYSTARLWDDGIIDPANTRQILGLSLKAALNNAGQ  569

Query  536  DTKFGVFRM  544
            +TKFGVFRM
Sbjct  570  ETKFGVFRM  578


>Q7JV23_DROME unnamed protein product
Length=2323

 Score = 33.5 bits (75),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 59/155 (38%), Gaps = 27/155 (17%)

Query  321   DGSKFSEFKPLYGESLVTAFANIYGIKCGIVA--------------------------NN  354
             D   +SE    + +++VT  A + G+  G++A                            
Sbjct  1928  DRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAG  1987

Query  355   GVLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAK  414
              V + +S+ K +  I+   + ++PLI   N  GF  G       I K GA +V  +   K
Sbjct  1988  QVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYK  2047

Query  415   VPK-ITLIIGGSYGAGNYGMCGRPYSPRFLFTWPN  448
              P  I L        G + +     +PR++ T+ +
Sbjct  2048  KPVLIYLPPNAELRGGAWAVLDSLINPRYMETYAD  2082


>A1Z784_DROME unnamed protein product
Length=2482

 Score = 33.5 bits (75),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 59/155 (38%), Gaps = 27/155 (17%)

Query  321   DGSKFSEFKPLYGESLVTAFANIYGIKCGIVA--------------------------NN  354
             D   +SE    + +++VT  A + G+  G++A                            
Sbjct  2087  DRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAG  2146

Query  355   GVLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAK  414
              V + +S+ K +  I+   + ++PLI   N  GF  G       I K GA +V  +   K
Sbjct  2147  QVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYK  2206

Query  415   VPK-ITLIIGGSYGAGNYGMCGRPYSPRFLFTWPN  448
              P  I L        G + +     +PR++ T+ +
Sbjct  2207  KPVLIYLPPNAELRGGAWAVLDSLINPRYMETYAD  2241



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03070.1.1 Methyl-accepting

Length=91
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYB_DROME  unnamed protein product                                    25.0    6.6  
Q9VKB1_DROME  unnamed protein product                                 24.6    9.1  
Q9U722_DROME  unnamed protein product                                 24.6    9.5  


>MYB_DROME unnamed protein product
Length=657

 Score = 25.0 bits (53),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query  18   DTLLRDLGKKHYTYGAKAKYVDLIGPQFISAIQPSLESRWSPELN  62
            D LL+ L + H       +  ++IGP F   ++  ++ RW+  LN
Sbjct  93   DVLLKQLVETH------GENWEIIGPHFKDRLEQQVQQRWAKVLN  131


>Q9VKB1_DROME unnamed protein product
Length=585

 Score = 24.6 bits (52),  Expect = 9.1, Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)

Query  54   ESRWSPELNNAWIHLFG  70
            +SRW P ++ +W  LFG
Sbjct  315  KSRWIPSVSESWGWLFG  331


>Q9U722_DROME unnamed protein product
Length=444

 Score = 24.6 bits (52),  Expect = 9.5, Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)

Query  54   ESRWSPELNNAWIHLFG  70
            +SRW P ++ +W  LFG
Sbjct  205  KSRWIPSVSESWGWLFG  221



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03080.1.1 Cytochrome

Length=127
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  35.4    0.003
C15C1_BOMMO  unnamed protein product                                  32.0    0.064
CP18A_DROME  unnamed protein product                                  30.4    0.19 


>CP4G1_DROME unnamed protein product
Length=556

 Score = 35.4 bits (80),  Expect = 0.003, Method: Composition-based stats.
 Identities = 25/94 (27%), Positives = 42/94 (45%), Gaps = 6/94 (6%)

Query  29   WRRR-KLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIG  87
            WRR  + Y +   +P P  LPI+G          + +  +    + KYG     ++ W+G
Sbjct  44   WRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGET---MKAWLG  100

Query  88   PELAILVTDASVASQV--NALALTKAEFYQHLAP  119
              L + +T+ S    +      LTKAE Y++  P
Sbjct  101  NVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP  134


>C15C1_BOMMO unnamed protein product
Length=493

 Score = 32.0 bits (71),  Expect = 0.064, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 18/28 (64%), Gaps = 4/28 (14%)

Query  30  RRRKLYYISWCLPGPTALPIIGNLLYVL  57
           R R L Y     PGPT LPI+GNLL VL
Sbjct  19  RHRGLCYP----PGPTPLPIVGNLLSVL  42


>CP18A_DROME unnamed protein product
Length=538

 Score = 30.4 bits (67),  Expect = 0.19, Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 41/96 (43%), Gaps = 11/96 (11%)

Query  29   WRRRKLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIGP  88
            W  R    +    PGP  LP+IG LL++     S  +     L  +YG    L    +G 
Sbjct  42   WLVRNYRELRKLPPGPWGLPVIGYLLFM----GSEKHTRFMELAKQYG---SLFSTRLGS  94

Query  89   ELAILVTDASVASQVNALALTKAEFYQHLAPPYMKT  124
            +L ++++D  +  +       + EF      P+M+T
Sbjct  95   QLTVVMSDYKMIRE----CFRREEFTGRPDTPFMQT  126



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03090.1.1 GATA-binding

Length=344
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GATAC_DROME  unnamed protein product                                  39.7    0.001


>GATAC_DROME unnamed protein product
Length=486

 Score = 39.7 bits (91),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 57/137 (42%), Gaps = 21/137 (15%)

Query  126  QVCRPHFPHHSSLHPWLSNSSSDTKPLQHQNSSWCSPFNTGSTTEESSLKSSPNPQQNPS  185
            QVCRPHF  H+ L PWL++      P     S+W       +  +E  ++          
Sbjct  119  QVCRPHF--HTPLSPWLTSEHKSFAPA----SAW--SMGQFACPQEPQVEHKLGQMGQSH  170

Query  186  TSSSSTHPMFSYPPTPPKTHPTPPTPDSVTAASTNVTVTSSSASNEYTNAIAHAASMGVF  245
             ++++    F +PPTPPK      TPDSV         T  S      NA  H  + G  
Sbjct  171  QTTAAGQHSFPFPPTPPKD----STPDSVQ--------TGPSEYQAVMNAFMHQQATGST  218

Query  246  LHPDQS-SCDIKPMLNS  261
               D S + DIKP + +
Sbjct  219  SLTDASCALDIKPSIQN  235



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03100.1.1 RNA

Length=179
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED25_DROME  unnamed protein product                                  28.1    2.9  
STAN_DROME  unnamed protein product                                   26.6    7.9  


>MED25_DROME unnamed protein product
Length=863

 Score = 28.1 bits (61),  Expect = 2.9, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 22/46 (48%), Gaps = 5/46 (11%)

Query  6    SIPLSPACALVALALHYRYAHNPAEDHYEFGFKRGNEHHFTERHEK  51
            SIP SPAC L  L L Y     P  + +  GF   N+  F ER  K
Sbjct  624  SIPNSPACDLKVLILLY----TPDRNAF-LGFIPNNQAMFVERLRK  664


>STAN_DROME unnamed protein product
Length=3579

 Score = 26.6 bits (57),  Expect = 7.9, Method: Composition-based stats.
 Identities = 14/37 (38%), Positives = 18/37 (49%), Gaps = 2/37 (5%)

Query  68    KHGGYGEHYWDYNHGDHHGDEND--GAGDESQTISAL  102
             + G Y + Y  Y    H+G E D  G G  SQTI  +
Sbjct  3346  RRGEYPDKYGSYKPPSHYGSEKDYPGGGSGSQTIGHM  3382



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03110.1.1 SET

Length=240
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RZ8_DROME  unnamed protein product                                 59.7    2e-10
A1Z8L3_DROME  unnamed protein product                                 59.7    2e-10
Q9VTX2_DROME  unnamed protein product                                 49.3    5e-07


>Q95RZ8_DROME unnamed protein product
Length=567

 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/239 (26%), Positives = 95/239 (40%), Gaps = 33/239 (14%)

Query  8    GSLLFTEKPFVCVLHYNQRLKRCDHCFEEKKL-TNCRLCDKIAYCSSQC-EEKGWPMHKF  65
            G  L  E+PFV VL        C++CF    +   C  C  + YCS QC EE     HK+
Sbjct  169  GEELLVERPFVSVLLEKFAKTHCENCFMRTVVPVACPRCADVLYCSEQCREEASKKYHKY  228

Query  66   ECPNMKRISPKIVPESVGMMARIIYKLKYCKGLAVKGFYGEK----------ENEYRTFG  115
            EC  +  I       +  +  RII        L +K    E+          ++++R   
Sbjct  229  ECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKPTIDEELTPEQLISLPKDDFRRVA  288

Query  116  NLQSHYEELQQDRKRLEDFLS--LTHILEDFMGHTEVLPPPTELLTIYGKMLINSFNIMD  173
             L+ H  E Q         ++  LT+ L    G+    P P E ++I   +++ S   + 
Sbjct  289  QLERHQGERQPSNFFQHVLMARFLTNCLR-AGGYFGSEPKPDE-VSIICSLVLRSLQFIQ  346

Query  174  PNMNT-----------------IGSGLYLGASRFDHSCVPNAVATFSGTTISIRLIKPV  215
             N +                  IG  +Y   + F+HSC P  V  F GTTI I  ++P+
Sbjct  347  FNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPI  405


>A1Z8L3_DROME unnamed protein product
Length=660

 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/239 (26%), Positives = 95/239 (40%), Gaps = 33/239 (14%)

Query  8    GSLLFTEKPFVCVLHYNQRLKRCDHCFEEKKL-TNCRLCDKIAYCSSQC-EEKGWPMHKF  65
            G  L  E+PFV VL        C++CF    +   C  C  + YCS QC EE     HK+
Sbjct  262  GEELLVERPFVSVLLEKFAKTHCENCFMRTVVPVACPRCADVLYCSEQCREEASKKYHKY  321

Query  66   ECPNMKRISPKIVPESVGMMARIIYKLKYCKGLAVKGFYGEK----------ENEYRTFG  115
            EC  +  I       +  +  RII        L +K    E+          ++++R   
Sbjct  322  ECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKPTIDEELTPEQLISLPKDDFRRVA  381

Query  116  NLQSHYEELQQDRKRLEDFLS--LTHILEDFMGHTEVLPPPTELLTIYGKMLINSFNIMD  173
             L+ H  E Q         ++  LT+ L    G+    P P E ++I   +++ S   + 
Sbjct  382  QLERHQGERQPSNFFQHVLMARFLTNCLR-AGGYFGSEPKPDE-VSIICSLVLRSLQFIQ  439

Query  174  PNMNT-----------------IGSGLYLGASRFDHSCVPNAVATFSGTTISIRLIKPV  215
             N +                  IG  +Y   + F+HSC P  V  F GTTI I  ++P+
Sbjct  440  FNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPI  498


>Q9VTX2_DROME unnamed protein product
Length=663

 Score = 49.3 bits (116),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 61/236 (26%), Positives = 91/236 (39%), Gaps = 40/236 (17%)

Query  8    GSLLFTEKPFVCVLHYNQRLKRCDHCFEEKKL---TNCRLCDKIAYCSSQC-EEKGWPMH  63
            G +L  E+P    L  +     C HCF  K+L    +C  C  IA+CS+QC  E     H
Sbjct  277  GDVLLFEEPVAACLEPSYFGTHCHHCF--KRLHTPVSCLHCSGIAFCSAQCMGEACSSYH  334

Query  64   KFECPNMKRISPKIVPESVGMMARIIYKLKYC-KGLAVKGFYGEKENEYRTFGNLQSHYE  122
            +FEC  M  +    +     +  RI  +     +GLA              F +L SH E
Sbjct  335  RFECEYMDLMIGSGMSILCFIALRIFTQAPSLEQGLATANLL---------FEHLCSHEE  385

Query  123  ELQQDRKRLEDFLS--LTHILED--FMGH--TEVLPP-------PTELLTIYGKMLINSF  169
            + Q D       +S  L  IL+   + G   TE + P        T LL +   +  N+ 
Sbjct  386  DRQPDDYLRRALMSGFLLRILQKSLYFGRRKTEGVNPTAVELQVATALLGLLQVLQYNAH  445

Query  170  NIMDPNMNT-----------IGSGLYLGASRFDHSCVPNAVATFSGTTISIRLIKP  214
             I    +             + +GLY   S F+H C P+    F G  + +   +P
Sbjct  446  QIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHFVGKKLVLTATRP  501



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03120.1.1 SET

Length=107
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T443_DROME  unnamed protein product                                 25.8    5.3  
Q95SQ0_DROME  unnamed protein product                                 23.5    10.0 


>Q8T443_DROME unnamed protein product
Length=470

 Score = 25.8 bits (55),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 15/72 (21%), Positives = 34/72 (47%), Gaps = 5/72 (7%)

Query  18   GLKEKKLVETYGIRPNL----DVCQISLRKQEGLFHEYNIYKLQILDCAFSSAIDLAHWR  73
            G ++K+++E+Y I P +    D   + +  ++  +H    Y   ++    S    + HW+
Sbjct  185  GRRDKRILESYNI-PEIVKHSDFIHLMMHDEQDPYHLRLAYNAPLVGYEGSVTDSIMHWK  243

Query  74   EAKEYGERLLVG  85
                  E+L++G
Sbjct  244  RNGGAPEKLILG  255


>Q95SQ0_DROME unnamed protein product
Length=56

 Score = 23.5 bits (49),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 2/41 (5%)

Query  32  PNLDVCQISLRKQEGL--FHEYNIYKLQILDCAFSSAIDLA  70
           PN      +L+K++ L  F +  + K Q   C F+ A D++
Sbjct  2   PNPKTNTATLKKKKNLIQFQKPAVAKQQQPKCLFAKAADIS  42



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03130.1.1 Histone-lysine

Length=188
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8L3_DROME  unnamed protein product                                 50.1    1e-07
Q95RZ8_DROME  unnamed protein product                                 49.7    2e-07
Q9VTX2_DROME  unnamed protein product                                 42.0    7e-05


>A1Z8L3_DROME unnamed protein product
Length=660

 Score = 50.1 bits (118),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 38/78 (49%), Gaps = 0/78 (0%)

Query  8    IGSGLYLGASRFDHSCVPNAVATFSGTTISIRLIKPVSPFDWSKVFVSYIDVLQPTSKRI  67
            IG  +Y   + F+HSC P  V  F GTTI I  ++P+            +      S+R 
Sbjct  462  IGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPIEAGLPINENYGPMYTQDERSERQ  521

Query  68   SELKKGYFFECQCVFCLD  85
            + LK  Y+FEC C  C+D
Sbjct  522  ARLKDLYWFECSCDACID  539


>Q95RZ8_DROME unnamed protein product
Length=567

 Score = 49.7 bits (117),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 38/78 (49%), Gaps = 0/78 (0%)

Query  8    IGSGLYLGASRFDHSCVPNAVATFSGTTISIRLIKPVSPFDWSKVFVSYIDVLQPTSKRI  67
            IG  +Y   + F+HSC P  V  F GTTI I  ++P+            +      S+R 
Sbjct  369  IGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPIEAGLPINENYGPMYTQDERSERQ  428

Query  68   SELKKGYFFECQCVFCLD  85
            + LK  Y+FEC C  C+D
Sbjct  429  ARLKDLYWFECSCDACID  446


>Q9VTX2_DROME unnamed protein product
Length=663

 Score = 42.0 bits (97),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 47/113 (42%), Gaps = 4/113 (4%)

Query  8    IGSGLYLGASRFDHSCVPNAVATFSGTTISIRLIKPVSPFDWSKVFVSYIDVLQPTSKRI  67
            + +GLY   S F+H C P+    F G  + +   +P    +   V    I +     +R 
Sbjct  466  LAAGLYGTGSYFNHECWPSTACHFVGKKLVLTATRPHRANELVAVNYGPIFIKNNLKERQ  525

Query  68   SELKKGYFFECQCVFCLDR----EQQEHMLSMSCPNQKCSEPIYISEEYSSDV  116
              L+  Y F C C+ C +     ++ +  +   C +  CS  +   ++ + DV
Sbjct  526  RSLRGRYSFSCSCMACQENWPLLQKLDKQVRFWCTSANCSNLLKFPKDLAKDV  578



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03140.1.1 Protein

Length=271
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPAC2_DROME  unnamed protein product                                  84.3    4e-20
Q8ING6_DROME  unnamed protein product                                 82.0    3e-19
HSP27_DROME  unnamed protein product                                  28.9    2.2  


>PPAC2_DROME unnamed protein product
Length=164

 Score = 84.3 bits (207),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 73/132 (55%), Gaps = 7/132 (5%)

Query  54   KKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCE  113
            K SVL +C  N  RSP+ +++ ++++A A    EW VESAGI  W  G   D RA     
Sbjct  7    KSSVLMVCVGNLCRSPIAEAVMRDLVARAGLQGEWHVESAGIEDWHSGHQPDERALNVLA  66

Query  114  MYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQ  173
             + ++     R +  +DF +FDYI A D ++L+ LR  AP  ++A+L+ LG F  K    
Sbjct  67   RHNIEYNGKARVLAPEDFLEFDYIFAMDLSNLAALRRMAPKGTTAKLLILGNFGLK----  122

Query  174  GPSD--LPDPFF  183
             P +  + DP++
Sbjct  123  -PDERIIEDPYY  133


>Q8ING6_DROME unnamed protein product
Length=164

 Score = 82.0 bits (201),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 75/139 (54%), Gaps = 7/139 (5%)

Query  57   VLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYG  116
            VLF+C  N  RSPM +++ K ++   N   +W V+SAG+  W+VG     R ++  + +G
Sbjct  3    VLFVCIGNTCRSPMAEAILKHLVVKRN-LQDWYVDSAGLRSWNVGLEPQARGQQLLKQHG  61

Query  117  LDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAP---PDSSAQLVKLGTFTRKAKFQ  173
            L T H+ R I+  DFY FDYI A D ++L  L   A    P  + ++  LG++  + +  
Sbjct  62   LKTNHLGRMISAQDFYDFDYIFAMDNSNLLELEHMAASLTPSPTCKIQLLGSYIGRKE--  119

Query  174  GPSDLPDPFFLKTKELINA  192
                + DP+F++     NA
Sbjct  120  -DEIIEDPYFIQGMGGFNA  137


>HSP27_DROME unnamed protein product
Length=213

 Score = 28.9 bits (63),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 30/56 (54%), Gaps = 1/56 (2%)

Query  107  RAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVK  162
            + +ER + +G+   H VR+ T    +  + +++T  +D   L L+APP  S +  K
Sbjct  118  KHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSD-GVLTLKAPPPPSKEQAK  172



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03150.1.1 Protein

Length=202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPAC2_DROME  unnamed protein product                                  65.9    7e-14
Q8ING6_DROME  unnamed protein product                                 65.5    1e-13
HSP27_DROME  unnamed protein product                                  28.1    2.2  


>PPAC2_DROME unnamed protein product
Length=164

 Score = 65.9 bits (159),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 7/114 (6%)

Query  3    KSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDF  62
            +++ ++++A A    EW VESAGI  W  G   D RA      + ++     R +  +DF
Sbjct  25   EAVMRDLVARAGLQGEWHVESAGIEDWHSGHQPDERALNVLARHNIEYNGKARVLAPEDF  84

Query  63   YKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQGPSD--LPDPFF  114
             +FDYI A D ++L+ LR  AP  ++A+L+ LG F  K     P +  + DP++
Sbjct  85   LEFDYIFAMDLSNLAALRRMAPKGTTAKLLILGNFGLK-----PDERIIEDPYY  133


>Q8ING6_DROME unnamed protein product
Length=164

 Score = 65.5 bits (158),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 7/126 (6%)

Query  1    MIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKD  60
            M +++ K ++   N   +W V+SAG+  W+VG     R ++  + +GL T H+ R I+  
Sbjct  16   MAEAILKHLVVKRN-LQDWYVDSAGLRSWNVGLEPQARGQQLLKQHGLKTNHLGRMISAQ  74

Query  61   DFYKFDYIIATDETDLSFLRLEAP---PDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKT  117
            DFY FDYI A D ++L  L   A    P  + ++  LG++  + +      + DP+F++ 
Sbjct  75   DFYDFDYIFAMDNSNLLELEHMAASLTPSPTCKIQLLGSYIGRKE---DEIIEDPYFIQG  131

Query  118  KELINA  123
                NA
Sbjct  132  MGGFNA  137


>HSP27_DROME unnamed protein product
Length=213

 Score = 28.1 bits (61),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 30/56 (54%), Gaps = 1/56 (2%)

Query  38   RAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVK  93
            + +ER + +G+   H VR+ T    +  + +++T  +D   L L+APP  S +  K
Sbjct  118  KHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSD-GVLTLKAPPPPSKEQAK  172



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03160.1.1 XK-related

Length=238
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLS8_DROME  unnamed protein product                                 27.7    5.4  


>Q9VLS8_DROME unnamed protein product
Length=585

 Score = 27.7 bits (60),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query  53   QKQLAELKVIEEEIKQGKHQRPGGTPTPLEPPPPP--------PPRGKQPPQSNTCEILL  104
            +KQ  E KVI+E IK+ K +     P   +PP PP        P     P +    E L 
Sbjct  260  EKQEPESKVIQE-IKEAKKEAAVPLPKSAKPPVPPVKTTKSKVPSAPVDPSKGVATETLY  318

Query  105  APYYLDNEQDEQQ  117
             P ++D E D ++
Sbjct  319  EPGHVDEEIDAER  331



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03170.1.1 Sulfiredoxin

Length=116
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3M5_DROME  unnamed protein product                                 27.7    1.5  
APLP_DROME  unnamed protein product                                   27.7    1.6  
TENA_DROME  unnamed protein product                                   26.2    5.5  


>Q7K3M5_DROME unnamed protein product
Length=729

 Score = 27.7 bits (60),  Expect = 1.5, Method: Composition-based stats.
 Identities = 22/65 (34%), Positives = 27/65 (42%), Gaps = 2/65 (3%)

Query  27   MRVINRPFPPELDEAKVERFMRDYEEGDTFTPIEIWRARNAQGQSFYFSFGGCHRYEAAK  86
            M+V  R  P E+         RDY E    T I+I      +G    F  G     EA K
Sbjct  243  MKVPGRTHPVEIFYTPEPE--RDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACK  300

Query  87   RLKRE  91
            R+KRE
Sbjct  301  RIKRE  305


>APLP_DROME unnamed protein product
Length=3351

 Score = 27.7 bits (60),  Expect = 1.6, Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 6/34 (18%)

Query  7    ATNTSVFQASERSDNVHDV------PMRVINRPF  34
             TN +VF+AS R +NV DV      P  ++N+ F
Sbjct  651  GTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDF  684


>TENA_DROME unnamed protein product
Length=3004

 Score = 26.2 bits (56),  Expect = 5.5, Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 25/67 (37%), Gaps = 6/67 (9%)

Query  13    FQASERSDNVHDVPMRVINRPFPPELDEAKV------ERFMRDYEEGDTFTPIEIWRARN  66
             +Q+S+ S  +  V MR+     PP L    V         ++ YE   +      W  RN
Sbjct  1081  YQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEADPSLVHTFAWNKRN  1140

Query  67    AQGQSFY  73
                Q  Y
Sbjct  1141  VYRQKVY  1147



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03180.1.1 AP-2

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O62530_DROME  unnamed protein product                                 310     5e-104
O62531_DROME  unnamed protein product                                 250     4e-81 
O76928_DROME  unnamed protein product                                 100     3e-24 


>O62530_DROME unnamed protein product
Length=437

 Score = 310 bits (793),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/287 (52%), Positives = 203/287 (71%), Gaps = 9/287 (3%)

Query  2    YITTEGVKSEQAIREDSSKITSQATGATSWRRADVKYRKNEAFVDVVENVNLMMSAQGNI  61
            +IT +G+KS  A +E+  +ITSQ TG   WRR  +KYR+NE F+DV+E VNL+MS QG +
Sbjct  132  FITQQGIKS--ATKEEQMQITSQVTGQIGWRREGIKYRRNELFLDVLEYVNLLMSPQGQV  189

Query  62   LRADVDGQILMRAYLSGMPECKFGLNDKLVLERSDRTRIVDDSALGG-----AVELDDCQ  116
            L A V G+++M++YLSGMPECKFG+NDK+V+E   R    +  A         V +DDCQ
Sbjct  190  LSAHVAGKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGNSEAETSRSGKPVVVIDDCQ  249

Query  117  FHQCVRLGKFDTDRTISFIPPDGEFELMRYRSTHNVNLPFKISAVVNEIGRSRVEYTIRI  176
            FHQCV+L KF+T+ +ISFIPPDGEFELMRYR+T +++LPF++  +V E+GR+++E  + +
Sbjct  250  FHQCVKLSKFETEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRTKMEVKVVL  309

Query  177  KANFGNKLSANTVILRIPTPLNTTEVKCNAPMGKAKYVPDENHIVWKIPRMQGQTETTLT  236
            K+NF   L    + ++IPTPLNT+ V+     GKAKY   EN IVWKI RM G  ET L+
Sbjct  310  KSNFKPSLLGQKIEVKIPTPLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLS  369

Query  237  ANAELTSTTTRQAWSRPPINVDFQVLMYTSSGLSVRFLKVFE-KSNY  282
            A  EL  T T++ W+RPPI+++F+V  +  SG  VR+LKVFE K NY
Sbjct  370  AEIELLETDTKKKWTRPPISMNFEV-PFAPSGFKVRYLKVFEPKLNY  415


>O62531_DROME unnamed protein product
Length=426

 Score = 250 bits (639),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 172/283 (61%), Gaps = 13/283 (5%)

Query  2    YITTEGVKSEQAIREDSSKITSQATGATSWRRADVKYRKNEAFVDVVENVNLMMSAQGNI  61
            YIT EG K E   R     I    T A SWR   +KYRKNE F+DV+E+VNL+ +A GN+
Sbjct  137  YITQEGHKLELQPR-----IPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANANGNV  191

Query  62   LRADVDGQILMRAYLSGMPECKFGLNDKLVLERSDRTRIVDDSALGGAVELDDCQFHQCV  121
            LR+++ G I MR YLSGMPE + GLNDK++ E + R +         +VEL+D +FHQCV
Sbjct  192  LRSEIVGAIKMRVYLSGMPELRLGLNDKVLFESTGRGK-------SKSVELEDVKFHQCV  244

Query  122  RLGKFDTDRTISFIPPDGEFELMRYRSTHNVNLPFKISAVVNEIGRSRVEYTIRIKANFG  181
            RL +F+ DRTISFIPPDGEFELM YR   +V     I +V+     SRVEY I+ K+ F 
Sbjct  245  RLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFK  304

Query  182  NKLSANTVILRIPTPLNTTEVKCNAPMGKAKYVPDENHIVWKIPRMQGQTETTLTANAEL  241
             + +AN V + IP P +    K    +G  KY P++N I+W I    G  E  + A+  L
Sbjct  305  RRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGL  364

Query  242  TSTTTR-QAWSRPPINVDFQVLMYTSSGLSVRFLKVFEKSNYQ  283
             S  +      +PPI V F++  +T+SG+ VR+LK+ EKS YQ
Sbjct  365  PSVESEDNTEGKPPIQVRFEIPYFTTSGIQVRYLKIIEKSGYQ  407


>O76928_DROME unnamed protein product
Length=415

 Score = 100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/269 (29%), Positives = 119/269 (44%), Gaps = 37/269 (14%)

Query  18   SSKITSQATGATSWRRADVKYRKNEAFVDVVENVNLMMSAQGNILRADVDGQILMRAYLS  77
            S+ + S    A  WRR+ V+Y  NEA+ DV+E V+ ++   G+ + A++ G I     LS
Sbjct  152  STTLPSGQLSAVRWRRSGVRYTNNEAYFDVIEEVDAIIDKSGSTVFAEIQGHIDCCIKLS  211

Query  78   GMPECKFG-LNDKLVLERSDRTRIVDDSALGGAVELDDCQFHQCVRLGKFDTDRTISFIP  136
            GMP+     +N +L                      DD  FH CVR  +++ +R +SFIP
Sbjct  212  GMPDLTLSFMNPRL---------------------FDDVSFHPCVRYKRWEAERLLSFIP  250

Query  137  PDGEFELMRYR--STHNVNLPFKI----SAVVNEIGRSRVEYTIRIKANFGNKLSANTVI  190
            PDG F LM Y   S   V +P  I    S    E G  R++ TI  +   G  +    + 
Sbjct  251  PDGNFRLMSYHISSQSVVAIPIYIRHNFSIKTGEQG--RLDLTIGPRNTLGRTVDKVKLE  308

Query  191  LRIPTPLNTTEVKCNAPMGKAKYVPDE--NHIVWKIPRMQGQTETTLTANAELTSTTTRQ  248
            L +P  +    + C     + KY  D     + W + R+       +  +  +T  TT  
Sbjct  309  LTMPRCV----LNCLLTPNQGKYTFDSVTKTLSWDVGRIDVSKLPNIRGSVSITPGTTNI  364

Query  249  AWSRPPINVDFQVLMYTSSGLSVRFLKVF  277
              + P +NV FQ+     SGL V  L ++
Sbjct  365  D-ANPSVNVQFQISQLAVSGLKVNRLDMY  392



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03190.1.1 DNA

Length=171
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6TY75_DROME  unnamed protein product                                 137     3e-38
Q6TY68_DROME  unnamed protein product                                 137     3e-38
Q6TY79_DROME  unnamed protein product                                 137     3e-38


>Q6TY75_DROME unnamed protein product
Length=685

 Score = 137 bits (345),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 99/153 (65%), Gaps = 17/153 (11%)

Query  16   YIGLGLSSRKNLCLHPSISQERRGKAVDARCRDLTSAHAVQKGRSDPGSHELCSYHEGLS  75
            + GL LSSRKN+C+HP +S+ER GKAVD +C  LT+++  ++   D  +  +C Y EG S
Sbjct  20   FTGLVLSSRKNMCIHPEVSKEREGKAVDGKCYGLTASYIRERHEMDTET-PICQYFEGFS  78

Query  76   EVAPGEIVPPGIWTIEDVKKFGQQKGYCPYFSVRRMVGVVFLTIILVETIPKVPFCNTII  135
                   +P G+++I+D+K++G+ + +CPYF  R  +                   + ++
Sbjct  79   LEGKESTLPVGVYSIDDLKEYGRSRNWCPYFLARYAIA----------------HAHIVV  122

Query  136  YSFHYLLDPKVAEMVSREMSKDAIVVFDEAHNI  168
            YS+HYLLDPK+A++VS+EMS+++ VVFDEAHNI
Sbjct  123  YSYHYLLDPKIAQVVSKEMSRESCVVFDEAHNI  155


>Q6TY68_DROME unnamed protein product
Length=685

 Score = 137 bits (345),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 99/153 (65%), Gaps = 17/153 (11%)

Query  16   YIGLGLSSRKNLCLHPSISQERRGKAVDARCRDLTSAHAVQKGRSDPGSHELCSYHEGLS  75
            + GL LSSRKN+C+HP +S+ER GKAVD +C  LT+++  ++   D  +  +C Y EG S
Sbjct  20   FTGLVLSSRKNMCIHPEVSKEREGKAVDGKCYGLTASYIRERHEMDTET-PICQYFEGFS  78

Query  76   EVAPGEIVPPGIWTIEDVKKFGQQKGYCPYFSVRRMVGVVFLTIILVETIPKVPFCNTII  135
                   +P G+++I+D+K++G+ + +CPYF  R  +                   + ++
Sbjct  79   LEGKESTLPVGVYSIDDLKEYGRSRNWCPYFLARYAIA----------------HAHIVV  122

Query  136  YSFHYLLDPKVAEMVSREMSKDAIVVFDEAHNI  168
            YS+HYLLDPK+A++VS+EMS+++ VVFDEAHNI
Sbjct  123  YSYHYLLDPKIAQVVSKEMSRESCVVFDEAHNI  155


>Q6TY79_DROME unnamed protein product
Length=685

 Score = 137 bits (345),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 99/153 (65%), Gaps = 17/153 (11%)

Query  16   YIGLGLSSRKNLCLHPSISQERRGKAVDARCRDLTSAHAVQKGRSDPGSHELCSYHEGLS  75
            + GL LSSRKN+C+HP +S+ER GKAVD +C  LT+++  ++   D  +  +C Y EG S
Sbjct  20   FTGLVLSSRKNMCIHPEVSKEREGKAVDGKCYGLTASYIRERHEMDTET-PICQYFEGFS  78

Query  76   EVAPGEIVPPGIWTIEDVKKFGQQKGYCPYFSVRRMVGVVFLTIILVETIPKVPFCNTII  135
                   +P G+++I+D+K++G+ + +CPYF  R  +                   + ++
Sbjct  79   LEGKESTLPVGVYSIDDLKEYGRSRNWCPYFLARYAIA----------------HAHIVV  122

Query  136  YSFHYLLDPKVAEMVSREMSKDAIVVFDEAHNI  168
            YS+HYLLDPK+A++VS+EMS+++ VVFDEAHNI
Sbjct  123  YSYHYLLDPKIAQVVSKEMSRESCVVFDEAHNI  155



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03200.1.1 DNA

Length=405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6TY75_DROME  unnamed protein product                                 404     6e-136
Q6TY79_DROME  unnamed protein product                                 404     6e-136
Q6TY68_DROME  unnamed protein product                                 404     6e-136


>Q6TY75_DROME unnamed protein product
Length=685

 Score = 404 bits (1038),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 246/296 (83%), Gaps = 3/296 (1%)

Query  63   LSNPDMYPKMLNFNAIVQESYPMTLSRNCFIPMVITRGSDQVAVSSRFEVRNDPAVVRNY  122
            LS  DMYPK+L+F+ +V  S+ MTL+R C +PM++++G+DQV +SS+FE R D AV+RNY
Sbjct  377  LSPMDMYPKILDFDPVVMSSFTMTLARPCLLPMIVSKGNDQVTISSKFETREDTAVIRNY  436

Query  123  GQMLIEYSKVIPDGIVAFFPSYLYMESIVSAWNEMQILDEVWKHKLIFVETPDAPETSIA  182
            GQ+L+E +K +PDGIV FF SYLY+ES+V++W +  I+D + ++KL+F+ET D  ETS A
Sbjct  437  GQLLVEVAKTVPDGIVCFFTSYLYLESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYA  496

Query  183  LENFRKACDNGRGAVMLSVARGKVSEGIDFDHHFGRAVIMFGVPYQYTESRILKARLEYL  242
            L N+ KACD GRGAV+L+VARGKVSEG+DFDHH+GRAV+MFG+PY YT+SRILKARL+YL
Sbjct  497  LMNYVKACDCGRGAVLLAVARGKVSEGVDFDHHYGRAVLMFGIPYVYTQSRILKARLDYL  556

Query  243  RDNHRIRESDFLTFDAMRHAAQCVGRVLRGKSDYGLMIFADKRFARSDKRAKLPRWINQY  302
            RD  +IRE+DFLTFDAMRHAAQCVGR LRGK+DYG+MIFADKRF+R DKR++LP+WI ++
Sbjct  557  RDQFQIRENDFLTFDAMRHAAQCVGRALRGKTDYGIMIFADKRFSRHDKRSRLPKWIQEH  616

Query  303  ISETSSNLSTDMAISLAKRFVRTMAQPFDHS-QTGVSLWTMDHV--LERQRLDKES  355
            + ++  NLST+ A+ LA+R++R MAQPF    Q G+SL T+  +  +E+++L++++
Sbjct  617  LVDSFCNLSTEEAVQLARRWLRRMAQPFTREDQLGISLLTLAQLENMEQEKLERQA  672


 Score = 36.2 bits (82),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 38/65 (58%), Gaps = 12/65 (18%)

Query  2    LESASRSVDKLSEKIAEVKENDAQRLQDEYAKLVEGMQDADQPPPAANDEMAMIRRQDED  61
            +E ++ +++ L++ + +++E D  RL + Y ++V+G++DA             ++R  + 
Sbjct  172  VERSTNALNHLTKLVQDIREEDTNRLNEXYQRMVQGLKDAS------------VQRXTDM  219

Query  62   VLSNP  66
            +L+NP
Sbjct  220  ILANP  224


>Q6TY79_DROME unnamed protein product
Length=685

 Score = 404 bits (1038),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 246/296 (83%), Gaps = 3/296 (1%)

Query  63   LSNPDMYPKMLNFNAIVQESYPMTLSRNCFIPMVITRGSDQVAVSSRFEVRNDPAVVRNY  122
            LS  DMYPK+L+F+ +V  S+ MTL+R C +PM++++G+DQV +SS+FE R D AV+RNY
Sbjct  377  LSPMDMYPKILDFDPVVMSSFTMTLARPCLLPMIVSKGNDQVTISSKFETREDTAVIRNY  436

Query  123  GQMLIEYSKVIPDGIVAFFPSYLYMESIVSAWNEMQILDEVWKHKLIFVETPDAPETSIA  182
            GQ+L+E +K +PDGIV FF SYLY+ES+V++W +  I+D + ++KL+F+ET D  ETS A
Sbjct  437  GQLLVEVAKTVPDGIVCFFTSYLYLESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYA  496

Query  183  LENFRKACDNGRGAVMLSVARGKVSEGIDFDHHFGRAVIMFGVPYQYTESRILKARLEYL  242
            L N+ KACD GRGAV+L+VARGKVSEG+DFDHH+GRAV+MFG+PY YT+SRILKARL+YL
Sbjct  497  LMNYVKACDCGRGAVLLAVARGKVSEGVDFDHHYGRAVLMFGIPYVYTQSRILKARLDYL  556

Query  243  RDNHRIRESDFLTFDAMRHAAQCVGRVLRGKSDYGLMIFADKRFARSDKRAKLPRWINQY  302
            RD  +IRE+DFLTFDAMRHAAQCVGR LRGK+DYG+MIFADKRF+R DKR++LP+WI ++
Sbjct  557  RDQFQIRENDFLTFDAMRHAAQCVGRALRGKTDYGIMIFADKRFSRHDKRSRLPKWIQEH  616

Query  303  ISETSSNLSTDMAISLAKRFVRTMAQPFDHS-QTGVSLWTMDHV--LERQRLDKES  355
            + ++  NLST+ A+ LA+R++R MAQPF    Q G+SL T+  +  +E+++L++++
Sbjct  617  LVDSFCNLSTEEAVQLARRWLRRMAQPFTREDQLGISLLTLAQLENMEQEKLERQA  672


 Score = 38.1 bits (87),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 39/65 (60%), Gaps = 12/65 (18%)

Query  2    LESASRSVDKLSEKIAEVKENDAQRLQDEYAKLVEGMQDADQPPPAANDEMAMIRRQDED  61
            +E ++ +++ L++ + +++E D  RL +EY ++V+G++DA             ++R  + 
Sbjct  172  VERSTNALNHLTKLVQDIREEDTNRLNEEYQRMVQGLKDAS------------VQRDTDM  219

Query  62   VLSNP  66
            +L+NP
Sbjct  220  ILANP  224


>Q6TY68_DROME unnamed protein product
Length=685

 Score = 404 bits (1038),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 246/296 (83%), Gaps = 3/296 (1%)

Query  63   LSNPDMYPKMLNFNAIVQESYPMTLSRNCFIPMVITRGSDQVAVSSRFEVRNDPAVVRNY  122
            LS  DMYPK+L+F+ +V  S+ MTL+R C +PM++++G+DQV +SS+FE R D AV+RNY
Sbjct  377  LSPMDMYPKILDFDPVVMSSFTMTLARPCLLPMIVSKGNDQVTISSKFETREDTAVIRNY  436

Query  123  GQMLIEYSKVIPDGIVAFFPSYLYMESIVSAWNEMQILDEVWKHKLIFVETPDAPETSIA  182
            GQ+L+E +K +PDGIV FF SYLY+ES+V++W +  I+D + ++KL+F+ET D  ETS A
Sbjct  437  GQLLVEVAKTVPDGIVCFFTSYLYLESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYA  496

Query  183  LENFRKACDNGRGAVMLSVARGKVSEGIDFDHHFGRAVIMFGVPYQYTESRILKARLEYL  242
            L N+ KACD GRGAV+L+VARGKVSEG+DFDHH+GRAV+MFG+PY YT+SRILKARL+YL
Sbjct  497  LMNYVKACDCGRGAVLLAVARGKVSEGVDFDHHYGRAVLMFGIPYVYTQSRILKARLDYL  556

Query  243  RDNHRIRESDFLTFDAMRHAAQCVGRVLRGKSDYGLMIFADKRFARSDKRAKLPRWINQY  302
            RD  +IRE+DFLTFDAMRHAAQCVGR LRGK+DYG+MIFADKRF+R DKR++LP+WI ++
Sbjct  557  RDQFQIRENDFLTFDAMRHAAQCVGRALRGKTDYGIMIFADKRFSRHDKRSRLPKWIQEH  616

Query  303  ISETSSNLSTDMAISLAKRFVRTMAQPFDHS-QTGVSLWTMDHV--LERQRLDKES  355
            + ++  NLST+ A+ LA+R++R MAQPF    Q G+SL T+  +  +E+++L++++
Sbjct  617  LVDSFCNLSTEEAVQLARRWLRRMAQPFTREDQLGISLLTLAQLENMEQEKLERQA  672


 Score = 38.1 bits (87),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 39/65 (60%), Gaps = 12/65 (18%)

Query  2    LESASRSVDKLSEKIAEVKENDAQRLQDEYAKLVEGMQDADQPPPAANDEMAMIRRQDED  61
            +E ++ +++ L++ + +++E D  RL +EY ++V+G++DA             ++R  + 
Sbjct  172  VERSTNALNHLTKLVQDIREEDTNRLNEEYQRMVQGLKDAS------------VQRDTDM  219

Query  62   VLSNP  66
            +L+NP
Sbjct  220  ILANP  224



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03210.1.1 Glycerol-3-phosphate

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPDA_DROME  unnamed protein product                                   80.1    1e-16
X2JDJ3_DROME  unnamed protein product                                 29.6    3.1  
Q9VLS7_DROME  unnamed protein product                                 29.6    3.3  


>GPDA_DROME unnamed protein product
Length=363

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 91/353 (26%), Positives = 147/353 (42%), Gaps = 33/353 (9%)

Query  40   VLVLGSGSFGSCLAD-------HLADIGHQTRIWARN-----KDVVDSFNNNHKNPKYLT  87
            V ++GSG++GS +A         L +   +  ++        K + +  N  H+N KYL 
Sbjct  7    VCIVGSGNWGSAIAKIVGANAAALPEFEERVTMFVYEELIDGKKLTEIINETHENVKYLK  66

Query  88   DHTFSKNLKAVGPEFPSFEDLLLYNVIVMAIPSQSMSSVLKNLVPLFEAKKDKAPLLVFA  147
             H    N+ AV P+    E     ++++  +P Q + +  K L+   +       L+   
Sbjct  67   GHKLPPNVVAV-PDL--VEAAKNADILIFVVPHQFIPNFCKQLLGKIKPNAIAISLIKGF  123

Query  148  NKGIESGSCFLPIEIIERECGKEIARVSTFLSGPSFAKEIVQRMPTQVTIASFSSQHAEQ  207
            +K  E G   L   II R     +      L G + A E+ +    + TI     ++ + 
Sbjct  124  DKA-EGGGIDLISHIITRH----LKIPCAVLMGANLANEVAEGNFCETTIGCTDKKYGKV  178

Query  208  ACEVFHQGHFLTFSSTDPVGVELAGALKNVYAIASGVASGLGFQQNTRAGLVTRASAEMQ  267
              ++F   HF      D   VE+ GALKN+ A  +G   GL    NT+A ++     EM 
Sbjct  179  LRDLFQANHFRVVVVDDADAVEVCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMI  238

Query  268  KIGAAF--NADPLTFLSLAGVGDLFLTCSSENSRN-----FTVGKRLGEGEKLQHILDTL  320
            +    F   +   TF    GV DL  TC    +R       T GK + E EK   +L+  
Sbjct  239  RFVDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEK--EMLN--  294

Query  321  GSTAEGVFTAEAVHELLKR--LEMSAPIAEAVYDLLYQGASAADMADRLMGLP  371
            G   +G  TAE V+ +LK   LE   P+  A++ +        D+ D +   P
Sbjct  295  GQKLQGPPTAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPNDLIDCIRNHP  347


>X2JDJ3_DROME unnamed protein product
Length=2015

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 4/45 (9%)

Query  393  AVGVLSPAQSPSITPSV-TPGGSPPHSPKP-QNTGIN--ALPEDK  433
            AVG    + +PS+TPSV TPG  PP +P+P Q+  +N  ALP + 
Sbjct  427  AVGAFFTSAAPSVTPSVFTPGTVPPLAPQPFQSATVNQSALPPNN  471


>Q9VLS7_DROME unnamed protein product
Length=2016

 Score = 29.6 bits (65),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 4/45 (9%)

Query  393  AVGVLSPAQSPSITPSV-TPGGSPPHSPKP-QNTGIN--ALPEDK  433
            AVG    + +PS+TPSV TPG  PP +P+P Q+  +N  ALP + 
Sbjct  427  AVGAFFTSAAPSVTPSVFTPGTVPPLAPQPFQSATVNQSALPPNN  471



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03220.1.1 Indoleamine

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXV3_DROME  unnamed protein product                                 29.3    5.0  
LONM_DROME  unnamed protein product                                   29.3    5.1  
RG190_DROME  unnamed protein product                                  28.9    6.8  


>Q9VXV3_DROME unnamed protein product
Length=2030

 Score = 29.3 bits (64),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (45%), Gaps = 18/87 (21%)

Query  247  NQINILTRILIDVRKECRPEVFYGKIRRWFNGPNGQSSWHYEGVDPPGVYRDYGGPSAGQ  306
            N   +LTR +  +R+   P  F   + RW++  N           PPG  R+Y   S  Q
Sbjct  664  NDTRLLTRCVATLRQVLSPTQFLDFVIRWYSDRN-----------PPG-SRNY---SIEQ  708

Query  307  SSLIH--SLDAFLGVNHAP-VDDDANY  330
              L+   +L A +G+  AP VD   NY
Sbjct  709  EWLLFRSTLLALMGLTAAPDVDAGENY  735


>LONM_DROME unnamed protein product
Length=1024

 Score = 29.3 bits (64),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (47%), Gaps = 6/79 (8%)

Query  338  MQFYMPEYHRNFLDHLLNVEPSCRDVV---KASENDELKESYNKAIESMKV---FRSEHI  391
            ++   PE + NFLDH L+V      V+    A+  D + E     +E +++      E I
Sbjct  649  LELLDPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKI  708

Query  392  KIATLYIVTQSRKDTSPID  410
             IA  Y++ Q+ KD    D
Sbjct  709  AIARQYLMPQAMKDCGLTD  727


>RG190_DROME unnamed protein product
Length=1561

 Score = 28.9 bits (63),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 43/101 (43%), Gaps = 14/101 (14%)

Query  99    VKPPTINSNGIRVVRRAYTVLSYIAHFYVHSSRSSEDKTTIPSSIAVPWNHTASALG---  155
             ++   ++S GI      Y V    AH  +   R  ED  T   ++ +P N  A+AL    
Sbjct  1374  IEKEGLDSEGI------YRVPGSRAHVDMLFQRFEEDTNTEIDALDIPVNAVATALKDFF  1427

Query  156   ---LPPILTYASTVLWNWEYIDPSKGLVEGNLRAPLTFTRS  193
                LPP+  ++  ++   E I  S+G+    L   +   RS
Sbjct  1428  SKRLPPL--FSKDIIKELEEIAGSRGVGNSKLNVEVKTDRS  1466



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03230.1.1 40S

Length=231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU52_DROME  unnamed protein product                                 33.9    0.051
ELP1_DROME  unnamed protein product                                   29.3    2.0  
Q9VUH6_DROME  unnamed protein product                                 27.7    6.7  


>Q9VU52_DROME unnamed protein product
Length=715

 Score = 33.9 bits (76),  Expect = 0.051, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 27/120 (23%)

Query  99   VEVAEAAPAGK-----MSVEEALQQVLKNALYHDGLARGLRECAKALDRRAAHLCVLVET  153
            + V+E    GK      +V+E  Q+ ++N   H  L  G R C +    R  +       
Sbjct  217  MNVSEIGNGGKELPTPAAVQERFQRNMRNRCKHQ-LRSGHRACLEVF--RNGY-----RK  268

Query  154  CTEAEYIKLIEALCAEHKINLIKVSDAKVLGTWAGLCKIDREGNPRKVVGTSCVVVRDFG  213
            CT      + +A+C  +++++I              C++D  GNP K+   S VV ++FG
Sbjct  269  CTTNFPSMIAKAICWPYRVDII--------------CELDLFGNPDKICDPSAVVPQNFG  314


>ELP1_DROME unnamed protein product
Length=1252

 Score = 29.3 bits (64),  Expect = 2.0, Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  101  VAEAAPAGKMSVEEALQQVLKNALYHDGLA  130
            ++  A  G+   EEAL+ + K+ LY DGLA
Sbjct  876  LSHLAACGEQHYEEALEYIRKHGLYTDGLA  905


>Q9VUH6_DROME unnamed protein product
Length=1833

 Score = 27.7 bits (60),  Expect = 6.7, Method: Composition-based stats.
 Identities = 25/105 (24%), Positives = 44/105 (42%), Gaps = 4/105 (4%)

Query  7     AVSALVAATFAAPAGGSETGSCNTGLVSCCDTSKDAQKSTGEESGLLHTGDVLDQVAVQC  66
             + +++   + A+    ++T S      S    +K   K       +    D+L  + + C
Sbjct  1312  STASIYMQSGASSTAETQTTSSGVPYASSAALTKVEPKPEALPPKVTSNVDLLSDLDIDC  1371

Query  67    TQI---PLLIGVALEDECKNTPSENGEQVEVPQEEVEVAE-AAPA  107
             +     P+L    L+ +   TP+    QV VP +   VAE AAPA
Sbjct  1372  SVAVPPPMLPQPVLQPQVVATPTPPASQVSVPVKVESVAEHAAPA  1416



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03240.1.1 Major

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQH6_DROME  unnamed protein product                                 242     2e-74
Q9VU17_DROME  unnamed protein product                                 243     3e-74
TRET1_POLVA  unnamed protein product                                  239     4e-73


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 248/463 (54%), Gaps = 6/463 (1%)

Query  21   TNTKSKIRQYVTAFVVNIIAFGFGTVNGWPSPAQSMLQSPHPPIGDTPFTDEEISWLGSI  80
            +N   K  QYV A      AF  GTV GW SPA++ +        D P   ++ SW+GS 
Sbjct  7    SNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGY-DFPVDKDQFSWVGSA  65

Query  81   VFIGGVIGTLVWSQVADRLGRKAAGYLTAVPFIISWSIMIFATDYWSLLGARFIVGIGCT  140
            + +G     +    + + +GRK       +PFI+ W+++I+A +   L  +RFI+GI   
Sbjct  66   MTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGG  125

Query  141  GSLINVPLIVSEMADKDLRGPLGTCLVLSLNGGYLFSYVIGAFATFTQLNVSCAFVPIVF  200
               +  P+   E+A K++RG LG+   L +  G LF Y +GA      L++ C  +P++F
Sbjct  126  AFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGILPLIF  185

Query  201  LVLFYWIPESPSFLISKDKVKEARESLLWYRGDDEDVTEVEMRFLQSQAFTKPNNVSVAA  260
              +F+++PESP++L+SKD+ + A +S+ W RG + D         ++   TK N V+V A
Sbjct  186  GAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANKVNVWA  245

Query  261  LFTDRGVFRGFIIGFILIMGQQITGANFVLTYTASIFKAAGSKLEPDICTIIIGMLQLIA  320
                    +   I   L+  QQ+ G N V+ Y + IF  A + +E +  TI+IG++Q++A
Sbjct  246  ALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVA  305

Query  321  SIVSCVVVNKAGRKILLLLTYLGIFLALSTMGACYYLIDTGTD---ISSFSFVPIVALSF  377
            + VS +VV+K GR+ILLL +  GI +A+ST     Y      D   + S  ++P+ +L  
Sbjct  306  TFVSTLVVDKLGRRILLLAS--GISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCL  363

Query  378  FVTCNAMGVGPVPYILFGEILPGYIQNMAISVFFLFGIFGAFLTVKTYPTLNAIWGMHGT  437
            F+   ++G GPVP+++ GE+    I+  A S+        AF+  KT+  LN   G+ GT
Sbjct  364  FIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGT  423

Query  438  FLFYALCSLSMFIYTMLFVPETKGRSVRSILRELKGTPDTKKS  480
            F  +A  ++   I+    VPETKG+S+  I +EL G   T ++
Sbjct  424  FWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQA  466


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 147/461 (32%), Positives = 249/461 (54%), Gaps = 2/461 (0%)

Query  21   TNTKSKIRQYVTAFVVNIIAFGFGTVNGWPSPAQSMLQSPHPPIGDTPFTDEEISWLGSI  80
            +N   K  QYV A      AF  GTV GW SPA++ +        D P   ++ SW+GS 
Sbjct  75   SNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGY-DFPVDKDQFSWVGSA  133

Query  81   VFIGGVIGTLVWSQVADRLGRKAAGYLTAVPFIISWSIMIFATDYWSLLGARFIVGIGCT  140
            + +G     +    + + +GRK       +PFI+ W+++I+A +   L  +RFI+GI   
Sbjct  134  MTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGG  193

Query  141  GSLINVPLIVSEMADKDLRGPLGTCLVLSLNGGYLFSYVIGAFATFTQLNVSCAFVPIVF  200
               +  P+   E+A K++RG LG+   L +  G LF Y +GA      L++ C  +P++F
Sbjct  194  AFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGILPLIF  253

Query  201  LVLFYWIPESPSFLISKDKVKEARESLLWYRGDDEDVTEVEMRFLQSQAFTKPNNVSVAA  260
              +F+++PESP++L+SKD+ + A +S+ W RG + D         ++   TK N V+V A
Sbjct  254  GAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANKVNVWA  313

Query  261  LFTDRGVFRGFIIGFILIMGQQITGANFVLTYTASIFKAAGSKLEPDICTIIIGMLQLIA  320
                    +   I   L+  QQ+ G N V+ Y + IF  A + +E +  TI+IG++Q++A
Sbjct  314  ALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVA  373

Query  321  SIVSCVVVNKAGRKILLLLTYLGIFLALSTMGACYYL-IDTGTDISSFSFVPIVALSFFV  379
            + VS +VV+K GR+ILLL + + + ++ + +G  ++L       + S  ++P+ +L  F+
Sbjct  374  TFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCLFI  433

Query  380  TCNAMGVGPVPYILFGEILPGYIQNMAISVFFLFGIFGAFLTVKTYPTLNAIWGMHGTFL  439
               ++G GPVP+++ GE+    I+  A S+        AF+  KT+  LN   G+ GTF 
Sbjct  434  IMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFW  493

Query  440  FYALCSLSMFIYTMLFVPETKGRSVRSILRELKGTPDTKKS  480
             +A  ++   I+    VPETKG+S+  I +EL G   T ++
Sbjct  494  LFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQA  534


>TRET1_POLVA unnamed protein product
Length=504

 Score = 239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 152/497 (31%), Positives = 262/497 (53%), Gaps = 20/497 (4%)

Query  3    NHYDKRPSCTSAEFNSLVTNTKSKIR-------------QYVTAFVVNIIAFGFGTVNGW  49
            N+ +  P  T      +  + K+K+              Q + A  V++ +   G  + +
Sbjct  4    NNKEDSPRHTVPFVRQITEDGKAKLEIYRPTTNPIYIYTQILAAIAVSMGSMVVGFASAY  63

Query  50   PSPAQSMLQSPHPPIGDTPFTDEEISWLGSIVFIGGVIGTLVWSQVADRLGRKAAGYLTA  109
             SPA   +Q  +  I     T++E SW+G I+ + G+ G +      + LGRK     TA
Sbjct  64   TSPALVSMQ--NTTITSFKVTEQEASWVGGIMPLAGLAGGIAGGPFIEYLGRKNTILATA  121

Query  110  VPFIISWSIMIFATDYWSLLGARFIVGIGCTG-SLINVPLIVSEMADKDLRGPLGTCLVL  168
            VPFI++W ++ FA   W +L  R + G  C G + +++P+ + E    ++RG LG     
Sbjct  122  VPFIVAWLLIAFANSIWMVLAGRALSGF-CVGIASLSLPVYLGETVQPEVRGTLGLLPTA  180

Query  169  SLNGGYLFSYVIGAFATFTQLNVSCAFVPIVFLVLFYWIPESPSFLISKDKVKEARESLL  228
              N G L  +V G +  ++ L    + +PI F+VL   IPE+P + +++ + + AR++L 
Sbjct  181  FGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPETPRWFVTRGREERARKALQ  240

Query  229  WYRGDDEDVTEVEMRFLQSQAFTKPNNVSVAALFT--DRGVFRGFIIGFILIMGQQITGA  286
            W RG   DV E E++ +         + S  A+F    R   +  +I   L+  QQ++G 
Sbjct  241  WLRGKKADV-EPELKGIVKSHCEAERHASQNAIFDLMKRSNLKPLLIALGLMFFQQLSGI  299

Query  287  NFVLTYTASIFKAAGSKLEPDICTIIIGMLQLIASIVSCVVVNKAGRKILLLLTYLGIFL  346
            N V+ YT SIFK AGS ++ ++CTII+G++   A+  + V++++ GRKILL ++ + + +
Sbjct  300  NAVIFYTVSIFKDAGSTIDENLCTIIVGVVNFGATFFATVLIDRLGRKILLYISEVAMVI  359

Query  347  ALSTMGACYYLIDTGTDISSFSFVPIVALSFFVTCNAMGVGPVPYILFGEILPGYIQNMA  406
             L T+G  +Y  ++G D+S+  ++P+ +   +V   + GVGP+P+++ GEILPG I+  A
Sbjct  360  TLLTLGTFFYYKNSGNDVSNIGWLPLASFVIYVIGFSSGVGPIPWLMLGEILPGKIRGSA  419

Query  407  ISVFFLFGIFGAFLTVKTYPTLNAIWGMHGTFLFYALCSLSMFIYTMLFVPETKGRSVRS  466
             SV   F     F+  KT+  + A  G HG F F+ +  L    + + FVPET+G+S+  
Sbjct  420  ASVATGFNWTCTFIVTKTFADIVAAIGNHGAFWFFGVICLIGLFFVIFFVPETQGKSLEE  479

Query  467  ILRELKGTPDTKKSAIN  483
            I R++ G      S  N
Sbjct  480  IERKMMGRVRRMSSVAN  496



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


Query= Dcitr00g03250.1.1 ADP-ribosylation

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4B2_DROME  unnamed protein product                                 232     1e-76
H9XVM3_DROME  unnamed protein product                                 232     1e-76
ARF1_DROME  unnamed protein product                                   174     1e-55


>Q9V4B2_DROME unnamed protein product
Length=312

 Score = 232 bits (592),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 1/162 (1%)

Query  1    MGANMGKNSAAFFENLQASGS-SSVHIVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNC  59
            MGA M K        L A  S +++H+VMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNC
Sbjct  1    MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNC  60

Query  60   EKVKGQIGKCKGINFLIWDVGGQEKLRPLWKSYTRCTDGIIFVIDSTDVERMEEVKIELI  119
            EKV+  +GK KG++FL+WDVGGQEKLRPLW+SYTRCTDGI+FVIDS D ERMEE K+EL+
Sbjct  61   EKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELM  120

Query  120  KTIKNNDNFNVPILILANKQDLPNAIQIKQIEKLLGLYELNN  161
            +T K  DN  VP+LILANKQDLPNA    ++EKLLGL EL N
Sbjct  121  RTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLGLNELYN  162


 Score = 60.1 bits (144),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 6/76 (8%)

Query  129  NVPILILANKQDLPNAIQIKQIEKLLGLYELNNMHL--YYIQATCAITGDGLHEGINELY  186
            N  +L   N QD+ N    K++ +       N++    +YIQ TCAITG+GL EG++ LY
Sbjct  240  NSAVLDQKNPQDVKNGFHNKKMNR----SSSNSVQFRGWYIQPTCAITGEGLQEGLDALY  295

Query  187  QLILKKRKLQKTNKMN  202
             +ILK+RK+ K+NK N
Sbjct  296  DMILKRRKINKSNKRN  311


>H9XVM3_DROME unnamed protein product
Length=313

 Score = 232 bits (591),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 131/163 (80%), Gaps = 2/163 (1%)

Query  1    MGANMGKNSAAFFENLQA--SGSSSVHIVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFN  58
            MGA M K        L A  S  +++H+VMLGLDSAGKTTALYRLKFDQYLNTVPTIGFN
Sbjct  1    MGATMVKPLVKNGNILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFN  60

Query  59   CEKVKGQIGKCKGINFLIWDVGGQEKLRPLWKSYTRCTDGIIFVIDSTDVERMEEVKIEL  118
            CEKV+  +GK KG++FL+WDVGGQEKLRPLW+SYTRCTDGI+FVIDS D ERMEE K+EL
Sbjct  61   CEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMEL  120

Query  119  IKTIKNNDNFNVPILILANKQDLPNAIQIKQIEKLLGLYELNN  161
            ++T K  DN  VP+LILANKQDLPNA    ++EKLLGL EL N
Sbjct  121  MRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLGLNELYN  163


 Score = 60.1 bits (144),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 6/76 (8%)

Query  129  NVPILILANKQDLPNAIQIKQIEKLLGLYELNNMHL--YYIQATCAITGDGLHEGINELY  186
            N  +L   N QD+ N    K++ +       N++    +YIQ TCAITG+GL EG++ LY
Sbjct  241  NSAVLDQKNPQDVKNGFHNKKMNR----SSSNSVQFRGWYIQPTCAITGEGLQEGLDALY  296

Query  187  QLILKKRKLQKTNKMN  202
             +ILK+RK+ K+NK N
Sbjct  297  DMILKRRKINKSNKRN  312


>ARF1_DROME unnamed protein product
Length=182

 Score = 174 bits (441),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 8/181 (4%)

Query  5    MGKNSAAFFENLQASGSSSVHIVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVKG  64
            MG   A  F+ L   G   + I+M+GLD+AGKTT LY+LK  + + T+PTIGFN E V+ 
Sbjct  1    MGNVFANLFKGL--FGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-  57

Query  65   QIGKCKGINFLIWDVGGQEKLRPLWKSYTRCTDGIIFVIDSTDVERMEEVKIELIKTIKN  124
                 K I+F +WDVGGQ+K+RPLW+ Y + T G+IFV+DS D ER+ E + EL++ +  
Sbjct  58   ----YKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAE  113

Query  125  NDNFNVPILILANKQDLPNAIQIKQIEKLLGLYELNNMHLYYIQATCAITGDGLHEGINE  184
            ++  +  +LI ANKQDLPNA+   +I   LGL+ L N + +YIQATCA +GDGL+EG++ 
Sbjct  114  DELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRN-WYIQATCATSGDGLYEGLDW  172

Query  185  L  185
            L
Sbjct  173  L  173



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6097717956


  Database: /agbase_database/arthropod_exponly.fa
    Posted date:  Apr 30, 2020  3:48 PM
  Number of letters in database: 9,326,551
  Number of sequences in database:  12,081



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/arthropod_exponly.fa
           12,081 sequences; 9,326,551 total letters



Query= Dcitr00g03250.1.2 ADP-ribosylation

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4B2_DROME  unnamed protein product                                 232     1e-76
H9XVM3_DROME  unnamed protein product                                 232     1e-76
ARF1_DROME  unnamed protein product                                   174     1e-55


>Q9V4B2_DROME unnamed protein product
Length=312

 Score = 232 bits (592),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 1/162 (1%)

Query  1    MGANMGKNSAAFFENLQASGS-SSVHIVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNC  59
            MGA M K        L A  S +++H+VMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNC
Sbjct  1    MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNC  60

Query  60   EKVKGQIGKCKGINFLIWDVGGQEKLRPLWKSYTRCTDGIIFVIDSTDVERMEEVKIELI  119
            EKV+  +GK KG++FL+WDVGGQEKLRPLW+SYTRCTDGI+FVIDS D ERMEE K+EL+
Sbjct  61   EKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELM  120

Query  120  KTIKNNDNFNVPILILANKQDLPNAIQIKQIEKLLGLYELNN  161
            +T K  DN  VP+LILANKQDLPNA    ++EKLLGL EL N
Sbjct  121  RTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLGLNELYN  162


 Score = 60.1 bits (144),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 6/76 (8%)

Query  129  NVPILILANKQDLPNAIQIKQIEKLLGLYELNNMHL--YYIQATCAITGDGLHEGINELY  186
            N  +L   N QD+ N    K++ +       N++    +YIQ TCAITG+GL EG++ LY
Sbjct  240  NSAVLDQKNPQDVKNGFHNKKMNR----SSSNSVQFRGWYIQPTCAITGEGLQEGLDALY  295

Query  187  QLILKKRKLQKTNKMN  202
             +ILK+RK+ K+NK N
Sbjct  296  DMILKRRKINKSNKRN  311


>H9XVM3_DROME unnamed protein product
Length=313

 Score = 232 bits (591),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 131/163 (80%), Gaps = 2/163 (1%)

Query  1    MGANMGKNSAAFFENLQA--SGSSSVHIVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFN  58
            MGA M K        L A  S  +++H+VMLGLDSAGKTTALYRLKFDQYLNTVPTIGFN
Sbjct  1    MGATMVKPLVKNGNILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFN  60

Query  59   CEKVKGQIGKCKGINFLIWDVGGQEKLRPLWKSYTRCTDGIIFVIDSTDVERMEEVKIEL  118
            CEKV+  +GK KG++FL+WDVGGQEKLRPLW+SYTRCTDGI+FVIDS D ERMEE K+EL
Sbjct  61   CEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMEL  120

Query  119  IKTIKNNDNFNVPILILANKQDLPNAIQIKQIEKLLGLYELNN  161
            ++T K  DN  VP+LILANKQDLPNA    ++EKLLGL EL N
Sbjct  121  MRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLGLNELYN  163


 Score = 60.1 bits (144),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 6/76 (8%)

Query  129  NVPILILANKQDLPNAIQIKQIEKLLGLYELNNMHL--YYIQATCAITGDGLHEGINELY  186
            N  +L   N QD+ N    K++ +       N++    +YIQ TCAITG+GL EG++ LY
Sbjct  241  NSAVLDQKNPQDVKNGFHNKKMNR----SSSNSVQFRGWYIQPTCAITGEGLQEGLDALY  296

Query  187  QLILKKRKLQKTNKMN  202
             +ILK+RK+ K+NK N
Sbjct  297  DMILKRRKINKSNKRN  312


>ARF1_DROME unnamed protein product
Length=182

 Score = 174 bits (441),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 8/181 (4%)

Query  5    MGKNSAAFFENLQASGSSSVHIVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVKG  64
            MG   A  F+ L   G   + I+M+GLD+AGKTT LY+LK  + + T+PTIGFN E V+ 
Sbjct  1    MGNVFANLFKGL--FGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-  57

Query  65   QIGKCKGINFLIWDVGGQEKLRPLWKSYTRCTDGIIFVIDSTDVERMEEVKIELIKTIKN  124
                 K I+F +WDVGGQ+K+RPLW+ Y + T G+IFV+DS D ER+ E + EL++ +  
Sbjct  58   ----YKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAE  113

Query  125  NDNFNVPILILANKQDLPNAIQIKQIEKLLGLYELNNMHLYYIQATCAITGDGLHEGINE  184
            ++  +  +LI ANKQDLPNA+   +I   LGL+ L N + +YIQATCA +GDGL+EG++ 
Sbjct  114  DELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRN-WYIQATCATSGDGLYEGLDW  172

Query  185  L  185
            L
Sbjct  173  L  173



Lambda      K        H
   0.322    0.139    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 925575881


Query= Dcitr00g03260.1.1 Glutaredoxin-related

Length=228
                                                                      Score     E
Sequences producing signific