BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g01000.1.1 cAMP-specific

Length=131
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NH11_DROME  unnamed protein product                                 30.8    0.35 
Q9VSE6_DROME  unnamed protein product                                 30.8    0.36 
PER_CAEEL  unnamed protein product                                    27.3    4.1  


>Q9NH11_DROME unnamed protein product
Length=1530

 Score = 30.8 bits (68),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 12/62 (19%)

Query  63    ILRKNL----LLGKMSAATLPELSEILPASGEGDGD-----DLPLPVNPIIRRRSSSKTH  113
             +LRKNL    +LG  + ATLP    I+   G  DG+     D+PLP N ++   S SK  
Sbjct  972   VLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVL---SVSKDE  1028

Query  114   TR  115
              R
Sbjct  1029  NR  1030


>Q9VSE6_DROME unnamed protein product
Length=1579

 Score = 30.8 bits (68),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 12/62 (19%)

Query  63    ILRKNL----LLGKMSAATLPELSEILPASGEGDGD-----DLPLPVNPIIRRRSSSKTH  113
             +LRKNL    +LG  + ATLP    I+   G  DG+     D+PLP N ++   S SK  
Sbjct  1021  VLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVL---SVSKDE  1077

Query  114   TR  115
              R
Sbjct  1078  NR  1079


>PER_CAEEL unnamed protein product
Length=597

 Score = 27.3 bits (59),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 0/55 (0%)

Query  15  NRRAPLPEVPPVRNEDQEVAPPNYVSSKSFPPSQRTERGKQLFHKSFSILRKNLL  69
           N   P P  P +R E   ++PPN  SS S       +  + LF  +F++    +L
Sbjct  19  NPTQPQPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVL  73



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01010.1.1 Phosphodiesterase

Length=186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDE4B_DROME  unnamed protein product                                  102     2e-25
PDE4A_DROME  unnamed protein product                                  102     3e-25
PDE4C_DROME  unnamed protein product                                  98.6    4e-24


>PDE4B_DROME unnamed protein product
Length=1070

 Score = 102 bits (255),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 57/69 (83%), Gaps = 2/69 (3%)

Query  63   LQNFDVENGASPGRSPLDGAASPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI  122
            L  FDVENG    RSPL+G  SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI
Sbjct  383  LFGFDVENGQG-ARSPLEGG-SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI  440

Query  123  VSERIIKAE  131
             SER  + E
Sbjct  441  ASERFKEQE  449


>PDE4A_DROME unnamed protein product
Length=1209

 Score = 102 bits (253),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 56/66 (85%), Gaps = 2/66 (3%)

Query  66   FDVENGASPGRSPLDGAASPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIVSE  125
            FDVENG    RSPL+G  SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI SE
Sbjct  525  FDVENGQG-ARSPLEGG-SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIASE  582

Query  126  RIIKAE  131
            R  + E
Sbjct  583  RFKEQE  588


>PDE4C_DROME unnamed protein product
Length=983

 Score = 98.6 bits (244),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 53/60 (88%), Gaps = 2/60 (3%)

Query  66   FDVENGASPGRSPLDGAASPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIVSE  125
            FDVENG    RSPL+G  SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSI SE
Sbjct  312  FDVENGQG-ARSPLEGG-SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSMSRNSSIASE  369



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01020.1.1 cAMP-specific

Length=107
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389V9_TRYB2  unnamed protein product                                 27.3    2.8  
BCL9_DROME  unnamed protein product                                   26.9    3.4  
M9PGJ2_DROME  unnamed protein product                                 26.9    3.9  


>Q389V9_TRYB2 unnamed protein product
Length=300

 Score = 27.3 bits (59),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 28/60 (47%), Gaps = 3/60 (5%)

Query  37   SENVPSVDSPSSGAGKLPRTLSTSVLR--IKPRSSFWDKFWEE-RSKSRNCLSFRTLKYT  93
            + ++P  D PSS A  LP  L  S L+  IK   +F +K     RS  R C S   L  T
Sbjct  144  TTHIPLTDDPSSAARVLPDELLGSYLQESIKKAPTFREKMCHTVRSLFRRCASVSRLSVT  203


>BCL9_DROME unnamed protein product
Length=1469

 Score = 26.9 bits (58),  Expect = 3.4, Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 0/43 (0%)

Query  19   PHPFGVLSITSSASVSGMSENVPSVDSPSSGAGKLPRTLSTSV  61
            P+   + S  ++A+V G+  N PS+D   S +G +P+  +++V
Sbjct  788  PNNLSLPSPRTTAAVMGLPTNSPSMDGTGSLSGSVPQANTSTV  830


>M9PGJ2_DROME unnamed protein product
Length=1403

 Score = 26.9 bits (58),  Expect = 3.9, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 25/56 (45%), Gaps = 0/56 (0%)

Query  14  GGKFKPHPFGVLSITSSASVSGMSENVPSVDSPSSGAGKLPRTLSTSVLRIKPRSS  69
           G  F   PFG  S+ +   +S +    P   S S G+G    T   + LR  PR++
Sbjct  41  GVHFMSSPFGNASLIALQDLSNVHGKSPQRRSFSEGSGPRQATPQLAALRCLPRTT  96



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01030.1.1 Phosphodiesterase

Length=147
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDE4B_DROME  unnamed protein product                                  140     3e-39
PDE4E_DROME  unnamed protein product                                  139     4e-39
PDE4A_DROME  unnamed protein product                                  139     6e-39


>PDE4B_DROME unnamed protein product
Length=1070

 Score = 140 bits (353),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 4/97 (4%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  458  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  517

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLK  99
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLK
Sbjct  518  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLK  554


>PDE4E_DROME unnamed protein product
Length=662

 Score = 139 bits (350),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 4/97 (4%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  50   HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  109

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLK  99
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLK
Sbjct  110  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLK  146


>PDE4A_DROME unnamed protein product
Length=1209

 Score = 139 bits (351),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 4/97 (4%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  597  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  656

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLK  99
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLK
Sbjct  657  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLK  693



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01040.1.1 Phosphodiesterase

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDE4E_DROME  unnamed protein product                                  328     5e-109
PDE4B_DROME  unnamed protein product                                  330     4e-106
PDE4C_DROME  unnamed protein product                                  328     6e-106


>PDE4E_DROME unnamed protein product
Length=662

 Score = 328 bits (840),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 191/243 (79%), Gaps = 8/243 (3%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  50   HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  109

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSKSGNQIS  122
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESS+SGNQIS
Sbjct  110  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQIS  169

Query  123  EYICSTFLDKQQELDLPALRIEDSQ---GSDPRSGGASSKKKDRGGPPGRTVPMSHISGV  179
            EYICSTFLDKQQE DLP+LR+ED+     ++  +G  S+ +  R   P R  PMS ISGV
Sbjct  170  EYICSTFLDKQQEFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSP-RGPPMSQISGV  228

Query  180  KRPLTHTNSFTGEKLPKHGVETASEEELGNTLSEIDSWGIDIFRIAELSNNRPLTAVAYA  239
            KRPL+HTNSFTGE+LP  GVET  E ELG  L E+D+WGI IF I E S NRPLT VAY 
Sbjct  229  KRPLSHTNSFTGERLPTFGVETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYT  288

Query  240  AFQ  242
             FQ
Sbjct  289  IFQ  291


>PDE4B_DROME unnamed protein product
Length=1070

 Score = 330 bits (845),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 191/243 (79%), Gaps = 8/243 (3%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  458  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  517

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSKSGNQIS  122
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESS+SGNQIS
Sbjct  518  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQIS  577

Query  123  EYICSTFLDKQQELDLPALRIEDSQ---GSDPRSGGASSKKKDRGGPPGRTVPMSHISGV  179
            EYICSTFLDKQQE DLP+LR+ED+     ++  +G  S+ +  R   P R  PMS ISGV
Sbjct  578  EYICSTFLDKQQEFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSP-RGPPMSQISGV  636

Query  180  KRPLTHTNSFTGEKLPKHGVETASEEELGNTLSEIDSWGIDIFRIAELSNNRPLTAVAYA  239
            KRPL+HTNSFTGE+LP  GVET  E ELG  L E+D+WGI IF I E S NRPLT VAY 
Sbjct  637  KRPLSHTNSFTGERLPTFGVETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYT  696

Query  240  AFQ  242
             FQ
Sbjct  697  IFQ  699


>PDE4C_DROME unnamed protein product
Length=983

 Score = 328 bits (840),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 191/243 (79%), Gaps = 8/243 (3%)

Query  7    HGEDLIVTPFAQILASLRSVRNNFLSLTNVPTA-KSRR---SSGAAGSGTPQNRNLTPGD  62
            HGEDLIVTPFAQILASLRSVRNN LSLTNVP + KSRR   SS A+ SG P    L+ G+
Sbjct  371  HGEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGE  430

Query  63   DAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSKSGNQIS  122
            +AY +L+ +T+EELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESS+SGNQIS
Sbjct  431  EAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQIS  490

Query  123  EYICSTFLDKQQELDLPALRIEDSQ---GSDPRSGGASSKKKDRGGPPGRTVPMSHISGV  179
            EYICSTFLDKQQE DLP+LR+ED+     ++  +G  S+ +  R   P R  PMS ISGV
Sbjct  491  EYICSTFLDKQQEFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSP-RGPPMSQISGV  549

Query  180  KRPLTHTNSFTGEKLPKHGVETASEEELGNTLSEIDSWGIDIFRIAELSNNRPLTAVAYA  239
            KRPL+HTNSFTGE+LP  GVET  E ELG  L E+D+WGI IF I E S NRPLT VAY 
Sbjct  550  KRPLSHTNSFTGERLPTFGVETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYT  609

Query  240  AFQ  242
             FQ
Sbjct  610  IFQ  612



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01050.1.1 Transcription

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PFG6_DROME  unnamed protein product                                 48.1    4e-06
Q9VUD1_DROME  unnamed protein product                                 47.8    4e-06
DICH_DROME  unnamed protein product                                   43.5    1e-04


>M9PFG6_DROME unnamed protein product
Length=407

 Score = 48.1 bits (113),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)

Query  1    MHMKDHPDYKYRPRRKPKTLRK  22
            +HMK+HPDYKYRPRRKPKTL K
Sbjct  180  LHMKEHPDYKYRPRRKPKTLNK  201


>Q9VUD1_DROME unnamed protein product
Length=388

 Score = 47.8 bits (112),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)

Query  1    MHMKDHPDYKYRPRRKPKTLRK  22
            +HMK+HPDYKYRPRRKPKTL K
Sbjct  180  LHMKEHPDYKYRPRRKPKTLNK  201


>DICH_DROME unnamed protein product
Length=382

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)

Query  1    MHMKDHPDYKYRPRRKPK  18
            +HMK+HPDYKYRPRRKPK
Sbjct  201  LHMKEHPDYKYRPRRKPK  218



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01060.1.1 ATPase

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 236     1e-70
Q9Y090_DROME  unnamed protein product                                 236     1e-70
Q581V6_TRYB2  unnamed protein product                                 202     1e-58


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 186/326 (57%), Gaps = 40/326 (12%)

Query  20    LFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVWPS  72
             L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+WPS
Sbjct  681   LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMWPS  740

Query  73    MYPDLFSQCPLKPQSGILLV---------------------------QNCFSKFIGESEE  105
              YP +F+  PL+ Q+G+LL                                +K+IG+SEE
Sbjct  741   RYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQSEE  800

Query  106   GVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVYVV  165
              VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV V+
Sbjct  801   NVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVTVI  860

Query  166   GATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTEIAQCTE  225
              ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  T 
Sbjct  861   AATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGKTA  920

Query  226   RFTGADLLGLLCSAQM------LRQKYDEESSEEPEITQADLLKALEDTKPSLSAADSFK  279
              +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D  K
Sbjct  921   NYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDVAK  980

Query  280   FEQIFYNFANNRGLSSDEIQKQKVIS  305
             + + +  F N    S + + K+  ++
Sbjct  981   YHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 73/171 (43%), Gaps = 9/171 (5%)

Query  104  EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLE  160
            ++ +RNIF       P I+  +  D LA   G  S+      +R+ + +   +       
Sbjct  527  QKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNN  586

Query  161  GVYVVGATSRPDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNL  217
             + V+   +    ++  L  P GR        +P+L+  +RE IL  L   + +  D++L
Sbjct  587  AIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDL  646

Query  218  TEIAQCTERFTGADLLGLLCSAQMLRQKYDEESSEEPEITQADLLKALEDT  268
             + +  TE +   DL+  +  A     +    S  +P +T   L+++LE T
Sbjct  647  VKFSNLTEGYRKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 186/326 (57%), Gaps = 40/326 (12%)

Query  20    LFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVWPS  72
             L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+WPS
Sbjct  681   LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMWPS  740

Query  73    MYPDLFSQCPLKPQSGILLV---------------------------QNCFSKFIGESEE  105
              YP +F+  PL+ Q+G+LL                                +K+IG+SEE
Sbjct  741   RYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQSEE  800

Query  106   GVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVYVV  165
              VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV V+
Sbjct  801   NVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVTVI  860

Query  166   GATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTEIAQCTE  225
              ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  T 
Sbjct  861   AATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGKTA  920

Query  226   RFTGADLLGLLCSAQM------LRQKYDEESSEEPEITQADLLKALEDTKPSLSAADSFK  279
              +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D  K
Sbjct  921   NYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDVAK  980

Query  280   FEQIFYNFANNRGLSSDEIQKQKVIS  305
             + + +  F N    S + + K+  ++
Sbjct  981   YHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 73/171 (43%), Gaps = 9/171 (5%)

Query  104  EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLE  160
            ++ +RNIF       P I+  +  D LA   G  S+      +R+ + +   +       
Sbjct  527  QKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNN  586

Query  161  GVYVVGATSRPDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNL  217
             + V+   +    ++  L  P GR        +P+L+  +RE IL  L   + +  D++L
Sbjct  587  AIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDL  646

Query  218  TEIAQCTERFTGADLLGLLCSAQMLRQKYDEESSEEPEITQADLLKALEDT  268
             + +  TE +   DL+  +  A     +    S  +P +T   L+++LE T
Sbjct  647  VKFSNLTEGYRKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>Q581V6_TRYB2 unnamed protein product
Length=911

 Score = 202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 155/242 (64%), Gaps = 28/242 (12%)

Query  29   AFKSHVPLALKGISSNAVEKINFSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKPQSG  88
            A  +  PL+  GI+    EK +  +VGGL  A+++L +TLV P  +P+LF++ PLK +SG
Sbjct  562  AIAAFTPLSHTGITFLKSEKASLQSVGGLAEARKVLYDTLVLPMKHPELFARLPLKTRSG  621

Query  89   ILLVQ-------------------NC--------FSKFIGESEEGVRNIFNRARSIQPCI  121
            +LL                     NC        F K+IG+SE+ +R++F RA++  PC+
Sbjct  622  VLLYGASGCGKTFVVEAIVNSENLNCIVVNGPEVFGKYIGQSEQKIRDVFERAQAAAPCV  681

Query  122  LFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRP  181
            +FFDEFDS+A +RG D++GV DRVVNQLL  LDGVE  + VYVV A+SRPD+ID ALLRP
Sbjct  682  VFFDEFDSVAPQRGVDNSGVTDRVVNQLLCYLDGVESRKDVYVVAASSRPDLIDAALLRP  741

Query  182  GRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDV-NLTEIAQCTERFTGADLLGLLCSAQ  240
            GRL  +VHC +P L++R +IL++  ++L+    +  + EIA+ T  +T ADL GL  SA 
Sbjct  742  GRLDKAVHCPIPSLEDRVNILTICFEQLQAELTLPEIKEIAEQTINWTPADLNGLASSAS  801

Query  241  ML  242
            M+
Sbjct  802  MV  803



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01070.1.1 protein

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q381S4_TRYB2  unnamed protein product                                 37.0    0.028
SYFA_DROME  unnamed protein product                                   30.4    3.0  
Q20937_CAEEL  unnamed protein product                                 30.4    3.5  


>Q381S4_TRYB2 unnamed protein product
Length=595

 Score = 37.0 bits (84),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 55/316 (17%), Positives = 130/316 (41%), Gaps = 41/316 (13%)

Query  2    SATHSSNVKHTLHCNES---YGTSNLKNSWKIVTDETNKVSFIANLNNDKSGNTSKVVEK  58
            S  HS+  K  +    S   +   N+  SW+ V     +V   +  N         ++++
Sbjct  108  SYNHSNKQKREVSLTPSELGFSQCNVNYSWETVVAHPLEVRLASRRNES-------LLQR  160

Query  59   IKIFFYQAFLPQGFPDTVSNDYIEYQLWDTAQAFCSTLTAVLTTHAIMQGVGVGNESATT  118
            + +F     +P G+PD+    +  Y L     +F S+  + +   +I+ G  +       
Sbjct  161  LHLFG----MPAGYPDSCGEGFRRYFLLSLCSSFVSSFASSIGYQSILNGFLLA------  210

Query  119  LAAATAWIIKDGTGMI------GRILFAWWEGTILDADCKRWRILADLINDVAMCVELML  172
             ++   W++KD    +       R++         +   K W + +  ++++++  E+++
Sbjct  211  -SSPQLWMLKDLAPALAAAYLANRVI-------SYENRPKFWFVFSVALHNLSVIAEMII  262

Query  173  PLFPQSCVIYALALSSLGKSLVGVAGGATRASIIQHQAAHSGNIGDIAAKDGSQETCVNL  232
            P    + ++ A  L+S  +    +    TRAS +QH A  S N+ ++  K  S    +  
Sbjct  263  PTTVPNHLLAAAILTSCVRQSASLMFLVTRASALQHFAI-SNNLAELTKKFNSFGMVIYT  321

Query  233  TASLLGLVVLKLCTENIFLTWLLFIIFTGLHIYFNYRAVRCLEFNTFNRQRFIILFQHYL  292
             ++ LG+    L   ++       ++  G ++  ++ ++  + F   N     ++ + Y+
Sbjct  322  VSTALGIAYTSL-VPSVTAQLATVLMCCGANLAISHLSMCNIAFRILNETTLSVILRFYM  380

Query  293  HSK-----HILSPSQV  303
              +      +LSP +V
Sbjct  381  REEGHQRGRVLSPREV  396


>SYFA_DROME unnamed protein product
Length=498

 Score = 30.4 bits (67),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  58   KIKIFFYQAFLPQGFPDTVSNDYIEYQLWD  87
            K++  F Q FL  GF +  +N+Y+E   W+
Sbjct  228  KVRTEFRQIFLEMGFSEMPTNNYVESSFWN  257


>Q20937_CAEEL unnamed protein product
Length=2641

 Score = 30.4 bits (67),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query  265   YFNYRAVRCLEFNTFNRQRFII----LFQHYLHSKHILSPSQVRVQERILFPLTEKQAFN  320
             +F Y  +  L ++       I+    LFQ + H+KH++ P+ +   + ++ P+TE+ A  
Sbjct  1575  HFAYHDINVLTYDGLIPHVKIVSHLPLFQLHPHAKHLVRPAMIHAIKELIGPVTER-ALK  1633

Query  321   MNITLGASVL  330
             + +T+  S++
Sbjct  1634  IAMTVTESLV  1643



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01080.1.1 ATPase

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 325     5e-101
Q9Y090_DROME  unnamed protein product                                 325     5e-101
TERA_DROME  unnamed protein product                                   262     8e-79 


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>TERA_DROME unnamed protein product
Length=801

 Score = 262 bits (669),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 264/507 (52%), Gaps = 37/507 (7%)

Query  3    SKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVSL  62
            SK+    E  LR     A    P+ + +D+I+ +        D     +  ++ S  ++L
Sbjct  273  SKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAP----KRDKTHGEVERRIVSQLLTL  328

Query  63   VHEFQLNSSIVMVGVTSSRDIIKNTKAGLVFSHCYSLPSLELDNRNLLLETL-IQYKLKR  121
            +   + +S ++++  T+  + I    A   F        + + +    LE L I  K  +
Sbjct  329  MDGMKKSSHLIVMAATNRPNSID--PALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK  386

Query  122  EHYNMNDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLED--NDASTPDTLKTNL  179
             H   +D+D+ +++ +  G+   D+  +  +A    +  K+DL D  +D    + L +  
Sbjct  387  LH---DDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLA  443

Query  180  FSTEDLEEAFKSHVPLALKGISSNAVEKINFSNVGGLKSAKQLLIETLVWPSMYPDLFSQ  239
             + E+   A     P AL+      V    ++++GGL+S K+ L E + +P  +PD F +
Sbjct  444  VTMENFRYAMTKSSPSALRETVVE-VPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLK  502

Query  240  CPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGESEEGVRNIFNR  299
              ++P  G+L YG PG GKTLLA AI+ EC   FIS+KGPEL + + GESE  VR+IF++
Sbjct  503  FGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDK  562

Query  300  ARSIQPCILFFDEFDSLAAKRG---NDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
            ARS  PC+LFFDE DS+A  RG    D+ G  DRV+NQ+LTE+DG+   + V+++GAT+R
Sbjct  563  ARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR  622

Query  357  PDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQCTEMFTGA  416
            PDIIDPA+LRPGRL   ++  +PD K RE IL    +K  L  +V+LT IA+ T+ F+GA
Sbjct  623  PDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGA  682

Query  417  DLLGLLCSAQML--RQEYDEESSEE-------------------PEITQADLLKALEDTK  455
            DL  +   A  L  RQ  + E   E                   PEIT A   +A++  +
Sbjct  683  DLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFAR  742

Query  456  PSLSAADSFKFEQIFYNFANNRGLSSD  482
             S+S  D  K+E        +RG   +
Sbjct  743  RSVSDNDIRKYEMFAQTLQQSRGFGQN  769


 Score = 175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 133/228 (58%), Gaps = 2/228 (1%)

Query  208  INFSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISG  267
            + + ++GG +     + E +  P  +P LF    +KP  GIL+YG PGTGKTL+A A++ 
Sbjct  198  VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVAN  257

Query  268  ECGLKFISIKGPELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGV  327
            E G  F  I GPE+ SK  GESE  +R  F  A    P I+F DE D++A KR      V
Sbjct  258  ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEV  317

Query  328  KDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDI  387
            + R+V+QLLT +DG++    + V+ AT+RP+ IDPAL R GR    +   +PD   R ++
Sbjct  318  ERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEV  377

Query  388  LSVLTQKLKLNSDVNLTKIAQCTEMFTGADLLGLLCSA--QMLRQEYD  433
            L + T+ +KL+ DV+L +IA  +    GADL  L   A  Q +R++ D
Sbjct  378  LRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMD  425



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01080.1.2 ATPase

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 325     5e-101
Q9Y090_DROME  unnamed protein product                                 325     5e-101
TERA_DROME  unnamed protein product                                   262     8e-79 


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 283/508 (56%), Gaps = 38/508 (7%)

Query  2     KSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVS  61
             K +    ++K LR++ +      P+ V+L+++++L     E          N++      
Sbjct  519   KGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGEYYNRMADTVYQ  577

Query  62    LVHEFQLNSSIVMVGVTSSRDIIK----NTKAGLVFSHCYSLPSLELDNRNLLLETLIQY  117
             L+ ++  N++I ++   +    +     + +   VF     LP+LE  +R ++L  L   
Sbjct  578   LIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCS-  636

Query  118   KLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLK  176
                  H N+  D+D+ K S   EGY   D+   V++A+F+             + P    
Sbjct  637   -----HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-------SKTQP----  680

Query  177   TNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKSAKQLLIETLVW  229
               L + + L E+ +      L+GI SN          ++    + GL+S   +L E L+W
Sbjct  681   --LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLESVVGVLEEVLMW  738

Query  230   PSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGES  289
             PS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KGPEL +K+IG+S
Sbjct  739   PSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQS  798

Query  290   EEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTELDGVEGLEGVY  349
             EE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTELDGVEGL+GV 
Sbjct  799   EENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEGLQGVT  858

Query  350   VVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQC  409
             V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+  V+    A  
Sbjct  859   VIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDFDWFAGK  918

Query  410   TEMFTGADLLGLLCSAQM------LRQEYDEESSEEPEITQADLLKALEDTKPSLSAADS  463
             T  +TGAD+  +L SA M      L Q   E+ +++  + Q  L+++ + T+PSLSA+D 
Sbjct  919   TANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTRPSLSASDV  978

Query  464   FKFEQIFYNFANNRGLSSDEIQKQKVIS  491
              K+ + +  F N    S + + K+  ++
Sbjct  979   AKYHRTYARFTNKEKTSREFVAKRATLA  1006


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 14/221 (6%)

Query  245  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  299
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  300  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  357  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTKIAQCTEMF  413
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L K +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  414  TGADLLGLLCSAQMLRQEYDEESSEEPEITQADLLKALEDT  454
               DL+  +  A          S  +P +T   L+++LE T
Sbjct  657  RKCDLVQFVERAIFYAYRI---SKTQPLLTNDQLIESLEHT  694


>TERA_DROME unnamed protein product
Length=801

 Score = 262 bits (669),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 264/507 (52%), Gaps = 37/507 (7%)

Query  3    SKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVSL  62
            SK+    E  LR     A    P+ + +D+I+ +        D     +  ++ S  ++L
Sbjct  273  SKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAP----KRDKTHGEVERRIVSQLLTL  328

Query  63   VHEFQLNSSIVMVGVTSSRDIIKNTKAGLVFSHCYSLPSLELDNRNLLLETL-IQYKLKR  121
            +   + +S ++++  T+  + I    A   F        + + +    LE L I  K  +
Sbjct  329  MDGMKKSSHLIVMAATNRPNSID--PALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK  386

Query  122  EHYNMNDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLED--NDASTPDTLKTNL  179
             H   +D+D+ +++ +  G+   D+  +  +A    +  K+DL D  +D    + L +  
Sbjct  387  LH---DDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLA  443

Query  180  FSTEDLEEAFKSHVPLALKGISSNAVEKINFSNVGGLKSAKQLLIETLVWPSMYPDLFSQ  239
             + E+   A     P AL+      V    ++++GGL+S K+ L E + +P  +PD F +
Sbjct  444  VTMENFRYAMTKSSPSALRETVVE-VPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLK  502

Query  240  CPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGESEEGVRNIFNR  299
              ++P  G+L YG PG GKTLLA AI+ EC   FIS+KGPEL + + GESE  VR+IF++
Sbjct  503  FGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDK  562

Query  300  ARSIQPCILFFDEFDSLAAKRG---NDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSR  356
            ARS  PC+LFFDE DS+A  RG    D+ G  DRV+NQ+LTE+DG+   + V+++GAT+R
Sbjct  563  ARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR  622

Query  357  PDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTKIAQCTEMFTGA  416
            PDIIDPA+LRPGRL   ++  +PD K RE IL    +K  L  +V+LT IA+ T+ F+GA
Sbjct  623  PDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGA  682

Query  417  DLLGLLCSAQML--RQEYDEESSEE-------------------PEITQADLLKALEDTK  455
            DL  +   A  L  RQ  + E   E                   PEIT A   +A++  +
Sbjct  683  DLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFAR  742

Query  456  PSLSAADSFKFEQIFYNFANNRGLSSD  482
             S+S  D  K+E        +RG   +
Sbjct  743  RSVSDNDIRKYEMFAQTLQQSRGFGQN  769


 Score = 175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 133/228 (58%), Gaps = 2/228 (1%)

Query  208  INFSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISG  267
            + + ++GG +     + E +  P  +P LF    +KP  GIL+YG PGTGKTL+A A++ 
Sbjct  198  VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVAN  257

Query  268  ECGLKFISIKGPELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGV  327
            E G  F  I GPE+ SK  GESE  +R  F  A    P I+F DE D++A KR      V
Sbjct  258  ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEV  317

Query  328  KDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDI  387
            + R+V+QLLT +DG++    + V+ AT+RP+ IDPAL R GR    +   +PD   R ++
Sbjct  318  ERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEV  377

Query  388  LSVLTQKLKLNSDVNLTKIAQCTEMFTGADLLGLLCSA--QMLRQEYD  433
            L + T+ +KL+ DV+L +IA  +    GADL  L   A  Q +R++ D
Sbjct  378  LRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMD  425



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01090.1.1 transcription

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57Z60_TRYB2  unnamed protein product                                 30.4    0.55 


>Q57Z60_TRYB2 unnamed protein product
Length=4692

 Score = 30.4 bits (67),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 53/138 (38%), Gaps = 19/138 (14%)

Query  17    MYVPLNLGKTTSETDVPNRQTDTAKMNQATPPNNISPRPSVERNQFQSPNESGNDNAFR-  75
              + PL L     + DVP        + +AT    +S   + E NQ ++ +E    +A R 
Sbjct  3510  CFEPLALTLRWVQRDVPKTVEGPLSVLEATVQEILSTCEAAEGNQIENDSEGVTSSALRM  3569

Query  76    --VNLSQVRLQKETLE-------SKLTNQSNSSYPWYPPLLPP--------GFLAMTSQL  118
               VN +  RL  E L        S+L       Y     L PP         FL  T+  
Sbjct  3570  LCVNRTATRLLVEILSGVFPTTTSRLCGALQREYQ-KVKLCPPTEEKNEWLDFLCSTAAY  3628

Query  119   NESPHVNDSHEYNLSRRP  136
             NE+ + N+     L+R P
Sbjct  3629  NEALYTNNEQYKLLARTP  3646



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01100.1.1 Transcription

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUD1_DROME  unnamed protein product                                 169     5e-49
M9PFG6_DROME  unnamed protein product                                 170     5e-49
DICH_DROME  unnamed protein product                                   165     2e-47


>Q9VUD1_DROME unnamed protein product
Length=388

 Score = 169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%), Gaps = 0/83 (0%)

Query  22   DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLR  81
            DHIKRPMNAFMVWSR QRRK+AQDNPKMHNSEISKRLGAEWKLLTE +KRP+IDEAKRLR
Sbjct  119  DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLR  178

Query  82   AMHMKDHPDYKYRPRRKPKTLRK  104
            A+HMK+HPDYKYRPRRKPKTL K
Sbjct  179  ALHMKEHPDYKYRPRRKPKTLNK  201


>M9PFG6_DROME unnamed protein product
Length=407

 Score = 170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%), Gaps = 0/83 (0%)

Query  22   DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLR  81
            DHIKRPMNAFMVWSR QRRK+AQDNPKMHNSEISKRLGAEWKLLTE +KRP+IDEAKRLR
Sbjct  119  DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLR  178

Query  82   AMHMKDHPDYKYRPRRKPKTLRK  104
            A+HMK+HPDYKYRPRRKPKTL K
Sbjct  179  ALHMKEHPDYKYRPRRKPKTLNK  201


>DICH_DROME unnamed protein product
Length=382

 Score = 165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 78/80 (98%), Gaps = 0/80 (0%)

Query  21   DDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRL  80
            + HIKRPMNAFMVWSRLQRR+IA+DNPKMHNSEISKRLGAEWKLL E+EKRP+IDEAKRL
Sbjct  139  EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRL  198

Query  81   RAMHMKDHPDYKYRPRRKPK  100
            RA+HMK+HPDYKYRPRRKPK
Sbjct  199  RALHMKEHPDYKYRPRRKPK  218



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01110.1.1 protein

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389Q9_TRYB2  unnamed protein product                                 32.7    0.35 
SYFA_DROME  unnamed protein product                                   30.0    2.4  
Q38EM1_TRYB2  unnamed protein product                                 28.9    3.9  


>Q389Q9_TRYB2 unnamed protein product
Length=383

 Score = 32.7 bits (73),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 36/146 (25%), Positives = 60/146 (41%), Gaps = 35/146 (24%)

Query  153  RWRILADLINDVAMCVELMLPLFPQSCATRA---SIIQHQAAHSGNIGDIA--------A  201
            R R+  +  NDV    E+ L L+PQ C       +I+   A  + NI             
Sbjct  73   RQRLRGERDNDVQEAREVTLSLYPQGCRVSEYADAIVTSAAMLTSNIPSTVLERFASCRV  132

Query  202  KDGSQETCVNLTASLLGLVVLKLCTENTFLT--W---------------LLFIIFTGLHI  244
            KD +++ CV+++A  L   +++    ++F    W               L+ +   GL +
Sbjct  133  KDLNEKGCVSISADELASDLIERPVLDSFTPSRWWESDKTAPSSSLKDGLVAVKSIGLRV  192

Query  245  YSNYRAVRCLEFNTFN---RQRFIIL  267
                + V  L F T+N   R+RFI L
Sbjct  193  ----QPVEILIFYTYNGRPRRRFIPL  214


>SYFA_DROME unnamed protein product
Length=498

 Score = 30.0 bits (66),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  58   KIKIFFYQAFLPQGFPDTVSNDYIEYQLWD  87
            K++  F Q FL  GF +  +N+Y+E   W+
Sbjct  228  KVRTEFRQIFLEMGFSEMPTNNYVESSFWN  257


>Q38EM1_TRYB2 unnamed protein product
Length=193

 Score = 28.9 bits (63),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query  1   MSATH-SSNVKHTLHCNESYGTSNLKNSWKIVTDETNKVSFIAN  43
           +S +H S+N K  + C +  G   L++SW++  D+T+ V F+ +
Sbjct  56  LSISHGSNNNKIEVSCWDLGGQEQLRDSWRLYYDQTDAVIFVVD  99



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01120.1.1 Unknown

Length=135
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MMC6_DROME  unnamed protein product                                 28.5    2.0  
PBO4_CAEEL  unnamed protein product                                   27.3    5.1  
G5EEC8_CAEEL  unnamed protein product                                 26.9    6.5  


>Q8MMC6_DROME unnamed protein product
Length=506

 Score = 28.5 bits (62),  Expect = 2.0, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 25/45 (56%), Gaps = 1/45 (2%)

Query  87   EFKQTYFEEFYNKLIGSQQWDLSYLNHFQIDEWRYHDASVTVEKQ  131
            +FK T+FE+ Y +L GS    +  +N   +D++ Y   S+   +Q
Sbjct  406  DFKSTHFEQIYKEL-GSTDRRIFKINTDDVDDYEYMKVSILGGRQ  449


>PBO4_CAEEL unnamed protein product
Length=783

 Score = 27.3 bits (59),  Expect = 5.1, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 40/84 (48%), Gaps = 7/84 (8%)

Query  23   YRQWFILSK---KSKPSNAVSVLLNINADVKATLKAYCYAVFHDVKKNVSPSLSLFQK--  77
            +++ FI+S    +   S ++  +++ N DVK T+    YAV          ++ LF K  
Sbjct  461  FQEQFIMSYGGLRGAVSFSLVFMISANPDVKNTMLGATYAVILFTNIIQGSTIKLFVKWL  520

Query  78   EIKYENDEDEFKQTYFEEFYNKLI  101
             I+    ED F+   F EF N ++
Sbjct  521  NIRLAKKEDHFR--LFIEFNNGMV  542


>G5EEC8_CAEEL unnamed protein product
Length=512

 Score = 26.9 bits (58),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  67   NVSPSLSLFQKEIKYENDEDEFKQTYFEEFYNKL  100
             VS SLS    E+ Y +  +EFK  YF+ FY  L
Sbjct  455  TVSNSLSTSFSEVFYPDVIEEFKTDYFQPFYEDL  488



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01130.1.1 ATP

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTEF5_DROME  unnamed protein product                                  176     1e-48
Q57VA7_TRYB2  unnamed protein product                                 31.6    2.2  
Q8SYP8_DROME  unnamed protein product                                 31.2    2.7  


>MTEF5_DROME unnamed protein product
Length=560

 Score = 176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 138/501 (28%), Positives = 243/501 (49%), Gaps = 14/501 (3%)

Query  29   NSELIKKMLGYDDTNWNN--EENSFLNKYDRNNILDSYKLLKKFGYSDADIKSELRTLCL  86
            N+  + K LG    +W    E++  L    R ++L SY  LK   YS  DI ++   +  
Sbjct  55   NASYLSKTLGSSYRSWAAALEKHPELKTLKRKDLLSSYDTLKSLDYSVDDIIAKPMIIYY  114

Query  87   KPQTITSRYRMFIDYCFQKDLISPTLLRHFVKTMSLNIYQIKHKGYID---KYKDVLGHV  143
               T+ +R+ +  +  F    ++   L  +V  ++  I  +K   YI    K  + L   
Sbjct  115  GATTLANRHSVLQECGFHN--VTVQTLAKYVTVVNKPIEVLKAHNYIPFDVKVAERLAGY  172

Query  144  NK--KLNISVQSL-SEKMPLKRIHCEFSVHHLMSVLNISHEEAKYKFKRYPNLKSRSFKC  200
             K  KL + ++ L SE + LK +       +L   L +   + +  ++ Y  ++ +SF+ 
Sbjct  173  FKDIKLPVDLRELESETLTLKSLRQSLINAYLRERLQMDDNDLQKLWRVYTRIRHKSFRA  232

Query  201  IQENVHVLTKKVGFTHERIKKNAFLLHADKENLLSLLKKYPKMGSVDMKQIIQAYPILVL  260
            +Q+ + +LTK+  F+ ER++KN+FLL+++ +N+  +L++ P + S D+++I    P +++
Sbjct  233  VQDTIELLTKEFNFSAERLRKNSFLLYSEADNVRRILREVPTIDSQDIREIGFRRPKILM  292

Query  261  SPIRNIESVIQCVQKFGYTLEHLSKAPMILILKPTTVEQRLTQIHTEEWLQPYSGLPRTL  320
            S   +++  +Q V  FG + + + +   +L L P TV +RL  +   E  Q     PR L
Sbjct  293  STCDSLKQTLQHVHAFGISEDAVLRCLEVLTLGPDTVLERLRDLQEIEEFQVLGTNPRIL  352

Query  321  MLVLTLPSLEKRRAVLQDLNMKCISINVLACTKILFNAYVKHGRDKLNSEDAYLYLSNKL  380
             LV        R   L  L ++C S+++L+C    F  + + G D+    D  +YLSN L
Sbjct  353  RLVHYQNKARLRLDYLNQLRVRCASLHILSCGSEAFAKFARDGSDRTKGRDIVVYLSNVL  412

Query  381  NVPFEKITQKLQSHPYKRYVSIQQIHNSLTFLLG-KFSEDNIYNNLQLVLYPVNVIEAAL  439
                + +   L  HP   ++ +  +   L +L   KF  + I+ N+ L+LYP+  IE  +
Sbjct  413  GKDVQVLRNLLSRHPNWCHIPLLHVKQCLEYLRSKKFKLNEIFANIHLLLYPIKRIEEKM  472

Query  440  EKLTSGSDTSLDTTPCHDANGNIKEELILPLTLYVIEKQTNFTGYGIWEEEEDGEVEHNA  499
              L S         P  + +     E IL L LY+IE + +FTG GIW E+    VE+  
Sbjct  473  LLLQSPDAQEDLQLPVANFDSLSNNE-ILTLILYLIESEFHFTGDGIWTEQHTHHVENFN  531

Query  500  NL--DSPVSMLPIRKKKRKPS  518
            NL  D P S+  + K   KP+
Sbjct  532  NLLPDFPESLNKVYKYGVKPA  552


>Q57VA7_TRYB2 unnamed protein product
Length=753

 Score = 31.6 bits (70),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 4/56 (7%)

Query  3    STRVLSRIYWCRSLSTSNSLHSSA----ETNSELIKKMLGYDDTNWNNEENSFLNK  54
            S  V  R  WC S +        A    ET +E+       +  NW+ EEN FL K
Sbjct  610  SAAVRPRRVWCLSHTEQKKREEEARRVYETEAEVTVNQFQQELANWDREENKFLKK  665


>Q8SYP8_DROME unnamed protein product
Length=591

 Score = 31.2 bits (69),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 35/79 (44%), Gaps = 14/79 (18%)

Query  460  GNIKEELILPL-------TLYVIEKQTNFTGYG-------IWEEEEDGEVEHNANLDSPV  505
            G  +EEL +PL       T  V E +T+FTGY        +++ E    V    +   P 
Sbjct  464  GKQEEELPIPLAPLLADDTKGVNEDETHFTGYKTARSGSILYDTERRNRVTRRTDNKLPT  523

Query  506  SMLPIRKKKRKPSFRNLRR  524
            + L I+  K KP    LRR
Sbjct  524  NTLDIKSDKAKPHGNVLRR  542



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01140.1.1 Transmembrane

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NDN5_DROME  unnamed protein product                                 104     1e-22
A0A0U1QT59_DROME  unnamed protein product                             104     2e-22
TMC1_CAEEL  unnamed protein product                                   81.3    2e-15


>M9NDN5_DROME unnamed protein product
Length=1932

 Score = 104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  101  SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  145
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  129  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  183

Query  146  --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  187
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  184  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  240

Query  188  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  247
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  241  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  279

Query  248  YENSSRWASPEIDLDTAVGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  304
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  280  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  335

Query  305  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  364
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  336  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  395

Query  365  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  422
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  396  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  451

Query  423  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  478
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  452  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  508

Query  479  VFMFSLYSRLNCPRK  493
              MFS   ++N   K
Sbjct  509  SLMFSFIYKINSKEK  523


 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  504   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  554
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1130  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1189

Query  555   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  614
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1190  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1249

Query  615   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  673
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1250  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1309

Query  674   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  724
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1310  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1360


>A0A0U1QT59_DROME unnamed protein product
Length=2036

 Score = 104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  101  SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  145
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  233  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  287

Query  146  --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  187
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  288  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  344

Query  188  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  247
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  345  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  383

Query  248  YENSSRWASPEIDLDTAVGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  304
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  384  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  439

Query  305  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  364
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  440  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  499

Query  365  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  422
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  500  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  555

Query  423  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  478
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  556  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  612

Query  479  VFMFSLYSRLNCPRK  493
              MFS   ++N   K
Sbjct  613  SLMFSFIYKINSKEK  627


 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  504   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  554
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1234  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1293

Query  555   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  614
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1294  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1353

Query  615   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  673
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1354  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1413

Query  674   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  724
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1414  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1464


>TMC1_CAEEL unnamed protein product
Length=1285

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/336 (22%), Positives = 136/336 (40%), Gaps = 48/336 (14%)

Query  173  WEGSLSSLEAYTGTGVSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLC  232
            WE  +  +E++ G+ VSS F F +W++ VN+   L+     +L                 
Sbjct  152  WESKIKRIESHFGSVVSSYFTFLRWIVFVNIMITLIALVFVVLP----------------  195

Query  233  DDHNDTTSIECCAATYENSSRW----------ASPEIDLDTAVGLLTGAGWLEWTAFFYG  282
                     E  A +  N  R+          A+  +  D    +    G+L ++  FYG
Sbjct  196  ---------ETLADSVANEGRFNRTKTRKQIPANERVHADELAVVWHYDGYLRYSPLFYG  246

Query  283  TYARGNMKAILGDYNVSIGYLVSNFLFFLITFILICKNVTKTVR-HKIMERENGNYLYSN  341
             Y+          Y + + Y +     F  +F  I + +    R  K+   +   Y+++ 
Sbjct  247  YYSDDPFLGNKIKYALPLAYFMVTLTIFAYSFFAILRKMAANARMSKLSGSKAEQYIFNW  306

Query  342  LIFGGWDYCLQNEINAKMRQKAIFTQLKH-LLDLELSQSRGHRDKDNNLRVM--PIRFFI  398
             +F GWDY + N   A     A+  +L+  + D++       +D     R++   +R F 
Sbjct  307  KLFTGWDYTIGNSETASNTVMAVVIKLRESIADIK-------KDAHGKFRLLQFSLRVFA  359

Query  399  NVIVLALLVTSGYIVTLMLHVTYPWHI--LLSEYSVPLTIALLNRIVGFIFEKITLIENY  456
            N+I+ A+L  S Y +   +  +       L ++  VP  ++ +  +   IF+ I  +ENY
Sbjct  360  NIIICAMLGFSIYCIIFAVQKSQVQDDGNLFTKNQVPSVVSTITHVFPMIFDLIGKMENY  419

Query  457  NYFNVLRVTALRCLILRLTNLTVFMFSLYSRLNCPR  492
            +    LR    R LIL   N    +F+L+ ++   R
Sbjct  420  HPRTALRAHLGRVLILYTVNYITLIFALFEKMTALR  455


 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 82/159 (52%), Gaps = 13/159 (8%)

Query  503  NTPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLHCSS-----------LR  551
            N  +CWE+ +GQ+I KL+  D++  +     +   R    K+  CSS             
Sbjct  663  NNDICWETIIGQEIVKLVTMDLIFTILSILVIDLFRGLWIKY--CSSWWCWDIETTFPEY  720

Query  552  QEFLLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHY  611
             EF + ++ L ++  Q + +LG+F+AP LP +  + L IL Y++ +A +   VP   +  
Sbjct  721  GEFKVAENVLHIINNQGMIWLGLFFAPLLPAINNIKLIILMYIRGWAVMTCNVPAREIFR  780

Query  612  GFRCSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPF  650
              R S  ++ IL +  +L  LP+ + I  + PSRSCGPF
Sbjct  781  ASRSSNFYLGILLIWLLLCTLPVGFVIASMSPSRSCGPF  819



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01150.1.1 Cytochrome

Length=319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4E3_DROME  unnamed protein product                                  64.7    2e-11
C4D21_DROME  unnamed protein product                                  57.8    4e-09
CP4G1_DROME  unnamed protein product                                  53.9    7e-08


>CP4E3_DROME unnamed protein product
Length=526

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 131/331 (40%), Gaps = 44/331 (13%)

Query  20   THRKLFLHAWSIPGPLALPLLGNLVNFRTWKTALFKDYLSFYLRYG-GIYRIWAGHNLLV  78
            + R+  L  ++  GP  +P+LGN          +   +  ++  YG   +  W G++  +
Sbjct  24   SQRRQLLKEFN--GPTPVPILGNANRIGKNPAEILSTFFDWWYDYGKDNFLFWIGYSSHI  81

Query  79   VITDPDMAETLFNLKAEVFPKPVFFDFFSVMFGQSIFFQGDYSAWKKHRKVLNRVFQTGP  138
            V+T+P   E + N + ++  K   +D      G  +      S W KHRK++   F    
Sbjct  82   VMTNPKQLEYILNSQ-QLIQKSTIYDLLHPWLGHGLLTSFG-SKWHKHRKMITPSFHFN-  138

Query  139  MTKLIPHLHEKVLDYSERLVTVPCIQRVDEMLYPWQ-------CDVITHTLFGLKFKPTE  191
               ++   HE + + S + +T        + +  +Q        DVI  T  G+     E
Sbjct  139  ---ILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAME  195

Query  192  ---------IDLICY-VNKQFFKLFRESIKSVLTQIKCLERFTAFQSKKTILETVT----  237
                        +CY +N + F  F+ S +           F+A+Q     L+  T    
Sbjct  196  QRDSSIVQAFRDMCYNINMRAFHPFKRSNRV----FSLTPEFSAYQKTLKTLQDFTYDII  251

Query  238  KMGMVNFFVTGHSDHRDSTLDDIKLADLQEELG----------EAHLDELGLFNIAGIET  287
            +  +      G  +  D +L   K+A L   L           +   +E+  F   G +T
Sbjct  252  EKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDT  311

Query  288  LTTAFSAVIFLLSMHPEVQAKVYDELISIIG  318
             T+  S  ++LLS HP+VQ K+Y E   ++G
Sbjct  312  TTSGVSFSVYLLSRHPDVQRKLYREQCEVMG  342


>C4D21_DROME unnamed protein product
Length=511

 Score = 57.8 bits (138),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 71/324 (22%), Positives = 130/324 (40%), Gaps = 45/324 (14%)

Query  33   GPLALPLLGNLVNFRTWKTALF-KDYLSFYLRYGGIYRIWAGHNLLVVITDPDMAETLFN  91
            GP  +P++GN +   T +   F + +  ++ +YG  +R+W     L+   D    E++ +
Sbjct  35   GPFTIPIVGNGLQALTLRPENFIQRFGDYFNKYGKTFRLWILGECLIYTKDLKYFESILS  94

Query  92   LKAEVFPKPVFFDFFSVMFGQSIFFQGDYSAWKKHRKVLNRVFQTGPMTKLIPHLH----  147
              + +  K   + F     G  +      + W   RKVL   F    +   +  +     
Sbjct  95   -SSTLLKKAHLYRFLRDFLGDGLLLSTG-NKWTSRRKVLAPAFHFKCLENFVEIMDRNSG  152

Query  148  ---EKVLDYSERLVTVPCIQRVD-EMLYPWQCDVITHTLFGLKFKPT-------------  190
               EK+ +Y++    V   + V  E L     DV T T  G++                 
Sbjct  153  IMVEKLKNYADGKTCVDLFKFVSLEAL-----DVTTETAMGVQVNAQNEPNFPYTKALKS  207

Query  191  ----EIDLICYVNKQFFKLFRESI----KSVLTQIKCLERFT--AFQSKKTILETVTKMG  240
                E   +  V+ ++  LF  +     + +   I  ++ FT    + ++ ILE     G
Sbjct  208  VVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIAIMQDFTDKVIRERRAILERARADG  267

Query  241  MVNFFVTGHSD---HRDSTLDDIKLADLQEELGEAHLD---ELGLFNIAGIETLTTAFSA  294
                 + G  D       TL DI L    +    + +D   E+ +F  AG +T T+  S 
Sbjct  268  TYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIREEVDVFIFAGDDTTTSGVSH  327

Query  295  VIFLLSMHPEVQAKVYDELISIIG  318
             +  +S HP+VQ  +Y+EL+S++G
Sbjct  328  ALHAISRHPKVQECIYEELVSVLG  351


>CP4G1_DROME unnamed protein product
Length=556

 Score = 53.9 bits (128),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 75/371 (20%), Positives = 152/371 (41%), Gaps = 59/371 (16%)

Query  1    MILVFLTTVLAVYICKYYWTHRKLFLHAWSIPGPLALPLLGNL-VNFRTWKTALFKDYLS  59
            M+   + T++A+ + +Y+  + + +    +IP P  LP+LG   V        +    L 
Sbjct  27   MLTTLVGTLVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLG  86

Query  60   FYLRYGGIYRIWAGHNLLVVITDPDMAETLFNLKAEVFPKPVFFDFFSVMFGQSIFFQGD  119
            +  +YG   + W G+ LLV +T+P   E + +   +   K   + +F   FG  +     
Sbjct  87   YLNKYGETMKAWLGNVLLVFLTNPSDIELILS-GHQHLTKAEEYRYFKPWFGDGLLISNG  145

Query  120  YSAWKKHRKVLNRVFQTGPMTKLIPHLHEKVLDYSERLVTVPCIQR-----VDEMLYPWQ  174
            +  W+ HRK++   F    +   +P      +D+S+ +V    ++      V + +    
Sbjct  146  HH-WRHHRKMIAPTFHQSILKSFVPTF----VDHSKAVVARMGLEAGKSFDVHDYMSQTT  200

Query  175  CDVITHTLFGLKFKPTE----------IDLICYVNKQFFKL------------FRESIKS  212
             D++  T  G+K  P            +D+   ++K+  KL             RE    
Sbjct  201  VDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDR  260

Query  213  VLTQIKCL------ERFTAFQSK-KTILETVT----------KMGMVNFFVTGH-----S  250
            ++  I  +      +R   FQ + + I+E ++          K G+ +           +
Sbjct  261  MMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGA  320

Query  251  DHRDSTLDD-IKLADLQE-ELGEAH-LDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQA  307
              R + LD  +++A   + E  E   +DE+      G +T +   S  + ++ +H ++QA
Sbjct  321  KRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQA  380

Query  308  KVYDELISIIG  318
            KV+ E  +I G
Sbjct  381  KVFAEQKAIFG  391



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01160.1.1 Dystrophin,

Length=539
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DTN1_CAEEL  unnamed protein product                                   315     2e-100
DMDD_DROME  unnamed protein product                                   149     1e-37 
DMDB_DROME  unnamed protein product                                   149     1e-37 


>DTN1_CAEEL unnamed protein product
Length=590

 Score = 315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/469 (39%), Positives = 267/469 (57%), Gaps = 65/469 (14%)

Query  1    MCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDTLAQEIF  60
            +C+GKL+DKLRYIFSQ+ D NG +   KF ++LQ +L++  AV E+P+F +++    + F
Sbjct  160  LCAGKLVDKLRYIFSQIADSNGLMDHIKFTDFLQQILSLTTAVFEAPTFGFSENAVNQCF  219

Query  61   SGNGKVTVNDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRC  120
              + KV++N F+DT +S+P P C++WLPLLHR+ +V +  HP+ CDAC   +F GFRY+C
Sbjct  220  HKDEKVSLNVFLDTFLSDPCPPCIMWLPLLHRMASVSNVYHPVVCDACQVRSFTGFRYKC  279

Query  121  AKCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLRKSFRCVPEKAKAN-  179
             +C N+Q+CQ CFW GR S  H+ EHE+KEY++YKSP+KQ+ HS+ KS +C+P  +    
Sbjct  280  QRCANYQLCQSCFWRGRTSQNHSNEHEMKEYSSYKSPTKQLVHSIHKSLQCIPATSTVGD  339

Query  180  -NIPRF--------PEEPEKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSSMDSRSTSTA  230
             NI  F          +P + LNL++IVP +        P  +      +S     TS  
Sbjct  340  ANIDIFNAKIGGPVSSKPARPLNLNNIVPAT--------PTTIRRQHAATSSADWPTSPV  391

Query  231  RSPGRYNMGTLEASRLDDEHKLIARYAAKLAAENRSVGKAPSEGSLSLDTSRA--QRELV  288
              PG+ + G +    +DDEHKLIARYAAKL+         P     S+++S    +R L+
Sbjct  392  LLPGQASHGGV----IDDEHKLIARYAAKLSGR----ADYPLSNGRSMNSSMVGDERTLI  443

Query  289  SQLESKNREIMREIARLRRQQELEGVCASGFEDNPALMSELRALRMRKDELESHLASLQD  348
            +QLE +N  ++RE+ARL  Q   +                L  LR RK ELE  +  +Q 
Sbjct  444  AQLEEENSMMVREMARLESQTTSD--------------DGLAGLRDRKMELEEKMFEMQQ  489

Query  349  SRRHLMVQLEGLMRLLKTHQGTSPNSSPRGPK-SPPPASRSAPQTPSSSNDGEILCSGGG  407
             RR LM+QLE LM  L T           GP+ S   +S S  Q P +++D ++      
Sbjct  490  RRRELMMQLEHLMAQLNT-----------GPQPSGGVSSASLSQLPFTASDQQL------  532

Query  408  EGSNSSLA----SGGV-GRSLRNDLLVAADSVTNAMSTLVRELNSEASD  451
             G NS++A    +G +   SL+ DLL AAD +T  MS LVR+L+   SD
Sbjct  533  TGVNSTVANAFRAGSLPATSLQGDLLHAADQITTNMSDLVRQLDLAQSD  581


>DMDD_DROME unnamed protein product
Length=1854

 Score = 149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/407 (29%), Positives = 181/407 (44%), Gaps = 59/407 (14%)

Query  1     MCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------  54
             +C G L +K RY+F  + D +      +    L D + +P  + E  +F  ++       
Sbjct  1353  LCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRS  1412

Query  55    ------LAQEIFSGNGKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACD  106
                   ++QE   GN  +++    F+  +  EP    L+WLP+LHRL A E+  H   C+
Sbjct  1413  CLEQAGISQEAIDGNQDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCN  1470

Query  107   ACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLR  166
              C     VGFRYRC KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R
Sbjct  1471  ICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----R  1526

Query  167   KSFRCVPEKAKANNI----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSS  221
                R +  K K+       PR    P +  L    +  P+P P H      L N      
Sbjct  1527  DFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----D  1579

Query  222   MDSRSTSTARSPGRYNMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLS  277
             M SR    A    +   G   ++     DDEH+LIA+Y   L    N S  K+P +   +
Sbjct  1580  MHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAA  1639

Query  278   LDTSRAQRE----LVSQLESKNREIMREIARLRRQQE----------------LEGVCAS  317
             +D    QRE    ++  LE +N  +  E  +L  +++                + G+   
Sbjct  1640  MDAE--QREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQ  1697

Query  318   GFEDNPALMSELRALRMRKDELESHLASLQDSRRHLMVQLEGLMRLL  364
             G E    +M+E + LR  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1698  G-EQGQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1743


>DMDB_DROME unnamed protein product
Length=1669

 Score = 149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/407 (29%), Positives = 181/407 (44%), Gaps = 59/407 (14%)

Query  1     MCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------  54
             +C G L +K RY+F  + D +      +    L D + +P  + E  +F  ++       
Sbjct  1168  LCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRS  1227

Query  55    ------LAQEIFSGNGKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACD  106
                   ++QE   GN  +++    F+  +  EP    L+WLP+LHRL A E+  H   C+
Sbjct  1228  CLEQAGISQEAIDGNQDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCN  1285

Query  107   ACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLR  166
              C     VGFRYRC KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R
Sbjct  1286  ICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----R  1341

Query  167   KSFRCVPEKAKANNI----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSS  221
                R +  K K+       PR    P +  L    +  P+P P H      L N      
Sbjct  1342  DFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----D  1394

Query  222   MDSRSTSTARSPGRYNMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLS  277
             M SR    A    +   G   ++     DDEH+LIA+Y   L    N S  K+P +   +
Sbjct  1395  MHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAA  1454

Query  278   LDTSRAQRE----LVSQLESKNREIMREIARLRRQQE----------------LEGVCAS  317
             +D    QRE    ++  LE +N  +  E  +L  +++                + G+   
Sbjct  1455  MDAE--QREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQ  1512

Query  318   GFEDNPALMSELRALRMRKDELESHLASLQDSRRHLMVQLEGLMRLL  364
             G E    +M+E + LR  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1513  G-EQGQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1558



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01170.1.1 Unknown

Length=95
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBR1_CAEEL  unnamed protein product                                   26.2    6.3  


>UBR1_CAEEL unnamed protein product
Length=2058

 Score = 26.2 bits (56),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 23/39 (59%), Gaps = 4/39 (10%)

Query  31    LTNKNQMLQKSLEKFEKKFESI-KNMPWDYKYRRHGNKI  68
             L N N++   S E FE+  + + KNM    K+R+ GN++
Sbjct  1520  LINSNRICSSSFEGFEEPIKDLGKNM---MKFRKRGNEL  1555



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01180.1.1 Dystrophin,

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DTN1_CAEEL  unnamed protein product                                   408     4e-135
DMDD_DROME  unnamed protein product                                   191     6e-51 
DMDB_DROME  unnamed protein product                                   191     6e-51 


>DTN1_CAEEL unnamed protein product
Length=590

 Score = 408 bits (1049),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 238/597 (40%), Positives = 338/597 (57%), Gaps = 96/597 (16%)

Query  14   VNEHIAQLFQEMRCQNFDMIRFSSYRTACKLRFVQKKLYLHTIDIWNVIEAFRENGLNAI  73
            V   + QL  EMR Q+FD IRF++YR ACKLRF+Q+K  +H +DIWN+IEAFRENGLNA+
Sbjct  32   VASEMQQLIDEMRLQDFDSIRFATYRAACKLRFIQQKTKVHLVDIWNMIEAFRENGLNAL  91

Query  74   ELQS----------------------------DSHNFIQLYSDL---APNIESLGRIRVF  102
             L +                            D+   I L       A + ++ GR+ VF
Sbjct  92   PLHTVIKTSRAELLLTTVFHNLNKRLVASQHVDTDVSISLLLAFLLGAYDKQNTGRLTVF  151

Query  103  SIKVALATMCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYT  162
            SIKVALAT+C+GKL+DKLRYIFSQ+ D NG +   KF ++LQ +L++  AV E+P+F ++
Sbjct  152  SIKVALATLCAGKLVDKLRYIFSQIADSNGLMDHIKFTDFLQQILSLTTAVFEAPTFGFS  211

Query  163  DTLAQEIFSGNGKVTVNDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRAN  222
            +    + F  + KV++N F+DT +S+P P C++WLPLLHR+ +V +  HP+ CDAC   +
Sbjct  212  ENAVNQCFHKDEKVSLNVFLDTFLSDPCPPCIMWLPLLHRMASVSNVYHPVVCDACQVRS  271

Query  223  FVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLRKSFRCV  282
            F GFRY+C +C N+Q+CQ CFW GR S  H+ EHE+KEY++YKSP+KQ+ HS+ KS +C+
Sbjct  272  FTGFRYKCQRCANYQLCQSCFWRGRTSQNHSNEHEMKEYSSYKSPTKQLVHSIHKSLQCI  331

Query  283  PEKAKAN--NIPRF--------PEEPEKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSSM  332
            P  +     NI  F          +P + LNL++IVP +        P  +      +S 
Sbjct  332  PATSTVGDANIDIFNAKIGGPVSSKPARPLNLNNIVPAT--------PTTIRRQHAATSS  383

Query  333  DSRSTSTARSPGRYNMGTLEASRLDDEHKLIARYAAKLAAENRSVGKAPSEGSLSLDTSR  392
                TS    PG+ + G +    +DDEHKLIARYAAKL+         P     S+++S 
Sbjct  384  ADWPTSPVLLPGQASHGGV----IDDEHKLIARYAAKLSGR----ADYPLSNGRSMNSSM  435

Query  393  A--QRELVSQLESKNREIMREIARLRRQQELEGVCASGFEDNPALMSELRALRMRKDELE  450
               +R L++QLE +N  ++RE+ARL  Q   +                L  LR RK ELE
Sbjct  436  VGDERTLIAQLEEENSMMVREMARLESQTTSD--------------DGLAGLRDRKMELE  481

Query  451  SHLASLQDSRRHLMVQLEGLMRLLKTHQGTSPNSSPRGPK-SPPPASRSAPQTPSSSNDG  509
              +  +Q  RR LM+QLE LM  L T           GP+ S   +S S  Q P +++D 
Sbjct  482  EKMFEMQQRRRELMMQLEHLMAQLNT-----------GPQPSGGVSSASLSQLPFTASDQ  530

Query  510  EILCSGGGEGSNSSLA----SGGV-GRSLRNDLLVAADSVTNAMSTLVRELNSEASD  561
            ++       G NS++A    +G +   SL+ DLL AAD +T  MS LVR+L+   SD
Sbjct  531  QL------TGVNSTVANAFRAGSLPATSLQGDLLHAADQITTNMSDLVRQLDLAQSD  581


>DMDD_DROME unnamed protein product
Length=1854

 Score = 191 bits (485),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 154/512 (30%), Positives = 230/512 (45%), Gaps = 82/512 (16%)

Query  29    NFDMIRFSSYRTACKLRFVQKKLYLHTIDIWNVIEAFRENGLNA-----IELQSDSHNFI  83
             + + IRFS+YRTA KLR VQK+L L  I +    E+F  +GL A     I++   +    
Sbjct  1248  DLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLH  1307

Query  84    QLYS-----------DLAPN-------IESLGRIRVFSIKVALATMCSGKLMDKLRYIFS  125
              LY            DLA N        +  G+IRV S KV L  +C G L +K RY+F 
Sbjct  1308  SLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFR  1367

Query  126   QLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------------LAQEIFSGN  173
              + D +      +    L D + +P  + E  +F  ++             ++QE   GN
Sbjct  1368  LVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGN  1427

Query  174   GKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCA  231
               +++    F+  +  EP    L+WLP+LHRL A E+  H   C+ C     VGFRYRC 
Sbjct  1428  QDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCL  1485

Query  232   KCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLRKSFRCVPEKAKANNI  291
             KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R   R +  K K+   
Sbjct  1486  KCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----RDFTRALKNKFKSRKY  1541

Query  292   ----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSSMDSRSTSTARSPGRY  346
                 PR    P +  L    +  P+P P H      L N      M SR    A    + 
Sbjct  1542  FKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----DMHSRLEMYASRLAQV  1594

Query  347   NMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLSLDTSRAQRE----LV  398
               G   ++     DDEH+LIA+Y   L    N S  K+P +   ++D    QRE    ++
Sbjct  1595  EYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAE--QREELEAII  1652

Query  399   SQLESKNREIMREIARLRRQQE----------------LEGVCASGFEDNPALMSELRAL  442
               LE +N  +  E  +L  +++                + G+   G E    +M+E + L
Sbjct  1653  RDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQG-EQGQDMMAEAKLL  1711

Query  443   RMRKDELESHLASLQDSRRHLMVQLEGLMRLL  474
             R  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1712  RQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1743


>DMDB_DROME unnamed protein product
Length=1669

 Score = 191 bits (485),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 154/512 (30%), Positives = 230/512 (45%), Gaps = 82/512 (16%)

Query  29    NFDMIRFSSYRTACKLRFVQKKLYLHTIDIWNVIEAFRENGLNA-----IELQSDSHNFI  83
             + + IRFS+YRTA KLR VQK+L L  I +    E+F  +GL A     I++   +    
Sbjct  1063  DLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLH  1122

Query  84    QLYS-----------DLAPN-------IESLGRIRVFSIKVALATMCSGKLMDKLRYIFS  125
              LY            DLA N        +  G+IRV S KV L  +C G L +K RY+F 
Sbjct  1123  SLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFR  1182

Query  126   QLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDT------------LAQEIFSGN  173
              + D +      +    L D + +P  + E  +F  ++             ++QE   GN
Sbjct  1183  LVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGN  1242

Query  174   GKVTV--NDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCA  231
               +++    F+  +  EP    L+WLP+LHRL A E+  H   C+ C     VGFRYRC 
Sbjct  1243  QDISIELQHFLGWLQHEP--QSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCL  1300

Query  232   KCGNFQMCQECFWWGRVSGGHNLEHEVKEYTTYKSPSKQIGHSLRKSFRCVPEKAKANNI  291
             KC NF MCQ+CF++GR +  H L H + EY T  + ++ +    R   R +  K K+   
Sbjct  1301  KCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDV----RDFTRALKNKFKSRKY  1356

Query  292   ----PRFPEEP-EKTLNLSHIVPPSPLPSHNGFPDMLSNTFDVSSMDSRSTSTARSPGRY  346
                 PR    P +  L    +  P+P P H      L N      M SR    A    + 
Sbjct  1357  FKKHPRVGYLPVQSVLEGDALESPAPSPQHTTH--QLQN-----DMHSRLEMYASRLAQV  1409

Query  347   NMGTLEASRL---DDEHKLIARYAAKL-AAENRSVGKAPSEGSLSLDTSRAQRE----LV  398
               G   ++     DDEH+LIA+Y   L    N S  K+P +   ++D    QRE    ++
Sbjct  1410  EYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAE--QREELEAII  1467

Query  399   SQLESKNREIMREIARLRRQQE----------------LEGVCASGFEDNPALMSELRAL  442
               LE +N  +  E  +L  +++                + G+   G E    +M+E + L
Sbjct  1468  RDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQG-EQGQDMMAEAKLL  1526

Query  443   RMRKDELESHLASLQDSRRHLMVQLEGLMRLL  474
             R  K  LE+ +  L+D  R L  QL+ L +LL
Sbjct  1527  RQHKGRLEARMQILEDHNRQLEAQLQRLRQLL  1558



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01190.1.1 RNA-directed

Length=268
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RTXE_DROME  unnamed protein product                                   76.3    2e-15
RTBS_DROME  unnamed protein product                                   68.2    9e-13
Q54DH4_DICDI  unnamed protein product                                 35.4    0.048


>RTXE_DROME unnamed protein product
Length=908

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 101/220 (46%), Gaps = 3/220 (1%)

Query  29   LQAIQSEADTYNIPSEVSFTFEEVTEEKVGSAIL-GIKSLARGYDGIDIRMLKLSLPHIL  87
            LQ ++   D  N   ++          +V   I+    + A G+D I    LK      +
Sbjct  413  LQQVEETQDQLNQALQMDMPITPFEPCEVAEVIVRQSNNKAPGHDVICNATLKALPRQAI  472

Query  88   PAVTHVFNESLTSGVFPSSWCSAEVVPLNKVVSPA-SCGDYRPVAILPVLSKALERIATL  146
              +T VFN  +    FP  W    +  ++K   P      YRP+++LP +SK  ER+  +
Sbjct  473  LYITLVFNAIVRLQYFPYQWKLGIISMIHKPGKPEREPASYRPISLLPSISKVFERLIAV  532

Query  147  QMLQYIEYFNIMDPYQSGFRKQHSTATALVKVTDDIRLALDTRKVTVLVLLDMSKAFDSV  206
            +++  +E   I   +Q GFR  H T   L +V + I  A D+++    + LD+ +AFD V
Sbjct  533  RIVSIMEAQGITPEHQFGFRAGHCTVEQLHRVVEQILTAYDSKEYCNSLFLDIREAFDRV  592

Query  207  DFDVLLAMLGRMRFSSSALSWIESYLRGRRQRVKQHGQVA  246
             + + L +  +    +     ++SYL GRR  V+ H  ++
Sbjct  593  -WHIGLQLKIKQTLPAPYFGLLKSYLEGRRFAVRFHSAIS  631


>RTBS_DROME unnamed protein product
Length=906

 Score = 68.2 bits (165),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 108/226 (48%), Gaps = 7/226 (3%)

Query  33   QSEADTYNIPSEVSFTFEEVTEEKVGSAI--LGIKSLARGYDGIDIRMLKLSLPHILPAV  90
            Q   D+   P ++S   + +  E++  AI  L +K  + G D +    LK      +  +
Sbjct  418  QETLDSLETPLQMSLPIKPIRVEEIVEAIKSLPLKK-SPGIDNVCNATLKALPVRAILYL  476

Query  91   THVFNESLTSGVFPSSWCSAEVVPLNKVVSPASCGD-YRPVAILPVLSKALERIATLQML  149
              ++N  L    FP  W  A ++ ++K   P    + YRP+++L  LSK  ER+   ++ 
Sbjct  477  ALIYNAILRVQFFPKQWKMAAILMIHKPGKPEESPESYRPISLLSSLSKLWERLIANRLN  536

Query  150  QYIEYFNIMDPYQSGFRKQHSTATALVKVTDDIRLALDTRKVTVLVLLDMSKAFDSVDFD  209
              +    I+  +Q GFR+ HST   + ++T  I  A D ++    V +DM +AFD V  D
Sbjct  537  DIMTERRILPDHQFGFRQGHSTVEQVHRLTKHILQAFDDKEYCNAVFIDMQQAFDRVWHD  596

Query  210  VLLAMLGRMRFSSSALSWIESYLRGRR--QRVKQHGQVARATIGGL  253
             L++ + ++ F +     ++SYL  RR   RV+    + R    G+
Sbjct  597  GLISKVKKL-FPAPYYGVLKSYLEDRRFMVRVRNSYSIPRVMRAGV  641


>Q54DH4_DICDI unnamed protein product
Length=1264

 Score = 35.4 bits (80),  Expect = 0.048, Method: Composition-based stats.
 Identities = 36/180 (20%), Positives = 79/180 (44%), Gaps = 5/180 (3%)

Query  70   GYDGIDIRMLKLSLPHILPAVTHVFNESLTS-GVFPSSWCSAEVVPLNKVVSPASCGDYR  128
            G DG+        L  + P +T +FN+ L +     + +    +  + K  +P    + R
Sbjct  806  GPDGVTNAFYINHLNQVKPILTTLFNDILENPHHITTEFTEGLIHTIYKKGNPLLISNRR  865

Query  129  PVAILPVLSKALERIATLQMLQYIEYFNIMDPYQSGFRKQHSTATALVKVTDDIRLALDT  188
            P+ +L    K L ++   ++L+ + +  I++  Q+GF   H      +   +++   L +
Sbjct  866  PITLLNTDYKILSKVINARLLRILPF--IINNNQTGFVP-HRFIIDNIININELINYLKS  922

Query  189  RKVT-VLVLLDMSKAFDSVDFDVLLAMLGRMRFSSSALSWIESYLRGRRQRVKQHGQVAR  247
            + +  ++ L D  KAFDS+  D +   L  +      ++ I   L   + ++  +G+  R
Sbjct  923  KNLPGIITLFDFFKAFDSISHDSIKRTLIHIGIPIKLINLIHKLLSDSQAKISINGKTTR  982



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01200.1.1 Plant

Length=239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LAP4_DROME  unnamed protein product                                   86.3    4e-19
GEFL_DICDI  unnamed protein product                                   79.3    1e-16
FLII_DROME  unnamed protein product                                   79.0    1e-16


>LAP4_DROME unnamed protein product
Length=1851

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 102/205 (50%), Gaps = 4/205 (2%)

Query  10   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  69
            F   K   V+ L+       P +   L   L +L++ +N +   P  ++    LK L   
Sbjct  125  FSQLKNLTVLGLNDMSLTTLPADFGSLTQ-LESLELRENLLKHLPETISQLTKLKRLDLG  183

Query  70   QNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNL  129
             N+IE LP  +G L  L  +  + N ++ LP     L  L +L +S+N+L + P  +  L
Sbjct  184  DNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGL  243

Query  130  QHLDVLDLSFNRIESIPDGIGKM-KVIEMNLNKNQICHISPDISECVRLKILRLEENCLA  188
              L  LDL+ N +E++PDGI K+ ++  + L++N++  ++  +  C  ++ L L EN L+
Sbjct  244  VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLS  303

Query  189  INAIPTCILTSSNVCTLNVEGNLFE  213
               +P  I   + +  LNV+ N  E
Sbjct  304  --ELPASIGQMTKLNNLNVDRNALE  326


 Score = 75.1 bits (183),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 57/198 (29%), Positives = 91/198 (46%), Gaps = 26/198 (13%)

Query  40   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  99
            LR L +S N+I + P D+ +++ L  L   +N I  +P DI  L+ L+    + N I +L
Sbjct  62   LRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKL  121

Query  100  PLSFSKLHN-----------------------LKHLSLSQNQLNKFPTVLFNLQHLDVLD  136
            P  FS+L N                       L+ L L +N L   P  +  L  L  LD
Sbjct  122  PSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLD  181

Query  137  LSFNRIESIPDGIGKMKVI-EMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTC  195
            L  N IE +P  +G +  + E+ L+ NQ+  + P++    +L  L + EN L    +P  
Sbjct  182  LGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRL--EELPNE  239

Query  196  ILTSSNVCTLNVEGNLFE  213
            I    ++  L++  NL E
Sbjct  240  ISGLVSLTDLDLAQNLLE  257


 Score = 70.5 bits (171),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 84/172 (49%), Gaps = 24/172 (14%)

Query  15   KTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIE  74
            K   +++S    +E P+E++ L + L  LD++QN +   P  +A    L  L  DQN+++
Sbjct  222  KLTYLDVSENRLEELPNEISGLVS-LTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQ  280

Query  75   -----------------------SLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKH  111
                                    LP  IG + KL N++ + N ++ LPL   +  NL  
Sbjct  281  RLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGV  340

Query  112  LSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQ  163
            LSL  N+L K P  L N   L VLD+S N++  +P  +  +++  + L++NQ
Sbjct  341  LSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQ  392


 Score = 67.8 bits (164),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 79/173 (46%), Gaps = 1/173 (1%)

Query  14   KKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKI  73
            ++   ++  H    + P+E+      L  L +  N I   P +      L+ L    N+I
Sbjct  13   RQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEI  72

Query  74   ESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLD  133
              LP DI   E L  +  + N I ++P     L +L+    S N + K P+    L++L 
Sbjct  73   GRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLT  132

Query  134  VLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  185
            VL L+   + ++P   G +  +E + L +N + H+   IS+  +LK L L +N
Sbjct  133  VLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDN  185


>GEFL_DICDI unnamed protein product
Length=2356

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 90/168 (54%), Gaps = 7/168 (4%)

Query  40   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  99
            +R L + +N+ S FP  L   Q L +L F  N ++S+P  IG +  L+ +  + N ++ +
Sbjct  141  MRELYLDENQFSNFPSHLCELQKLTTLGFSNNLLKSIPTQIGQMIGLKKLILSGNQMESI  200

Query  100  PLSFSKLHNLKHLSLSQNQLNKFPTVLFN-LQHLDVLDLSFNRIESIPDGIGKMK-VIEM  157
            P+  S L +L HL  S N L+  P  L N L  L  L L  N++ SIPD IG+ + ++ +
Sbjct  201  PMEISNLKSLTHLDCSSNILSSIPNELGNKLSQLSFLFLQHNKLRSIPDEIGQCQSLVSL  260

Query  158  NLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTL  205
             LN N I  +   I E   L+ L L+EN L  N +P+ +    N C+L
Sbjct  261  RLNNNSITLLPQSIGELENLQELYLQENRL--NTLPSEL---GNCCSL  303


 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 92/176 (52%), Gaps = 6/176 (3%)

Query  38   AVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIK  97
              LR LD+S N++   P+ L S   ++ L  D+N+  + P  +  L+KL  +  + NL+K
Sbjct  116  TTLRLLDLSGNQLGTIPVRLFSLVSMRELYLDENQFSNFPSHLCELQKLTTLGFSNNLLK  175

Query  98   ELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEM  157
             +P    ++  LK L LS NQ+   P  + NL+ L  LD S N + SIP+ +G  K+ ++
Sbjct  176  SIPTQIGQMIGLKKLILSGNQMESIPMEISNLKSLTHLDCSSNILSSIPNELGN-KLSQL  234

Query  158  N---LNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGN  210
            +   L  N++  I  +I +C  L  LRL  N  +I  +P  I    N+  L ++ N
Sbjct  235  SFLFLQHNKLRSIPDEIGQCQSLVSLRLNNN--SITLLPQSIGELENLQELYLQEN  288


 Score = 63.5 bits (153),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 2/133 (2%)

Query  21   LSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLAS-YQLLKSLTFDQNKIESLPKD  79
            LS    +  P E++ LK+ L  LD S N +S  P +L +    L  L    NK+ S+P +
Sbjct  192  LSGNQMESIPMEISNLKS-LTHLDCSSNILSSIPNELGNKLSQLSFLFLQHNKLRSIPDE  250

Query  80   IGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSF  139
            IG  + L ++  N N I  LP S  +L NL+ L L +N+LN  P+ L N   L  L L F
Sbjct  251  IGQCQSLVSLRLNNNSITLLPQSIGELENLQELYLQENRLNTLPSELGNCCSLKKLYLEF  310

Query  140  NRIESIPDGIGKM  152
            N++ ++PD   ++
Sbjct  311  NKLIALPDRFKRL  323


 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (52%), Gaps = 1/106 (1%)

Query  21   LSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDI  80
            L H   +  PDE+ + ++++ +L ++ N I+  P  +   + L+ L   +N++ +LP ++
Sbjct  239  LQHNKLRSIPDEIGQCQSLV-SLRLNNNSITLLPQSIGELENLQELYLQENRLNTLPSEL  297

Query  81   GTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVL  126
            G    L+ +    N +  LP  F +LH L  LSL  N L+  P  L
Sbjct  298  GNCCSLKKLYLEFNKLIALPDRFKRLHCLNVLSLHDNLLDDLPNFL  343


 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 0/119 (0%)

Query  29   FPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLEN  88
             P+E+    + L  L +  NK+   P ++   Q L SL  + N I  LP+ IG LE L+ 
Sbjct  223  IPNELGNKLSQLSFLFLQHNKLRSIPDEIGQCQSLVSLRLNNNSITLLPQSIGELENLQE  282

Query  89   VSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPD  147
            +    N +  LP       +LK L L  N+L   P     L  L+VL L  N ++ +P+
Sbjct  283  LYLQENRLNTLPSELGNCCSLKKLYLEFNKLIALPDRFKRLHCLNVLSLHDNLLDDLPN  341


>FLII_DROME unnamed protein product
Length=1256

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 103/186 (55%), Gaps = 7/186 (4%)

Query  40   LRTLDISQNKISK-FPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKE  98
            +R +D ++N  S  FP  +     ++ LT D+ ++  +P+++G L+KLE++S N N +++
Sbjct  7    VRGVDFTKNDFSATFPSSMRQMSRVQWLTLDRTQLAEIPEELGHLQKLEHLSLNHNRLEK  66

Query  99   LPLSFSKLHNLKHLSLSQNQL--NKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMK-VI  155
            +    ++L  L+ L L  NQL  +  P  LF+L+ L  LDLS N+++ +P+G+ + K +I
Sbjct  67   IFGELTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKEVPEGLERAKNLI  126

Query  156  EMNLNKNQICHI-SPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEM  214
             +NL+ NQI  I +P       L  L L  N L    +P       N+ TL++  N  E+
Sbjct  127  VLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRL--ETLPPQTRRLINLKTLDLSHNPLEL  184

Query  215  KAFQQL  220
               +QL
Sbjct  185  FQLRQL  190


 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 4/209 (2%)

Query  10   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  69
             E AK   V+NLS+   +  P  +      L  LD+S N++   P        LK+L   
Sbjct  119  LERAKNLIVLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRLETLPPQTRRLINLKTLDLS  178

Query  70   QNKIESLP-KDIGTLEKLE--NVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVL  126
             N +E    + + +L+ LE   +SG    +   P S   L NL  L LS N L K P  +
Sbjct  179  HNPLELFQLRQLPSLQSLEVLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCV  238

Query  127  FNLQHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  185
            +N+  L  L+LS N +  +  G+   + +E +NL++NQ+  +   + +  +L+ L + +N
Sbjct  239  YNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDN  298

Query  186  CLAINAIPTCILTSSNVCTLNVEGNLFEM  214
             L    IP+ I     +   +   NL EM
Sbjct  299  KLNFEGIPSGIGKLGALEVFSAANNLLEM  327


 Score = 53.9 bits (128),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 67/146 (46%), Gaps = 24/146 (16%)

Query  19   INLSHQGFKEFPD----------------EMNELKA------VLRTLDISQNKISKFPLD  56
            ++LSH    + PD                E+ EL A       L +L++S+N++   P  
Sbjct  224  LDLSHNSLPKLPDCVYNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAA  283

Query  57   LASYQLLKSLTFDQNKI--ESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSL  114
            L     L+ L  + NK+  E +P  IG L  LE  S   NL++ +P    +   LK L+L
Sbjct  284  LCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALEVFSAANNLLEMVPEGLCRCGALKQLNL  343

Query  115  SQNQLNKFPTVLFNLQHLDVLDLSFN  140
            S N+L   P  +  L+ LD LDL  N
Sbjct  344  SCNRLITLPDAIHLLEGLDQLDLRNN  369


 Score = 48.9 bits (115),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 77/145 (53%), Gaps = 5/145 (3%)

Query  29   FPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLEN  88
            FP  ++ L A L  LD+S N + K P  + +   L  L    N++  L   +   ++LE+
Sbjct  211  FPTSIDSL-ANLCELDLSHNSLPKLPDCVYNVVTLVRLNLSDNELTELTAGVELWQRLES  269

Query  89   VSGNCNLIKELPLSFSKLHNLKHLSLSQNQLN--KFPTVLFNLQHLDVLDLSFNRIESIP  146
            ++ + N +  LP +  KL  L+ L ++ N+LN    P+ +  L  L+V   + N +E +P
Sbjct  270  LNLSRNQLVALPAALCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALEVFSAANNLLEMVP  329

Query  147  DGIGKMKVI-EMNLNKNQICHISPD  170
            +G+ +   + ++NL+ N++  + PD
Sbjct  330  EGLCRCGALKQLNLSCNRLITL-PD  353



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01210.1.1 MAD2L1-binding

Length=315


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01220.1.1 Plant

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LAP4_DROME  unnamed protein product                                   87.0    3e-19
GEFL_DICDI  unnamed protein product                                   79.3    1e-16
FLII_DROME  unnamed protein product                                   78.2    3e-16


>LAP4_DROME unnamed protein product
Length=1851

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 102/205 (50%), Gaps = 4/205 (2%)

Query  19   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  78
            F   K   V+ L+       P +   L   L +L++ +N +   P  ++    LK L   
Sbjct  125  FSQLKNLTVLGLNDMSLTTLPADFGSLTQ-LESLELRENLLKHLPETISQLTKLKRLDLG  183

Query  79   QNKIESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNL  138
             N+IE LP  +G L  L  +  + N ++ LP     L  L +L +S+N+L + P  +  L
Sbjct  184  DNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGL  243

Query  139  QHLDVLDLSFNRIESIPDGIGKM-KVIEMNLNKNQICHISPDISECVRLKILRLEENCLA  197
              L  LDL+ N +E++PDGI K+ ++  + L++N++  ++  +  C  ++ L L EN L+
Sbjct  244  VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLS  303

Query  198  INAIPTCILTSSNVCTLNVEGNLFE  222
               +P  I   + +  LNV+ N  E
Sbjct  304  --ELPASIGQMTKLNNLNVDRNALE  326


 Score = 75.9 bits (185),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 57/198 (29%), Positives = 91/198 (46%), Gaps = 26/198 (13%)

Query  49   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  108
            LR L +S N+I + P D+ +++ L  L   +N I  +P DI  L+ L+    + N I +L
Sbjct  62   LRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKL  121

Query  109  PLSFSKLHN-----------------------LKHLSLSQNQLNKFPTVLFNLQHLDVLD  145
            P  FS+L N                       L+ L L +N L   P  +  L  L  LD
Sbjct  122  PSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLD  181

Query  146  LSFNRIESIPDGIGKMKVI-EMNLNKNQICHISPDISECVRLKILRLEENCLAINAIPTC  204
            L  N IE +P  +G +  + E+ L+ NQ+  + P++    +L  L + EN L    +P  
Sbjct  182  LGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRL--EELPNE  239

Query  205  ILTSSNVCTLNVEGNLFE  222
            I    ++  L++  NL E
Sbjct  240  ISGLVSLTDLDLAQNLLE  257


 Score = 71.2 bits (173),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 84/172 (49%), Gaps = 24/172 (14%)

Query  24   KTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIE  83
            K   +++S    +E P+E++ L + L  LD++QN +   P  +A    L  L  DQN+++
Sbjct  222  KLTYLDVSENRLEELPNEISGLVS-LTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQ  280

Query  84   -----------------------SLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKH  120
                                    LP  IG + KL N++ + N ++ LPL   +  NL  
Sbjct  281  RLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGV  340

Query  121  LSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEMNLNKNQ  172
            LSL  N+L K P  L N   L VLD+S N++  +P  +  +++  + L++NQ
Sbjct  341  LSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQ  392


 Score = 68.6 bits (166),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 79/173 (46%), Gaps = 1/173 (1%)

Query  23   KKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKI  82
            ++   ++  H    + P+E+      L  L +  N I   P +      L+ L    N+I
Sbjct  13   RQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEI  72

Query  83   ESLPKDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLD  142
              LP DI   E L  +  + N I ++P     L +L+    S N + K P+    L++L 
Sbjct  73   GRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLT  132

Query  143  VLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  194
            VL L+   + ++P   G +  +E + L +N + H+   IS+  +LK L L +N
Sbjct  133  VLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDN  185


>GEFL_DICDI unnamed protein product
Length=2356

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 90/168 (54%), Gaps = 7/168 (4%)

Query  49   LRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKEL  108
            +R L + +N+ S FP  L   Q L +L F  N ++S+P  IG +  L+ +  + N ++ +
Sbjct  141  MRELYLDENQFSNFPSHLCELQKLTTLGFSNNLLKSIPTQIGQMIGLKKLILSGNQMESI  200

Query  109  PLSFSKLHNLKHLSLSQNQLNKFPTVLFN-LQHLDVLDLSFNRIESIPDGIGKMK-VIEM  166
            P+  S L +L HL  S N L+  P  L N L  L  L L  N++ SIPD IG+ + ++ +
Sbjct  201  PMEISNLKSLTHLDCSSNILSSIPNELGNKLSQLSFLFLQHNKLRSIPDEIGQCQSLVSL  260

Query  167  NLNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTL  214
             LN N I  +   I E   L+ L L+EN L  N +P+ +    N C+L
Sbjct  261  RLNNNSITLLPQSIGELENLQELYLQENRL--NTLPSEL---GNCCSL  303


 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 92/176 (52%), Gaps = 6/176 (3%)

Query  47   AVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIK  106
              LR LD+S N++   P+ L S   ++ L  D+N+  + P  +  L+KL  +  + NL+K
Sbjct  116  TTLRLLDLSGNQLGTIPVRLFSLVSMRELYLDENQFSNFPSHLCELQKLTTLGFSNNLLK  175

Query  107  ELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVIEM  166
             +P    ++  LK L LS NQ+   P  + NL+ L  LD S N + SIP+ +G  K+ ++
Sbjct  176  SIPTQIGQMIGLKKLILSGNQMESIPMEISNLKSLTHLDCSSNILSSIPNELGN-KLSQL  234

Query  167  N---LNKNQICHISPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGN  219
            +   L  N++  I  +I +C  L  LRL  N  +I  +P  I    N+  L ++ N
Sbjct  235  SFLFLQHNKLRSIPDEIGQCQSLVSLRLNNN--SITLLPQSIGELENLQELYLQEN  288


 Score = 63.5 bits (153),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 73/135 (54%), Gaps = 6/135 (4%)

Query  30   LSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTF---DQNKIESLP  86
            LS    +  P E++ LK+ L  LD S N +S  P +L +   L  L+F     NK+ S+P
Sbjct  192  LSGNQMESIPMEISNLKS-LTHLDCSSNILSSIPNELGNK--LSQLSFLFLQHNKLRSIP  248

Query  87   KDIGTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDL  146
             +IG  + L ++  N N I  LP S  +L NL+ L L +N+LN  P+ L N   L  L L
Sbjct  249  DEIGQCQSLVSLRLNNNSITLLPQSIGELENLQELYLQENRLNTLPSELGNCCSLKKLYL  308

Query  147  SFNRIESIPDGIGKM  161
             FN++ ++PD   ++
Sbjct  309  EFNKLIALPDRFKRL  323


 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (52%), Gaps = 1/106 (1%)

Query  30   LSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDI  89
            L H   +  PDE+ + ++++ +L ++ N I+  P  +   + L+ L   +N++ +LP ++
Sbjct  239  LQHNKLRSIPDEIGQCQSLV-SLRLNNNSITLLPQSIGELENLQELYLQENRLNTLPSEL  297

Query  90   GTLEKLENVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVL  135
            G    L+ +    N +  LP  F +LH L  LSL  N L+  P  L
Sbjct  298  GNCCSLKKLYLEFNKLIALPDRFKRLHCLNVLSLHDNLLDDLPNFL  343


 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 0/119 (0%)

Query  38   FPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLEN  97
             P+E+    + L  L +  NK+   P ++   Q L SL  + N I  LP+ IG LE L+ 
Sbjct  223  IPNELGNKLSQLSFLFLQHNKLRSIPDEIGQCQSLVSLRLNNNSITLLPQSIGELENLQE  282

Query  98   VSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPD  156
            +    N +  LP       +LK L L  N+L   P     L  L+VL L  N ++ +P+
Sbjct  283  LYLQENRLNTLPSELGNCCSLKKLYLEFNKLIALPDRFKRLHCLNVLSLHDNLLDDLPN  341


>FLII_DROME unnamed protein product
Length=1256

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 103/186 (55%), Gaps = 7/186 (4%)

Query  49   LRTLDISQNKISK-FPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLIKE  107
            +R +D ++N  S  FP  +     ++ LT D+ ++  +P+++G L+KLE++S N N +++
Sbjct  7    VRGVDFTKNDFSATFPSSMRQMSRVQWLTLDRTQLAEIPEELGHLQKLEHLSLNHNRLEK  66

Query  108  LPLSFSKLHNLKHLSLSQNQL--NKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMK-VI  164
            +    ++L  L+ L L  NQL  +  P  LF+L+ L  LDLS N+++ +P+G+ + K +I
Sbjct  67   IFGELTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKEVPEGLERAKNLI  126

Query  165  EMNLNKNQICHI-SPDISECVRLKILRLEENCLAINAIPTCILTSSNVCTLNVEGNLFEM  223
             +NL+ NQI  I +P       L  L L  N L    +P       N+ TL++  N  E+
Sbjct  127  VLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRL--ETLPPQTRRLINLKTLDLSHNPLEL  184

Query  224  KAFQQL  229
               +QL
Sbjct  185  FQLRQL  190


 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 4/209 (2%)

Query  19   FETAKKTGVINLSHQGFKEFPDEMNELKAVLRTLDISQNKISKFPLDLASYQLLKSLTFD  78
             E AK   V+NLS+   +  P  +      L  LD+S N++   P        LK+L   
Sbjct  119  LERAKNLIVLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRLETLPPQTRRLINLKTLDLS  178

Query  79   QNKIESLP-KDIGTLEKLE--NVSGNCNLIKELPLSFSKLHNLKHLSLSQNQLNKFPTVL  135
             N +E    + + +L+ LE   +SG    +   P S   L NL  L LS N L K P  +
Sbjct  179  HNPLELFQLRQLPSLQSLEVLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCV  238

Query  136  FNLQHLDVLDLSFNRIESIPDGIGKMKVIE-MNLNKNQICHISPDISECVRLKILRLEEN  194
            +N+  L  L+LS N +  +  G+   + +E +NL++NQ+  +   + +  +L+ L + +N
Sbjct  239  YNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDN  298

Query  195  CLAINAIPTCILTSSNVCTLNVEGNLFEM  223
             L    IP+ I     +   +   NL EM
Sbjct  299  KLNFEGIPSGIGKLGALEVFSAANNLLEM  327


 Score = 54.3 bits (129),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 94/187 (50%), Gaps = 9/187 (5%)

Query  7    VLKM-GNSATKRHFETAKKTGV----INLSHQGFKEFPDEMNELKAVLRTLDISQNKISK  61
            VLKM G   T  +F T+  +      ++LSH    + PD +  +  ++R L++S N++++
Sbjct  198  VLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCVYNVVTLVR-LNLSDNELTE  256

Query  62   FPLDLASYQLLKSLTFDQNKIESLPKDIGTLEKLENVSGNCNLI--KELPLSFSKLHNLK  119
                +  +Q L+SL   +N++ +LP  +  L KL  +  N N +  + +P    KL  L+
Sbjct  257  LTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALE  316

Query  120  HLSLSQNQLNKFPTVLFNLQHLDVLDLSFNRIESIPDGIGKMKVI-EMNLNKNQICHISP  178
              S + N L   P  L     L  L+LS NR+ ++PD I  ++ + +++L  N    + P
Sbjct  317  VFSAANNLLEMVPEGLCRCGALKQLNLSCNRLITLPDAIHLLEGLDQLDLRNNPELVMPP  376

Query  179  DISECVR  185
              SE  +
Sbjct  377  KPSEASK  383



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01230.1.1 Unknown

Length=164


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01240.1.1 MAD2L1-binding

Length=315


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01250.1.1 Unknown

Length=89
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U1E8_LEIMA  unnamed protein product                                 30.4    0.12 
Q9VFA2_DROME  unnamed protein product                                 27.7    1.2  
Q38D56_TRYB2  unnamed protein product                                 25.8    5.5  


>Q9U1E8_LEIMA unnamed protein product
Length=376

 Score = 30.4 bits (67),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 45/108 (42%), Gaps = 27/108 (25%)

Query  4    FRVPEVVVSPSSMALSE-PILDYPAHHSTGGASINERRG-----SRTGGS-MFL------  50
            FR PEV+  PS + L E P      + S     I+ RR        +GGS MFL      
Sbjct  255  FRCPEVLFKPSLIGLDEAPGFPEMVYQSINKCDIDVRRELYGNIVLSGGSTMFLNLPERL  314

Query  51   ------------APYCQLAPRRRHS-WIGGT-STSVTIFYSSISQASE  84
                         P     P R++S WIGG+  +S+T F +   + SE
Sbjct  315  AKEISNLAPSSIKPKVVAPPERKYSVWIGGSILSSLTTFQTMWVKKSE  362


>Q9VFA2_DROME unnamed protein product
Length=366

 Score = 27.7 bits (60),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 24/49 (49%), Gaps = 3/49 (6%)

Query  16   MALSEPILDYPAHHSTGGASINERRGSRTGGSMFLAPYCQLAPRRRHSW  64
            + L   I+D PA  S+    I +   +  GG++F    C++ PR +  W
Sbjct  286  IGLGMLIVDVPAAWSSKTLPIVQ---ALAGGTLFYVTVCEVIPREKARW  331


>Q38D56_TRYB2 unnamed protein product
Length=339

 Score = 25.8 bits (55),  Expect = 5.5, Method: Composition-based stats.
 Identities = 14/43 (33%), Positives = 21/43 (49%), Gaps = 0/43 (0%)

Query  19  SEPILDYPAHHSTGGASINERRGSRTGGSMFLAPYCQLAPRRR  61
           +E   DY   HS+G A +N    +R G +   AP  +  P +R
Sbjct  16  AEEFYDYVRAHSSGDAVVNALLITRPGDNGAAAPGIRKGPAKR  58



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01260.1.1 Unknown

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABCC8_DICDI  unnamed protein product                                  29.6    0.49 
Q9U1E8_LEIMA  unnamed protein product                                 26.9    3.0  
Q9VFA2_DROME  unnamed protein product                                 26.9    3.2  


>ABCC8_DICDI unnamed protein product
Length=1593

 Score = 29.6 bits (65),  Expect = 0.49, Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 33/68 (49%), Gaps = 2/68 (3%)

Query  2     SLVFKSKIGDKKMSEFRVPEVVVSPSSMALSEPILDYPAHHSTGGASINERRGSRTGGSM  61
             S+VF S  G K   E     V++SP S   + PI       S    +I+E   +RT G M
Sbjct  1088  SMVFGSIKGSKLFHEKMFKAVILSPMSFFDTTPIGRILNRFSKDQLTIDESI-ARTLG-M  1145

Query  62    FLAPYCQL  69
             FL  +CQ+
Sbjct  1146  FLNTFCQV  1153


>Q9U1E8_LEIMA unnamed protein product
Length=376

 Score = 26.9 bits (58),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 35/90 (39%), Gaps = 26/90 (29%)

Query  17   FRVPEVVVSPSSMALSE-PILDYPAHHSTGGASINERR---GSRT---GGSMFL------  63
            FR PEV+  PS + L E P      + S     I+ RR   G+     G +MFL      
Sbjct  255  FRCPEVLFKPSLIGLDEAPGFPEMVYQSINKCDIDVRRELYGNIVLSGGSTMFLNLPERL  314

Query  64   ------------APYCQLAPRRRHS-WIGG  80
                         P     P R++S WIGG
Sbjct  315  AKEISNLAPSSIKPKVVAPPERKYSVWIGG  344


>Q9VFA2_DROME unnamed protein product
Length=366

 Score = 26.9 bits (58),  Expect = 3.2, Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 3/43 (7%)

Query  35   ILDYPAHHSTGGASINERRGSRTGGSMFLAPYCQLAPRRRHSW  77
            I+D PA  S+    I +   +  GG++F    C++ PR +  W
Sbjct  292  IVDVPAAWSSKTLPIVQ---ALAGGTLFYVTVCEVIPREKARW  331



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01270.1.1 Unknown

Length=148


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01280.1.1 Unknown

Length=72
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNU2_DROME  unnamed protein product                                 31.6    0.028
Q57WQ2_TRYB2  unnamed protein product                                 28.5    0.38 
Q388F0_TRYB2  unnamed protein product                                 24.6    8.8  


>Q9VNU2_DROME unnamed protein product
Length=334

 Score = 31.6 bits (70),  Expect = 0.028, Method: Composition-based stats.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  21   HGVAPRTDSKTSCFSLESTSLWADSYHQNINN  52
            HG  PR D  +SC  L++  L+ + +H   NN
Sbjct  96   HGCQPRLDDGSSCSDLQNAELYVEQFHCTNNN  127


>Q57WQ2_TRYB2 unnamed protein product
Length=402

 Score = 28.5 bits (62),  Expect = 0.38, Method: Composition-based stats.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  3    VGKTSAIEFRLPNLQELTHGVAPRTDSKTSCFSLEST  39
            VG  S+  FR+P L+ L   +    D+ T C + EST
Sbjct  127  VGNRSSGIFRVPVLEALRKEIGLTVDNSTPCLNSEST  163


>Q388F0_TRYB2 unnamed protein product
Length=466

 Score = 24.6 bits (52),  Expect = 8.8, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  11  FRLPNLQELTHGVAPRTDSKTSC  33
           +R+P   E+ H V P T S  SC
Sbjct  50  YRVPCCCEVAHDVCPATASDHSC  72



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01290.1.1 dentin

Length=143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VPS41_CAEEL  unnamed protein product                                  28.1    2.9  
Q9VVC6_DROME  unnamed protein product                                 27.3    5.1  


>VPS41_CAEEL unnamed protein product
Length=901

 Score = 28.1 bits (61),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 0/37 (0%)

Query  39  DETVPIIKQESLESLDNGKSKLLIQTKRGYSYQEDHH  75
           +ET+P +K  +  S+D     + I T  G  Y  DHH
Sbjct  49  EETLPFMKTATFTSIDLHDKFIAIGTATGLIYILDHH  85


>Q9VVC6_DROME unnamed protein product
Length=2029

 Score = 27.3 bits (59),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  55   NGKSKLLIQTKRGYSYQEDHHDTRRNS  81
             G+ K   +T  G SY + HH +RR S
Sbjct  333  GGRRKYSFKTHAGKSYHQHHHPSRRTS  359



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01300.1.1 cAMP-specific

Length=217


***** No hits found *****



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01310.1.1 Metallo-beta-lactamase

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C0H490_PLAF7  unnamed protein product                                 47.4    2e-06
Q8IPU3_DROME  unnamed protein product                                 40.0    6e-04
Q9VPB3_DROME  unnamed protein product                                 39.3    0.001


>C0H490_PLAF7 unnamed protein product
Length=263

 Score = 47.4 bits (111),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 79/173 (46%), Gaps = 43/173 (25%)

Query  45   LDTGEPDHMEYIENLKQVLNKESISLEHIVLSHWHNDHVGG---LKDIFKHINPDSATIW  101
            +D  EPD +     LK++    ++ LE+++ +H H DH GG   ++++ ++I        
Sbjct  32   IDPVEPDKV-----LKRI-ETANVELEYVLCTHHHYDHSGGNIRMRELKQNI--------  77

Query  102  KFKGTEKDEAQATDFVPENKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHI---VLKLEE  158
                    +   + + P     + + DGQ++++    ++ IH P HT  HI   V K +E
Sbjct  78   --------KVVGSAYEPTPGVNEKVYDGQIIRLGELNIKAIHAPCHTKGHILYYVYKTDE  129

Query  159  EN--------VVFSGDTILGEGTTVF-----SDLISYIESLRRIRSLKPDIIY  198
                      ++F+GDT+   G   F      D+   IE ++ +R  K  +IY
Sbjct  130  AKQEDHKYKPILFTGDTLFIAGCGRFFEGSAKDMFKNIEKVKNMR--KETLIY  180


>Q8IPU3_DROME unnamed protein product
Length=348

 Score = 40.0 bits (92),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 20/122 (16%)

Query  61   QVLNKESISLEHIVLSHWHNDHVGGLKDIFKHINPDSATIWKFKGTEKDEAQATDFVPE-  119
            + + ++ ++L  ++ +H H DH GG + + K        +W+    E D     D +   
Sbjct  127  KTVQEQQLTLSKVLTTHHHWDHAGGNEKLLK--------LWE---KELDVYGGDDRIGAL  175

Query  120  NKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEE-----ENVVFSGDTILGEGTT  174
            NK VQ         + G  ++ + TP HTT HI   +       E  VF+GDT+   G  
Sbjct  176  NKKVQ---QDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCG  232

Query  175  VF  176
             F
Sbjct  233  RF  234


>Q9VPB3_DROME unnamed protein product
Length=305

 Score = 39.3 bits (90),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 20/122 (16%)

Query  61   QVLNKESISLEHIVLSHWHNDHVGGLKDIFKHINPDSATIWKFKGTEKDEAQATDFVPE-  119
            + + ++ ++L  ++ +H H DH GG + + K        +W+    E D     D +   
Sbjct  84   KTVQEQQLTLSKVLTTHHHWDHAGGNEKLLK--------LWE---KELDVYGGDDRIGAL  132

Query  120  NKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEE-----ENVVFSGDTILGEGTT  174
            NK VQ         + G  ++ + TP HTT HI   +       E  VF+GDT+   G  
Sbjct  133  NKKVQ---QDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCG  189

Query  175  VF  176
             F
Sbjct  190  RF  191



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01320.1.1 Mitotic

Length=222
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRQ2_DROME  unnamed protein product                                 215     4e-71
Q9NGT3_CAEEL  unnamed protein product                                 201     2e-65
MD2L1_DICDI  unnamed protein product                                  186     1e-59


>Q9VRQ2_DROME unnamed protein product
Length=207

 Score = 215 bits (548),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 145/218 (67%), Gaps = 14/218 (6%)

Query  1    MATTQKTENAITLKGSAKLVTDYLSLGINSILFQRGIYPPESFKSEQHFGLTIYVATDKE  60
            M+T Q T+N ITLKGSA+++ +YL  GINSILFQRGIYP E F + Q +GLTI ++ D +
Sbjct  1    MSTAQATKNCITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPK  60

Query  61   IQDFINRILGQIKDWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNT  120
            I+ F+  +L Q ++WL +  + K+S++I+N +TKEVLE WDF +Q          A +  
Sbjct  61   IKTFLQNVLSQTEEWLSKNMINKISMVITNAHTKEVLECWDFNMQ----------AELGD  110

Query  121  ASKTDSTNAEKDKIGNKDIKVIQKEIRDVLRQICSTVSFLPLLDAPCAFDCLIFTNFDTS  180
               +D T A       K++  IQ EIRDV+RQI +TVS+LPLLD  C FD +I T  +T 
Sbjct  111  GDISDPTKATT----TKELSRIQNEIRDVMRQISATVSYLPLLDCICTFDIMIHTLQNTE  166

Query  181  VPENWVETEPVFIANSQEVQLRSFSTSLHKMDTVVSYK  218
            +P  W ET  + I N Q VQLRSFST LHK+DTVV+YK
Sbjct  167  LPAKWDETGAIVIQNPQAVQLRSFSTGLHKVDTVVNYK  204


>Q9NGT3_CAEEL unnamed protein product
Length=203

 Score = 201 bits (510),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 148/215 (69%), Gaps = 17/215 (8%)

Query  6    KTENAITLKGSAKLVTDYLSLGINSILFQRGIYPPESFKSEQHFGLTIYVATDKEIQDFI  65
            KT+NAI+LKGSA+LV ++   G+NSIL+QR +YP +SFK E+ +GLT++VA +K++Q F+
Sbjct  5    KTQNAISLKGSAQLVKEFFHFGLNSILYQRALYPSDSFKREKKYGLTLWVAHEKKLQAFM  64

Query  66   NRILGQIKDWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNTASKTD  125
            + +L Q++ WL + ++++L ++IS   TKEV+ERW F +  +  ++E +           
Sbjct  65   DPLLQQVEYWLAKRQLKRLVMVISEVKTKEVVERWQFDIHTENLAEEGE-----------  113

Query  126  STNAEKDKIGNKDIKVIQKEIRDVLRQICSTVSFLPLLDAPCAFDCLIFTNFDTSVPENW  185
              NA +     K+ K I++EI DV+RQI ++VSFLPLL+ P +FD LI+T  DT  PE+W
Sbjct  114  --NAHR----VKEEKKIRQEISDVIRQITASVSFLPLLEEPVSFDVLIYTGKDTQAPEDW  167

Query  186  VETEPVFIANSQEVQLRSFSTSLHKMDTVVSYKYD  220
             E+    I NS+ VQLRSFSTS+H ++T V YK D
Sbjct  168  TESGACLIQNSETVQLRSFSTSVHSVNTNVQYKAD  202


>MD2L1_DICDI unnamed protein product
Length=203

 Score = 186 bits (472),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 139/218 (64%), Gaps = 19/218 (9%)

Query  1    MATTQKTENAITLKGSAKLVTDYLSLGINSILFQRGIYPPESFKSEQHFGLTIYVATDKE  60
            M     ++  I+LKGS ++VT++ S  IN+ILFQRG+YPPESF     +GL I V  D+ 
Sbjct  1    MQAAVASKTNISLKGSTEIVTEFFSYSINTILFQRGLYPPESFTRVAKYGLPILVTNDQS  60

Query  61   IQDFINRILGQIKDWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNT  120
            ++D+++ +L Q+ +WLL   VQKL L+I++  TKEVLERW F +  D             
Sbjct  61   LKDYLDNVLKQLSEWLLSGDVQKLVLVITDIVTKEVLERWVFDVTTD-------------  107

Query  121  ASKTDSTNAEKDKIGNKDIKVIQKEIRDVLRQICSTVSFLPLLDAPCAFDCLIFTNFDTS  180
                     E +    K  K I  EI+ ++RQI ++V+FLPLL   C FD L++T+ D +
Sbjct  108  ------IPKEGEAPRQKPEKEIMNEIQAIIRQITASVTFLPLLPNACTFDLLVYTSKDLA  161

Query  181  VPENWVETEPVFIANSQEVQLRSFSTSLHKMDTVVSYK  218
            VP+ W E++P FI NSQ+V+LRSF+T++HK++++V+YK
Sbjct  162  VPQKWEESDPKFITNSQQVKLRSFTTTIHKVESMVAYK  199



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01330.1.1 Myelin

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XVS2_CAEEL  unnamed protein product                                 190     3e-54
Q9VHC7_DROME  unnamed protein product                                 176     7e-48
Q8MSI9_DROME  unnamed protein product                                 168     2e-46


>Q9XVS2_CAEEL unnamed protein product
Length=454

 Score = 190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 158/278 (57%), Gaps = 26/278 (9%)

Query  50   RRIIVSNIPFEYRWQDLKDLFRTEVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVN  109
            R + ++NI +E RW DLK L R + G+V + E+L D  GKP+G+A+VEF++ +   K V 
Sbjct  45   RMVFITNIAYEARWVDLKSLVREKGGEVAFCELLEDRNGKPKGNAVVEFETREGAEKCVE  104

Query  110  KMHRFETKGRKLVIKEAVEDKGGRRNMGGGGGVD-----------------RDLSALLQN  152
             + +F+ KGR ++ KE  +     R +    G+D                 +DL    + 
Sbjct  105  NLQKFDWKGRTIIAKEIRDPNAFFRTIKTETGIDYLSRTGGGGAGGRGPPPKDLDRPTRT  164

Query  153  NSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIAL  212
             +    + +GL+ +FL    I  PL  ++F+ANL + V   KL EVF +AGK+  ++  +
Sbjct  165  GTY---DLFGLNMEFLRQHNIEPPLCERIFIANLAFNVGTDKLYEVFGMAGKITWMDFRI  221

Query  213  DKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPV-RLPEGLK  271
            DK+GKS+G   +++ HP+EAVQ++SMLN Q LF+R + V+MDR    L+     LP GL+
Sbjct  222  DKEGKSKGVCVIQYTHPIEAVQAVSMLNGQRLFDRNLVVKMDRFDKELEHKEGGLPRGLE  281

Query  272  SIGMGLGANGAPLQDVARNLPNMNTNPTPTASVSTPAA  309
            SIGMGLGA GAPL +V    P   + P      + PAA
Sbjct  282  SIGMGLGAEGAPLSNVHGMFPGDASVP-----FTAPAA  314


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 40/69 (58%), Gaps = 1/69 (1%)

Query  476  TVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRI  535
             ++++NLP   TWQ +RD+ RN G++   ++   G    +RF +   A+RA   +  + +
Sbjct  386  VIIIRNLPSDYTWQIVRDRVRNFGEVDSVDMMAPG-AARIRFATFQDAERARAALYGSTV  444

Query  536  DGKIIDVTF  544
            +G++I V +
Sbjct  445  EGRMISVDY  453


 Score = 30.0 bits (66),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 30/59 (51%), Gaps = 4/59 (7%)

Query  50   RRIIVSNIPFEYRWQDLKDLFRTEVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAV  108
            R II+ N+P +Y WQ ++D  R   G+V  V+++     + R      FQ  +  R A+
Sbjct  385  RVIIIRNLPSDYTWQIVRDRVRN-FGEVDSVDMMAPGAARIR---FATFQDAERARAAL  439


>Q9VHC7_DROME unnamed protein product
Length=632

 Score = 176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 139/209 (67%), Gaps = 32/209 (15%)

Query  161  YGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRG  220
            YGLS  FLESLGI+ PL NKVFVANLDYKVD KKL++VF+LAGKV++V+++LDK+G SRG
Sbjct  214  YGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRG  273

Query  221  FGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGAN  280
            F  +E+DHPVEAVQ+ISML+ Q LF+RR+TVR+DR+ D+ +G ++LPEGL  +G+GLG N
Sbjct  274  FAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEG-IKLPEGLGGVGIGLGPN  332

Query  281  GAPLQDVARNLPN--------------------MNTNPTPTASVSTPAALAAAVTALT--  318
            G PL+DVA NLPN                    + + P  +A  +    L   +T +   
Sbjct  333  GEPLRDVAHNLPNGGQSQGQLLGNAQQGSQLGSVGSQPNSSAVSNATTNLLNNLTGVMFG  392

Query  319  --QAQQPPP----PQPSLGNLGLNLGLGG  341
               A QP P     +PSLGN   N G GG
Sbjct  393  NHAAVQPSPVAPVQKPSLGN---NTGSGG  418


>Q8MSI9_DROME unnamed protein product
Length=430

 Score = 168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 113/134 (84%), Gaps = 1/134 (1%)

Query  160  TYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSR  219
              G   +FLESLGI+ PL NKVFVANLDYKVD KKL++VF+LAGKV++V+++LDK+G SR
Sbjct  11   CMGFLLRFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSR  70

Query  220  GFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGA  279
            GF  +E+DHPVEAVQ+ISML+ Q LF+RR+TVR+DR+ D+ +G ++LPEGL  +G+GLG 
Sbjct  71   GFAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEG-IKLPEGLGGVGIGLGP  129

Query  280  NGAPLQDVARNLPN  293
            NG PL+DVA NLPN
Sbjct  130  NGEPLRDVAHNLPN  143


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  52   IIVSNIPFEYRWQDLKDLFRTEVGDVTYVEILNDDTGKPR  91
            II+ N+P    WQ L+D FR E+GDV + EI  +D G  R
Sbjct  363  IIIKNVPITCTWQTLRDKFR-EIGDVKFAEIRGNDVGVVR  401



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


Query= Dcitr00g01340.1.1 Testis-expressed

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HPF1_DROME  unnamed protein product                                   37.7    0.029
B3CJ34_CAEEL  unnamed protein product                                 33.9    0.59 
Q382A8_TRYB2  unnamed protein product                                 29.3    7.6  


>HPF1_DROME unnamed protein product
Length=449

 Score = 37.7 bits (86),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (48%), Gaps = 14/109 (13%)

Query  69   LMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVK  128
            ++ R   +N A KQ  L  L  +      +V +S F S L+    L +D+  +  K    
Sbjct  352  MLERKDVDNGAAKQAVLEKLQPVANAANIAVDESDFGSALE----LGIDMFCSGHKELHM  407

Query  129  LLSAMFSQVTEEELAPLFEIVVR--YLACAMSHLDAGVREDSLLIIDVL  175
            L S++        L P + ++ R  ++A A +H++   RED+L I DVL
Sbjct  408  LASSL--------LVPAYSMLSRPQFIAIAKAHMEQRSREDNLSIFDVL  448


>B3CJ34_CAEEL unnamed protein product
Length=2651

 Score = 33.9 bits (76),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 65/153 (42%), Gaps = 18/153 (12%)

Query  46    REQLKERGENELLSVQRKLSVKELMSRLRHNNSA---VKQDGLSGLLEIITLNPTSVIKS  102
             R+Q+  R   EL+       + +++  L  N  +    K+ G++  L  I  N +  + +
Sbjct  1931  RQQMGARCLGELVRKMGDKVINDILPVLDANQKSEEVAKRVGVAIALHEIIGNMSKEVTN  1990

Query  103   HF-SSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLD  161
             H+  +I+  V   + D S   R+AA    + ++  V  E L  +   ++  L     H+ 
Sbjct  1991  HYLGAIVAPVRRAICDESELVREAAADTFTVLYHVVGNEALDEIICPLLEQLTPEQDHIL  2050

Query  162   AGVREDSLLIIDVLLEQCPILTANYRSLLPHFL  194
             AG+              C ++  N RS+LP+ L
Sbjct  2051  AGL--------------CDVMRQNSRSMLPYLL  2069


>Q382A8_TRYB2 unnamed protein product
Length=226

 Score = 29.3 bits (64),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 33/65 (51%), Gaps = 7/65 (11%)

Query  53   GENELLSV-QRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSV  111
            G+ ++L++ QRKL V  L+S   HNN   +  G       + +NP S+  +  +  LD V
Sbjct  109  GDRDMLAMLQRKLDVDVLVSGATHNNKVFEFGGH------LFVNPGSITGAFTTRRLDVV  162

Query  112  SPLML  116
               +L
Sbjct  163  PTFVL  167



Lambda      K        H
   0.322    0.140    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 596048720


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Apr 30, 2020  2:49 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g01350.1.1 Mitogen-activated

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M3K7_DROME  unnamed protein product                                   332     1e-109
PHG2_DICDI  unnamed protein product                                   156     2e-42 
DRKC_DICDI  unnamed protein product                                   155     2e-42 


>M3K7_DROME unnamed protein product
Length=678

 Score = 332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 204/290 (70%), Gaps = 3/290 (1%)

Query  18   IDYNEIEKIEIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIV  77
            +D++EI   E VG G++GVV K +W+++ VAVK     AE+K    EV+QLSRV HPNI+
Sbjct  14   VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKEVKQLSRVKHPNII  73

Query  78   KLYGACT-GNPVCLVMEYAEGGSLYNVLHNKPEPAYSAGHAMSWALQCAEGVAYLHNIKP  136
             L+G  +      L+ME+AEGGSL+N LH K +PAYS  HAMSWA QCAEG+AYLH + P
Sbjct  74   ALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTP  133

Query  137  KPLIHRSEAP-NLLSSAHGTKLKICDFGTVCDKKTIMTNNKGSAAWMAPEVFEGSNYTEK  195
            KPLIHR   P NLL +  G  LKICDFGTV DK T+MTNN+GSAAWMAPEVFEGS YTEK
Sbjct  134  KPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNRGSAAWMAPEVFEGSKYTEK  193

Query  196  CDIFSWGIILWEILSRRKPFHEIYGSAFGILWAIHKGIRPALMEGCPKPIEQLMTRCWSK  255
            CDIFSW I+LWE+LSR++PF  I  +A+ I W I+KG RP L+  CPK IE LMT CW  
Sbjct  194  CDIFSWAIVLWEVLSRKQPFKGI-DNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKT  252

Query  256  DPLARPSMDEVVRIMTTLFQFFSGHEEPLQYTVGEIQESARKSDSKTAAQ  305
             P  RPSM  +V +M  + + ++G ++ L+YT    Q   ++SD   AAQ
Sbjct  253  VPEDRPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQ  302


>PHG2_DICDI unnamed protein product
Length=1387

 Score = 156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 157/281 (56%), Gaps = 28/281 (10%)

Query  22    EIEKIEIVGQGAFGVVWKGLWQNQYVAVKHIE----TEAERKAFAVEVRQLSRVSHPNIV  77
             ++E I+ +G G +  V+KG +++++VA+K +     T  + ++F  E   LS +  P ++
Sbjct  806   DLEYIKRIGSGTYSKVYKGKYRDKFVAIKTMRGSNMTTEQIESFKKECDILSTIQSPLLI  865

Query  78    KLYGACTG-NPVCLVMEYAEGGSLYNVLHNKPEPAYSAGHAMSWALQCAEGVAYLHNIKP  136
               YG+C   + + +V+EY   G+L+ VL+N P   +       W  +  EGV YLH++ P
Sbjct  866   SFYGSCIEESQLSMVVEYCSKGTLHKVLNN-PLLDFDWDKWFKWMTEVVEGVRYLHSMNP  924

Query  137   KPLIHRS-EAPNLLSSAHGTKLKICDFGTVCDKKTIMTNN------KGSAAWMAPEVFEG  189
              P++HR  +  N+L S+  T  K+CDFG    +   MTN       +G+ A+ APE+++G
Sbjct  925   -PMVHRDLKTLNILISSDWTA-KLCDFGLT--RTMTMTNVSTLGMLRGTMAYTAPEIYDG  980

Query  190   SNYTEKCDIFSWGIILWEILSR------RKPFHE--IYGSAFGILWAIHKGIRPALMEGC  241
               +  K D++S G+I+WE + R       +PFHE  I      I+      +RP + E C
Sbjct  981   LLFNTKSDVYSLGVIMWEAIQRCISGVYLRPFHEHPISMDIQIIILTSKNKVRPKISENC  1040

Query  242   PKPIEQLMTRCWSKDPLARPSMDEVVRIMTTLFQFFSGHEE  282
             P+ ++ L+TRCW ++P  RP+ DE++ I+ T+ Q    H+E
Sbjct  1041  PEQLKTLITRCWDENPDKRPNCDEILEILLTMKQ---AHDE  1078


>DRKC_DICDI unnamed protein product
Length=749

 Score = 155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 140/267 (52%), Gaps = 18/267 (7%)

Query  15   VEEIDYNEIEKIEIVGQGAFGVVWKGLWQNQYVAVKHI-----ETEAERKAFAVEVRQLS  69
            ++ ID +EI     +G+G+   V+ G W+   VA+K       + E      A E   +S
Sbjct  483  IKPIDISEIVVQNRIGRGSCAEVFTGTWRGIIVAIKKAKLLNEDDEDFLNELAQEATIMS  542

Query  70   RVSHPNIVKLYGACTGNP-VCLVMEYAEGGSLYNVLHNKPEPAYSAGHAMSWALQCAEGV  128
            ++ HPNI +  G C   P + +VMEY   GSLY +LH+ P  +       S AL  A+G+
Sbjct  543  QLRHPNICQFLGTCNNPPEILIVMEYMPLGSLYRILHD-PSISLDWPRMKSMALDIAKGM  601

Query  129  AYLHNIKPKPLIHRS-EAPNLLSSAHGTKLKICDFGTVC------DKKTIMTNNKGSAAW  181
             YLH   P  +IHR  ++ NLL   H  ++KI DFG         DKKT MT   G+  W
Sbjct  602  NYLHCCDPI-VIHRDLKSHNLLVDEH-YRVKISDFGLSTRFKKHLDKKTAMTP-VGTPCW  658

Query  182  MAPEVFEGSNYTEKCDIFSWGIILWEILSRRKPFHEIYGSAFGILWAIHKGIRPALMEGC  241
             APEV     YTEK D+FS+ I+LWEI++R  P+  +      I    HK +RP +    
Sbjct  659  TAPEVLRNDPYTEKADVFSFAIVLWEIVTREDPYQGMPTFQIVISVGQHK-LRPIVPPQV  717

Query  242  PKPIEQLMTRCWSKDPLARPSMDEVVR  268
              P  +L+T CWS+DP  RPS  E+V+
Sbjct  718  SAPFTRLITECWSEDPQQRPSFQEIVK  744



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01360.1.1 Unknown

Length=446


***** No hits found *****



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01370.1.1 TATA-binding

Length=323
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 146     9e-39
Q54M42_DICDI  unnamed protein product                                 99.4    1e-22
Q38BP8_TRYB2  unnamed protein product                                 31.6    1.2  


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 146 bits (368),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 138/252 (55%), Gaps = 30/252 (12%)

Query  1    MTSRLDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLA  60
            MTSRLDRLF+LLETGST  TR AAA Q+GE+Q+L+PHELH LL R    L S SW+TR+A
Sbjct  1    MTSRLDRLFILLETGSTAATRQAAAKQIGEVQKLYPHELHALLNRLVGYLHSTSWETRIA  60

Query  61   AAQAVGAVVRHTPPWSP----MPV---CVQEPDGNIMVIQDGVVSGK-----------LS  102
            AAQ V A+++  PPW P    +P    C           ++                 LS
Sbjct  61   AAQTVEAILKQVPPWQPEFQVLPKKERCATNTATAAAAAEEDSCQSSGSNSTTASERLLS  120

Query  103  LAMFDIERILDSSSCLTASQGSEFDMEEDSMGSTSTGIGPNNKDSLQRAHQQ---LHAKL  159
               FD+++IL   + L  S+G+EFD++E+   S   G G  ++    R  +Q   L+ KL
Sbjct  121  FDEFDLQQILHKGARLIGSEGNEFDVQEEQPAS---GGGEEDRSLASRLSRQRAVLNDKL  177

Query  160  GFPL---LDPSITDTLLTKED--LITTSRTKDIEQDKPNVGDILSSGSLNNSGGGGAMSS  214
            G      L  ++TD ++T ED  L  +  T ++  +K  V  +L+  +  N  G   +S 
Sbjct  178  GLTTAAKLGVNLTD-MITDEDVALNRSGSTYNVNAEKLPVEHLLNIKTAANGSGQAPLSC  236

Query  215  REMNRARRKARR  226
            REMNRA+RKAR+
Sbjct  237  REMNRAKRKARQ  248


>Q54M42_DICDI unnamed protein product
Length=2005

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 83/276 (30%), Positives = 124/276 (45%), Gaps = 59/276 (21%)

Query  3    SRLDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLAAA  62
            SRLDRL  LLETGS+P  R AAA Q+GE+Q+L+P++L +LL +    L S+SWDTR+AA 
Sbjct  2    SRLDRLLTLLETGSSPSIRKAAAQQIGEIQKLYPYDLQSLLDKVQVYLSSDSWDTRIAAG  61

Query  63   QAVGAVVRHTPPWSPMPVCVQEPDGNIMVIQDGVVSG-----------------------  99
            QA+ A+  + P W P+    ++ +  +  ++DG+ S                        
Sbjct  62   QAIEAIASNVPLWDPIERIKEKKEEELQKLKDGIPSSSTTSTSTTTTDINNNNNNNNNNN  121

Query  100  --------------------KLSLAMFDIERILDSSSCLTASQGSEFDMEE--DSMGSTS  137
                                 L    FDI ++L+  + L AS G EFD EE   +M    
Sbjct  122  NNNNNNNNNNNKPILNEDEFDLQFKNFDIVKVLNYGAPLVASGGKEFDEEELDPNMDPKE  181

Query  138  TGIGPNNKDSLQRAHQQLHAKLGFPLLDPSITDTLLTKEDLITTSRTKDIEQDKPNVGDI  197
              +    K   Q     L  KL          D+L+  +D++  +    I+  K      
Sbjct  182  LLLKQKKKLKKQLGLDDLPIKL-------ESMDSLVEDKDIVLNNSKSAIKAKKEKEEKE  234

Query  198  LS---SGSLNNSGGGGAMSSREMNRARRKARRAVAK  230
                 S  L+ +G    MS+RE N+A+RKAR  V +
Sbjct  235  KKEDISMVLDTTG----MSARERNKAKRKARNLVKE  266


>Q38BP8_TRYB2 unnamed protein product
Length=1802

 Score = 31.6 bits (70),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (56%), Gaps = 2/45 (4%)

Query  25   ATQLGELQRLHP-HELHTLLRRTYCLLRSNSWDTRLAAAQAVGAV  68
            A+  G+L R  P HE+  LLRR  C  R    + RL A + VGAV
Sbjct  490  ASLFGDLARWQPLHEVEVLLRRVSCRSR-QELEHRLRAIKEVGAV  533



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01380.1.1 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     8e-128
Q383K0_TRYB2  unnamed protein product                                 290     7e-99 
Q383I8_TRYB2  unnamed protein product                                 291     1e-98 


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>Q383K0_TRYB2 unnamed protein product
Length=244

 Score = 290 bits (743),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  4    VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  63

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  64   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  123

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  124  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  183

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  184  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  231


>Q383I8_TRYB2 unnamed protein product
Length=277

 Score = 291 bits (744),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  37   VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  96

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  97   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  156

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  157  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  216

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  217  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  264



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01380.1.2 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     8e-128
Q383K0_TRYB2  unnamed protein product                                 290     7e-99 
Q383I8_TRYB2  unnamed protein product                                 291     1e-98 


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>Q383K0_TRYB2 unnamed protein product
Length=244

 Score = 290 bits (743),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  4    VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  63

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  64   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  123

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  124  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  183

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  184  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  231


>Q383I8_TRYB2 unnamed protein product
Length=277

 Score = 291 bits (744),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  37   VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  96

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  97   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  156

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  157  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  216

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  217  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  264



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01380.1.3 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     8e-128
Q383K0_TRYB2  unnamed protein product                                 290     7e-99 
Q383I8_TRYB2  unnamed protein product                                 291     1e-98 


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>Q383K0_TRYB2 unnamed protein product
Length=244

 Score = 290 bits (743),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  4    VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  63

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  64   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  123

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  124  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  183

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  184  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  231


>Q383I8_TRYB2 unnamed protein product
Length=277

 Score = 291 bits (744),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  37   VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  96

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  97   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  156

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  157  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  216

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  217  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  264



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01380.1.4 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     8e-128
Q383K0_TRYB2  unnamed protein product                                 290     7e-99 
Q383I8_TRYB2  unnamed protein product                                 291     1e-98 


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (936),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDP  207
            EVLR RGTI R  +W VVVDLFFYRDP
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDP  207


>Q383K0_TRYB2 unnamed protein product
Length=244

 Score = 290 bits (743),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  4    VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  63

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  64   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  123

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  124  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  183

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  184  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  231


>Q383I8_TRYB2 unnamed protein product
Length=277

 Score = 291 bits (744),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 173/231 (75%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  37   VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  96

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  97   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  156

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  157  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  216

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   + ADE
Sbjct  217  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  264



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01390.1.1 Unknown

Length=52
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38B59_TRYB2  unnamed protein product                                 25.0    3.4  
Q9VNX2_DROME  unnamed protein product                                 25.0    3.4  
Q57V95_TRYB2  unnamed protein product                                 24.3    5.8  


>Q38B59_TRYB2 unnamed protein product
Length=957

 Score = 25.0 bits (53),  Expect = 3.4, Method: Composition-based stats.
 Identities = 9/22 (41%), Positives = 14/22 (64%), Gaps = 0/22 (0%)

Query  28   LTMFHNSWSALVQILPHSTRKS  49
            LTM  N  S ++ I+PH +R +
Sbjct  86   LTMAENYLSEIISIIPHCSRST  107


>Q9VNX2_DROME unnamed protein product
Length=568

 Score = 25.0 bits (53),  Expect = 3.4, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 3/35 (9%)

Query  9    VLSCGIVEVWWSHGQVLEVLT--MFHNSWSALVQI  41
            VL+C ++ V+++ G+VL  ++   FH+ W  L++I
Sbjct  248  VLACSVITVFYAVGEVLLAMSAKAFHD-WRILLRI  281


>Q57V95_TRYB2 unnamed protein product
Length=1751

 Score = 24.3 bits (51),  Expect = 5.8, Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  22   GQVLEVLTMFHNSWSALVQILPHSTRKSSL  51
             Q++EV   FH  W+ L+ + P   + S L
Sbjct  862  AQLVEVHDRFHARWNDLMALTPQVVQDSVL  891



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01400.1.1 40S

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RSSA_DROME  unnamed protein product                                   365     6e-128
Q383K0_TRYB2  unnamed protein product                                 288     5e-98 
Q383I8_TRYB2  unnamed protein product                                 289     9e-98 


>RSSA_DROME unnamed protein product
Length=270

 Score = 365 bits (937),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/266 (73%), Positives = 214/266 (80%), Gaps = 11/266 (4%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            MSGGLDILSLKEDD+TKML A TH+GSEN ++QMEQYVYKRR DGV+ILNL +TWEKL L
Sbjct  1    MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQL  60

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AARAIVAI++P+D+FVISSRPIGQRAVLKFA YT  TPIAGRFTPGAFTNQIQ AFREPR
Sbjct  61   AARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPR  120

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            LLVVTDP+TDHQPI EA+YVNIPVIAF NT+SPLR++DIAIPCNNKS HSIGLMWWLLAR
Sbjct  121  LLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR  180

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKE-----SAAAIADKPVDEFAAH  235
            EVLR RGTI R  +W VVVDLFFYRDPEEAEKEE A KE           D PV+E    
Sbjct  181  EVLRLRGTISRSVEWPVVVDLFFYRDPEEAEKEEAAAKELLPPPKIEEAVDHPVEE----  236

Query  236  APTESWNDTVVPSADLAPQSWAEESA  261
              T +W D V        + W E++ 
Sbjct  237  --TTNWADEVAAETVGGVEDWNEDTV  260


>Q383K0_TRYB2 unnamed protein product
Length=244

 Score = 288 bits (738),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 172/231 (74%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  4    VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  63

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  64   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  123

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  124  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  183

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPVDE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   +  DE
Sbjct  184  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  231


>Q383I8_TRYB2 unnamed protein product
Length=277

 Score = 289 bits (739),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 172/231 (74%), Gaps = 3/231 (1%)

Query  1    MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLL  60
            +S G  +L +KE DV K+L    H+G++NS   M++Y++ R +DG +I+++  TWEKL+L
Sbjct  37   VSSGAKVLRMKESDVQKLLAMHCHLGTKNSSSAMKKYIHGRTSDGTNIIDIHMTWEKLIL  96

Query  61   AARAIVAIEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPR  120
            AAR I A+E+P DV V S+R  GQRA+ KF+   G + + GRF PG FTNQIQ  F +PR
Sbjct  97   AARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGTSFLGGRFIPGTFTNQIQKKFMQPR  156

Query  121  LLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAR  180
            +LVVTDP TDHQ + EA+ VNIPVIAFC+T++PL FVDIAIPCNN+  HSI +M+WLLAR
Sbjct  157  VLVVTDPRTDHQALREASLVNIPVIAFCDTDAPLEFVDIAIPCNNRGRHSISMMYWLLAR  216

Query  181  EVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPVDE  231
            EVLR RGTIPR   W+V VDLFFYRDPEEA K+E+A   +AAA   +  DE
Sbjct  217  EVLRLRGTIPRSVPWEVKVDLFFYRDPEEALKQEEA---TAAAEVHEEADE  264



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01410.1.1 TATA-binding

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 353     2e-108
Q54M42_DICDI  unnamed protein product                                 272     3e-80 
Q8SX88_DROME  unnamed protein product                                 33.1    0.51  


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 353 bits (905),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 223/538 (41%), Positives = 301/538 (56%), Gaps = 89/538 (17%)

Query  11   LDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLAAAQA  70
            LDRLF+LLETGST  TR AAA Q+GE+Q+L+PHELH LL R    L S SW+TR+AAAQ 
Sbjct  5    LDRLFILLETGSTAATRQAAAKQIGEVQKLYPHELHALLNRLVGYLHSTSWETRIAAAQT  64

Query  71   VGAVVRHTPPWSP----MP-------------VCVQEPDCNTMVLQDGVVSGKL-SLAMF  112
            V A+++  PPW P    +P                +E  C +        S +L S   F
Sbjct  65   VEAILKQVPPWQPEFQVLPKKERCATNTATAAAAAEEDSCQSSGSNSTTASERLLSFDEF  124

Query  113  DIERILDSSSFLTASQGSEFDMEEDSMGSTSTGIGPNNKDSLQRAHQQ---LHAKLGFPL  169
            D+++IL   + L  S+G+EFD++E+   S   G G  ++    R  +Q   L+ KLG   
Sbjct  125  DLQQILHKGARLIGSEGNEFDVQEEQPAS---GGGEEDRSLASRLSRQRAVLNDKLGLTT  181

Query  170  ---LDPSITDTLLTKED--LITTSRTKDIEQDKPNVGDILSSGSLNNSGGGGAMSSREMN  224
               L  ++TD ++T ED  L  +  T ++  +K  V  +L+  +  N  G   +S REMN
Sbjct  182  AAKLGVNLTD-MITDEDVALNRSGSTYNVNAEKLPVEHLLNIKTAANGSGQAPLSCREMN  240

Query  225  ----RARRK-------------ARRAV-------AKHRPRAGSG---QDPGEH-------  250
                +AR+              +RR         + H     +G   ++P +        
Sbjct  241  RAKRKARQNTSGCSVTAVTPTCSRRNSNSNHSTGSNHSSNGTTGAAIEEPEKKKLKSTDR  300

Query  251  --------------------ATEWPLEGFCDGLCGDLFSPLWEVRHGVATALREIIKVHG  290
                                A  WPLE FC  L  DLF   WEVRHG ATALRE+I  H 
Sbjct  301  QEIFYSLNAAVPDATGTWVDAVSWPLENFCSRLFIDLFHAKWEVRHGAATALRELINQHA  360

Query  291  RGAGKVVGQTKVQMEHSNRAWLEDVSVRLLCVLALDRFGDFVSDQVVAPVRETCAQALGV  350
            +GAGK V QT+ QM+ ++  WLED ++RLLCVL LDRFGDFVSDQVVAPVRETCAQ LG 
Sbjct  361  QGAGKAVLQTREQMDEAHSRWLEDAALRLLCVLCLDRFGDFVSDQVVAPVRETCAQVLGT  420

Query  351  VISLIDEESLVTRVVDLLLTLAQQKH-WETRHGGLLGLKYILAVKQDMVPSLLPRSLPLI  409
            ++  + E S V R+V++LL L Q K+ W+ RHGGLLGLKY+  V+++++P  LP+S+  I
Sbjct  421  LVKEM-EASKVQRIVNILLQLIQHKNEWDVRHGGLLGLKYVFVVREELLPIYLPQSISNI  479

Query  410  LSGLADPVDDVGNIAAATLIPVA---PHLIATPHVPALITQLWTLLADHDQLTSAFRS  464
            L GL D VDDVG +AAATLIPV+   P L+    V +++  LW LL D D+LTSA  S
Sbjct  480  LIGLLDAVDDVGAVAAATLIPVSSWLPKLLNPAQVSSIVKMLWDLLLDQDELTSACNS  537


>Q54M42_DICDI unnamed protein product
Length=2005

 Score = 272 bits (695),  Expect = 3e-80, Method: Composition-based stats.
 Identities = 187/552 (34%), Positives = 267/552 (48%), Gaps = 110/552 (20%)

Query  11   LDRLFVLLETGSTPYTRHAAATQLGELQRLHPHELHTLLRRTYCLLRSNSWDTRLAAAQA  70
            LDRL  LLETGS+P  R AAA Q+GE+Q+L+P++L +LL +    L S+SWDTR+AA QA
Sbjct  4    LDRLLTLLETGSSPSIRKAAAQQIGEIQKLYPYDLQSLLDKVQVYLSSDSWDTRIAAGQA  63

Query  71   VGAVVRHTPPWSPMPVCVQEPDCNTMVLQDGVVSGK------------------------  106
            + A+  + P W P+    ++ +     L+DG+ S                          
Sbjct  64   IEAIASNVPLWDPIERIKEKKEEELQKLKDGIPSSSTTSTSTTTTDINNNNNNNNNNNNN  123

Query  107  -------------------LSLAMFDIERILDSSSFLTASQGSEFDMEE--DSMGSTSTG  145
                               L    FDI ++L+  + L AS G EFD EE   +M      
Sbjct  124  NNNNNNNNNKPILNEDEFDLQFKNFDIVKVLNYGAPLVASGGKEFDEEELDPNMDPKELL  183

Query  146  IGPNNKDSLQRAHQQLHAKLGFPLLDPSITDTLLTKEDLITTSRTKDIEQDKPNVGDILS  205
            +    K   Q     L  KL          D+L+  +D++  +    I+  K        
Sbjct  184  LKQKKKLKKQLGLDDLPIKL-------ESMDSLVEDKDIVLNNSKSAIKAKKEKEEKEKK  236

Query  206  ---SGSLNNSGGGGAMSSREMNRARRKARRAVAKHRPRAGSG------------------  244
               S  L+ +G    MS+RE N+A+RKAR  V +      +                   
Sbjct  237  EDISMVLDTTG----MSARERNKAKRKARNLVKEKENEKPTKRFKEVKSSNNNNNNNNNN  292

Query  245  -----------------QDPGE-------------HATEWPLEGFCDGLCGDLFSPLWEV  274
                             QD G+             +  EWP     + L  DLFSP WE+
Sbjct  293  NNNSTTEKTKQHITEQPQDSGKIVMESILDVDKAYNQDEWPFTSIFNDLVIDLFSPTWEI  352

Query  275  RHGVATALREIIKVHGRGAGKVVGQTKVQMEHSNRAWLEDVSVRLLCVLALDRFGDFVSD  334
            RHG    LREI K HG G GK +     +M++ N  WLED S+RLLCV++LDRF D+ SD
Sbjct  353  RHGSLVGLREICKKHGGGGGKTIDTPIDKMDYVNAKWLEDFSLRLLCVISLDRFADYTSD  412

Query  335  QVVAPVRETCAQALGVVISLIDEESLVTRVVDLLLTLAQQKHWETRHGGLLGLKYILAVK  394
            Q+VAPVRETC Q LG+V+  +D ES V +V+D+LL L   K WE RHGG+LG+KY++AV+
Sbjct  413  QIVAPVRETCTQTLGIVVKYMDNES-VLKVIDILLHLQNNKLWEVRHGGMLGIKYVVAVR  471

Query  395  QDMVPSLLPRSLPLILSGLADPVDDVGNIAAATLIPVAPHLIAT--PHVPALITQLWTLL  452
             D++  +LPR LP I  GL D  DDV   A+ T  P++ +L+      +P ++T LW +L
Sbjct  472  LDLIDIILPRILPTITDGLMDSDDDVRACASETFHPISRYLVEKHIDKLPEILTILWDIL  531

Query  453  ADHDQLTSAFRS  464
             + D ++ +  S
Sbjct  532  LELDDISVSTSS  543


>Q8SX88_DROME unnamed protein product
Length=642

 Score = 33.1 bits (74),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 3/102 (3%)

Query  340  VRETCAQALGVVISLIDEESLVTRVVDLLLTLAQQKHWETRHGGLLGLKYIL-AVKQDMV  398
            +R+  A AL V+ ++  E+ L   +  L  TL  Q+ W  +  G+L L  I     Q M+
Sbjct  128  LRKCSAAALDVLANVFREDCLPVVLPILKETLFHQE-WVIKESGVLALGAIAEGCMQGMI  186

Query  399  PSLLPRSLPLILSGLADPVDDVGNIAAATLIPVAPHLIATPH  440
              L P  +P ++S L+D    V +I   TL   A  ++  PH
Sbjct  187  QHL-PELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPH  227



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01420.1.1 TATA-binding

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 202     3e-56
Q54M42_DICDI  unnamed protein product                                 73.2    2e-13


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/280 (41%), Positives = 165/280 (59%), Gaps = 5/280 (2%)

Query  45    GVETVPLATREVNATRCRLLASCLLGLASTYVIQPMTGLYLGTEQPPCPIQCYVNLLLVY  104
             G E  PL  R+ N  R R+ +S  LG  S Y++QP  G+   T Q   P  CY  +LL +
Sbjct  738   GSEATPLDVRDANFMRARISSSRALGALSHYLVQPAPGVVY-TPQTESPTDCYTKVLLGH  796

Query  105   VNSKSALQRLVSGLVIADWN-RRQVLQPPQDTLNSALVQCLDENIYYDELGAVYTKLLHD  163
             +N+ SA+QR+V GL+IA W    + ++P    L   L QC+ E +YYDE+    T+LL +
Sbjct  797   LNAHSAVQRIVCGLIIAFWALEDEPVRPGPPNLQEKLHQCVSEYVYYDEVAISLTRLLQE  856

Query  164   TTDLLSYMKHYELGFDYDAFNRVLTLDEIEQLVGTLLVQSMNEQRTSKTVKCLERIDERR  223
               D ++ +K  ++  +     ++LTLD+IE +  TL   S N +      K L+ ++ERR
Sbjct  857   AQDFIATLKQNKIPINDFNNAKILTLDQIEAVATTL---SENLRSYPLKPKVLDMLEERR  913

Query  224   KSILSFVQTTRKDQFNWHIMVQAVLAGALLRLQCLPPKVNPIIKPLMESIKFETNPLLQD  283
             +S+ +  Q T  +Q  +H+  QA LAGA+  L CLP K+NP++KPLMESIK E    LQ 
Sbjct  914   RSLQASYQQTTSEQSAYHVSAQAALAGAICALHCLPDKLNPVVKPLMESIKREQCLQLQQ  973

Query  284   MAATHLAILLGLCSQRNPCPNNKIVHNLCTFLCCDPEFTP  323
             ++A  L  L+     RNP PN+KI++NLCT L  DPEFTP
Sbjct  974   LSAEFLVHLMDQVCDRNPSPNSKILNNLCTLLRSDPEFTP  1013


>Q54M42_DICDI unnamed protein product
Length=2005

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 65/111 (59%), Gaps = 0/111 (0%)

Query  215   CLERIDERRKSILSFVQTTRKDQFNWHIMVQAVLAGALLRLQCLPPKVNPIIKPLMESIK  274
              +++++ R+K+IL  +    K Q  +H  V + ++  L+    +PPKV+ I++ LM +I+
Sbjct  946   IIDQLEARKKTILVTIGFVEKIQTEYHTQVLSEMSTLLIVSNNIPPKVSAIVRSLMLAIR  1005

Query  275   FETNPLLQDMAATHLAILLGLCSQRNPCPNNKIVHNLCTFLCCDPEFTPVI  325
              + NPL Q  AA  L+  + +   R PCPN KI+ ++ T LC D   TP+I
Sbjct  1006  KDENPLYQLRAARSLSQFIEMSLTRTPCPNPKIISSMFTLLCDDHTETPLI  1056



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01430.1.1 SNF2

Length=176
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 240     1e-73
Q54M42_DICDI  unnamed protein product                                 236     4e-72
INO80_DROME  unnamed protein product                                  129     1e-34


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 4/169 (2%)

Query  1     MLDIVENDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNL  60
             MLDIVE DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNL
Sbjct  1725  MLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNL  1784

Query  61    TGADTVIFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTA  120
             TGADTVIFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTA
Sbjct  1785  TGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTA  1844

Query  121   NTVINSENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGGLKV  166
             NTV+++EN +L TM T +I DLF   G+D   E+GSS   GT  GG+ +
Sbjct  1845  NTVVSAENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSM  1892


>Q54M42_DICDI unnamed protein product
Length=2005

 Score = 236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 133/160 (83%), Gaps = 2/160 (1%)

Query  1     MLDIVENDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNL  60
             MLDIVEN+LFK  +P VTYLR+DGSV +  RH+IV +FNSDPTIDVLLLTT VGGLGLNL
Sbjct  1791  MLDIVENELFKKHLPSVTYLRMDGSVETMKRHSIVNQFNSDPTIDVLLLTTHVGGLGLNL  1850

Query  61    TGADTVIFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTA  120
             TGADTVIF++HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT  TLEEKIM LQKFKL  A
Sbjct  1851  TGADTVIFLEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITSGTLEEKIMGLQKFKLNIA  1910

Query  121   NTVINSENRNLDTMATGKILDLFCLDGQDSRQEAGSSGTN  160
             NTVIN +N +L TM+T ++L+LF  D  D ++   S  TN
Sbjct  1911  NTVINHDNSSLQTMSTNELLNLF--DYSDDQKSQQSKSTN  1948


>INO80_DROME unnamed protein product
Length=1638

 Score = 129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 98/164 (60%), Gaps = 6/164 (4%)

Query  1     MLDIVENDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNL  60
             M+D++E  ++  +     Y+RLDGS   +AR  +V  F +   I V LL+T+ GGLG+NL
Sbjct  1184  MIDLLEEYMWHRKH---RYMRLDGSSKISARRDMVADFQTRADIFVFLLSTRAGGLGINL  1240

Query  61    TGADTVIFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTA  120
             T ADTVIF D DW+P  D QAMDRAHR+GQ K V VYRLI K T+EE+I+   + K    
Sbjct  1241  TAADTVIFYDSDWNPTVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAREKSEIQ  1300

Query  121   NTVINSENRNLDTMATGKILDLFCLDGQ---DSRQEAGSSGTNP  161
               VI+  N   DT+   +++ L   D +     RQEA    ++P
Sbjct  1301  RMVISGGNFKPDTLKPKEVVSLLLDDEEIEMKYRQEAKLQSSSP  1344



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01440.1.1 F-box

Length=410
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K2J4_DROME  unnamed protein product                                 353     6e-117
Q9VT01_DROME  unnamed protein product                                 120     7e-31 
Q95RF4_DROME  unnamed protein product                                 102     1e-24 


>Q7K2J4_DROME unnamed protein product
Length=603

 Score = 353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/340 (54%), Positives = 233/340 (69%), Gaps = 31/340 (9%)

Query  77   LMQFPTELLEKILLYLDFKHIAALRLVNRRMNTVCGSILSTTFNRLQSTMLARFQSIKSK  136
            L   P EL+EKIL Y+D+K ++ LRLV+ RMN +C ++L+T F +   T L+RFQ+IK+ 
Sbjct  122  LYDLPNELIEKILSYVDYKKVSNLRLVSHRMNDICMAMLNTAFTKQIKTTLSRFQAIKAS  181

Query  137  MPRRESARRQHPLACESDIVEMLHMRLALLQMSFGKHIERQHCCFFAGEILDEIYRIIHY  196
            MPRRES RR HPLACE DI+E  +MRL+LLQMS GKHIER HCCFF G ILDE+  I++Y
Sbjct  182  MPRRESHRRNHPLACECDIIETCYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNY  241

Query  197  IKTTPRLARPYKVTDELFDLSTMAMEYFKEKIEPTLPEITYFGTDFMDIAGPFPSSKNDS  256
            I  TPRL RPY+VTDELFDLSTMAMEYFK++IE TLP + YF  DF  +     ++K  +
Sbjct  242  ISITPRLQRPYRVTDELFDLSTMAMEYFKDRIEATLPGLAYFNKDFYTLPT---TTKRPT  298

Query  257  IACGSDAGGCGFESTLELSP-RSPPQSNMVLRKRIHKIKQGMKRYSSQLTLMKRDLKLCK  315
            +A  SD         LE S   SPPQ++MVLRK I KIKQGMK Y++QL++++ +L+ CK
Sbjct  299  LAISSD---------LEDSASNSPPQNHMVLRKGIRKIKQGMKMYNNQLSVLRTELRTCK  349

Query  316  VKLVDQTKTV--------------VEYATRLDEYDKKNEETSRKFSQVLQELNKCKTELQ  361
             K  +Q+K +              +EYA RLDE DKKNEE SRKFS +LQELNKCKTELQ
Sbjct  350  RKAAEQSKQLAEQSNLISEQQKQTLEYANRLDENDKKNEEMSRKFSTLLQELNKCKTELQ  409

Query  362  FFRSKFPFNPD-CTCSGPAVATDAPLIAPDLSQVLSPQVI  400
            F+RSK P  P  C+     V   AP++ P+  Q L  Q +
Sbjct  410  FWRSKSPAIPAVCSSCNQKV---APVVPPEDFQALVNQGV  446


>Q9VT01_DROME unnamed protein product
Length=314

 Score = 120 bits (301),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 90/301 (30%), Positives = 151/301 (50%), Gaps = 18/301 (6%)

Query  75   INLMQFPTELLEKILLYLDFKHIAALRLVNRRMNTVCGSILSTTFNRLQSTMLARFQSIK  134
            +NL+  P  L++ IL  L +  +A  R V    N +   IL+  FN++       F+ IK
Sbjct  1    MNLLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIK  60

Query  135  SKMPRRESARRQHPLACESDIVEMLHMRLALLQMSFGKHIERQHCCFFAGEILDEIYRII  194
            S +PRRES RR H L+  SDI+  +  R+++L M++ K I+   CCF  G +LDEI  I+
Sbjct  61   SMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSIL  120

Query  195  HYIKTTPRLARPYKVTDELFDLSTMAMEYFKEKI--------EPTLPEITYFGTDFM---  243
              + T+ +  RP++V  EL D+S+MA+E+F EKI           L E T  G   +   
Sbjct  121  RILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFKLEHRKQLAESTAAGARLVVCS  180

Query  244  ---DIAGPFPSSKNDSIACGSDAGGCGFESTLELSPRSPPQSNMVLRKRIHKIKQGMKRY  300
               DI+  F   +   I+   D G    ++ ++L+P S  +S+    ++    KQ  K+Y
Sbjct  181  ALGDIS--FSGVRRTGISRPVDHGLVQ-QAIVQLAPISASKSHSDSSQKDRMSKQLFKQY  237

Query  301  SSQLTLMKRDLKLCKVKLVDQTKTVVEYATRLDEYDKKNEETSRKFSQVLQELNKCKTEL  360
              Q +L ++ ++L +V    Q + + E  + + E   +  E  R+   V+  +  C  + 
Sbjct  238  QLQRSLSQK-IRLLEVSRKVQDRRLQEALSSITELTTQVSELKRQMEDVVANMPSCAVKR  296

Query  361  Q  361
            Q
Sbjct  297  Q  297


>Q95RF4_DROME unnamed protein product
Length=265

 Score = 102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 126/246 (51%), Gaps = 18/246 (7%)

Query  130  FQSIKSKMPRRESARRQHPLACESDIVEMLHMRLALLQMSFGKHIERQHCCFFAGEILDE  189
            F+ IKS +PRRES RR H L+  SDI+  +  R+++L M++ K I+   CCF  G +LDE
Sbjct  7    FKRIKSMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDE  66

Query  190  IYRIIHYIKTTPRLARPYKVTDELFDLSTMAMEYFKEKI--------EPTLPEITYFGTD  241
            I  I+  + T+ +  RP++V  EL D+S+MA+E+F EKI           L E T  G  
Sbjct  67   INSILRILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFKLEHRKQLAESTAAGAR  126

Query  242  FM------DIAGPFPSSKNDSIACGSDAGGCGFESTLELSPRSPPQSNMVLRKRIHKIKQ  295
             +      DI+  F   +   I+   D G    ++ ++L+P S  +S+    ++    KQ
Sbjct  127  LVVCSALGDIS--FSGVRRTGISRPVDHGLVQ-QAIVQLAPISASKSHSDSSQKDRMSKQ  183

Query  296  GMKRYSSQLTLMKRDLKLCKVKLVDQTKTVVEYATRLDEYDKKNEETSRKFSQVLQELNK  355
              K+Y  Q +L ++ ++L +V    Q + + E  + + E   +  E  R+   V+  +  
Sbjct  184  LFKQYQLQRSLSQK-IRLLEVSRKVQDRRLQEALSSITELTTQVSELKRQMEDVVANMPS  242

Query  356  CKTELQ  361
            C  + Q
Sbjct  243  CAVKRQ  248



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01450.1.1 SNF2

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF02_DROME  unnamed protein product                                 831     0.0  
Q54M42_DICDI  unnamed protein product                                 747     0.0  
Q57UN8_TRYB2  unnamed protein product                                 247     6e-69


>Q9VF02_DROME unnamed protein product
Length=1923

 Score = 831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/793 (56%), Positives = 541/793 (68%), Gaps = 106/793 (13%)

Query  1     MGARCLSILATLQPNAVMSTVLSQVLPLLNASQPDIVRQGAVEALCNILDKMELKAVPYL  60
             M ARC+++LA +     M  V+  +LPLL   +  I RQGA+EA+  ++ ++++K VPY+
Sbjct  1211  MAARCIAVLAEIDACQTMQFVVHDLLPLLGKIEQLIERQGAIEAIERVVSRLQIKVVPYI  1270

Query  61    ILLVVPLLGRVSDQDTWVRLGATSCFATCIHLMPLDSALGTSTPSNSTQVCSSLHLPAD-  119
             +LLVVPLLG +SD D  VRL +T CFA  + LMPLD                +  L +D 
Sbjct  1271  VLLVVPLLGAMSDPDESVRLLSTHCFANLVQLMPLDG--------------KTEQLKSDP  1316

Query  120   LASRKASESRFLEQLFDPSRIPDFTLPSALGLTVTLRSYQQAGVNWLWFLRRYNLHGILC  179
             L +RK  +  FL+ LF+P  IP++ +P  + ++V LR YQQAG+NWLWFL +YNLHGILC
Sbjct  1317  LQARKTRDREFLDYLFNPKSIPNYKVP--VPISVELRCYQQAGINWLWFLNKYNLHGILC  1374

Query  180   DDMGLGKTLQSICVLAGDQWCRHEEEGEETRLPSLVVCPPTLTGHWMYEVLKFL-PNKFL  238
             DDMGLGKTLQ+IC+LAGD    H +      LPSLV+CPPTLTGHW+YEV KFL     L
Sbjct  1375  DDMGLGKTLQTICILAGDHM--HRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVL  1432

Query  239   NPLQYAGPPHEREKLRSRM-KEHNLIIASYDIIRKDNHVFSEVQWNYCILDEGHVIKNDK  297
              PL Y G P  REKLRS +  + NL++ASYD +RKD   FS + +NYC+LDEGH+IKN K
Sbjct  1433  RPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGK  1492

Query  298   AKSTRAIKSLRANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTPIQNNVLELWSLFDFL  357
              KS++AIK L+ANHRLILSGTPIQ                       NNVLELWSLFDFL
Sbjct  1493  TKSSKAIKRLKANHRLILSGTPIQ-----------------------NNVLELWSLFDFL  1529

Query  358   MPGFLGTPIQNNVLELWSLFDFLMPGFLGTEKQFASRYARPILASRDPKSSPRDQEAGVL  417
             MP                       GFLGTEKQF  R++RPIL+SRD KSS ++QEAGVL
Sbjct  1530  MP-----------------------GFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVL  1566

Query  418   AMEALHRQVLPLVLRRVKQDVLKDLPPKITQDYYCDLSPLQEKLYQDFARMKNLDLND--  475
             AMEALHRQVLP +LRRVK+DVLKDLPPKITQD  C+LSPLQ +LY+DF+     D  D  
Sbjct  1567  AMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKL  1626

Query  476   --------VKQN-----HVFQSLRYLQSVCNHPKLVLGPSH--AQYEALVSRPGLNLSDI  520
                     V +N     H+FQ+LRYLQ+VCNHPKLVL  S    +  + ++    +L DI
Sbjct  1627  GDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTKVTSQLALSNSSLDDI  1686

Query  521   RHAAKLPALKQLLMDCGIGASPGMSGSGPHYDPGAPPPSILTQHRALIFCQLRAMLDIVE  580
              H+AKLPALKQLL+DCGIG                     ++QHRALIFCQL+AMLDIVE
Sbjct  1687  EHSAKLPALKQLLLDCGIGVQ----------------TESVSQHRALIFCQLKAMLDIVE  1730

Query  581   NDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTV  640
              DL +  +P VTYLRLDGSV ++ R  IV  FNSDP+IDVLLLTT VGGLGLNLTGADTV
Sbjct  1731  QDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTV  1790

Query  641   IFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTANTVINS  700
             IFV+HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT+N+LEEKIM LQKFK+LTANTV+++
Sbjct  1791  IFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSA  1850

Query  701   ENRNLDTMATGKILDLFCLDGQDSRQEAGSS---GTNPGG--LKGLLDTLPELWDEREYE  755
             EN +L TM T +I DLF   G+D   E+GSS   GT  GG  +  +++ LPELW E +YE
Sbjct  1851  ENASLQTMGTSQIFDLFN-GGKDKGAESGSSAVQGTASGGMSMNTIIENLPELWSEHQYE  1909

Query  756   EEYDLSNFVQSLN  768
             EEYDL NFVQ+L 
Sbjct  1910  EEYDLGNFVQALK  1922


>Q54M42_DICDI unnamed protein product
Length=2005

 Score = 747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/829 (49%), Positives = 520/829 (63%), Gaps = 120/829 (14%)

Query  1     MGARCLSILATLQPNAVMSTVLSQVLPLLNASQPDIVRQGAVEALCNILDKMELKAVPYL  60
             M ++C++    +     M  ++  +LPLL  ++    R GA+  +  I+  M+++ +PY+
Sbjct  1236  MASKCIARYCQILTLPSMRFLIRNLLPLLGDTRSLTNRMGAINTVSQIIRDMDMQILPYI  1295

Query  61    ILLVVPLLGRVSDQDTWVRLGATSCFATCIHLMPLDSALGTSTPSNSTQVCSSLHLPADL  120
             +   +P+LG +SDQD   R  AT CFA  + LMPL+   G   P           L  DL
Sbjct  1296  VFFTIPILGCMSDQDPDQRRVATLCFAKLVKLMPLEK--GVPDPEG---------LDQDL  1344

Query  121   ASRKASESRFLEQLFDPSRIPDFTLPSALGLTVTLRSYQQAGVNWLWFLRRYNLHGILCD  180
               +K  E +FLEQL D S++ ++ LP  + +   LR YQQ GVNWL FL +Y LHGILCD
Sbjct  1345  IQQKQEERKFLEQLLDGSKVENYPLP--IRINTELRKYQQDGVNWLAFLNKYKLHGILCD  1402

Query  181   DMGLGKTLQSICVLAGDQWCR---HEEEG--EETRLPSLVVCPPTLTGHWMYEVLKFLPN  235
             DMGLGKTLQ+IC++AGD + R   ++E+G  +   LPSLV+CPP+L GHW YE+ KF  +
Sbjct  1403  DMGLGKTLQTICIIAGDDYHRRVNYQEKGTPDFAPLPSLVICPPSLVGHWFYEIKKFCSD  1462

Query  236   KFLNPLQYAGPPHEREKLRSRMKEHNLIIASYDIIRKDNHVFSEVQWNYCILDEGHVIKN  295
               + P+ Y G P ER+  RS+ K+HN++I SYDI+R D  + SE+ +NYCILDEGH+IKN
Sbjct  1463  STMKPMTYMGNPSERQAQRSKFKDHNVLIMSYDIMRNDIDILSEMHFNYCILDEGHIIKN  1522

Query  296   DKAKSTRAIKSLRANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTPIQNNVLELWSLFD  355
              K K T+A K L++NHRLILSGTPIQ                       NNVLELWSLFD
Sbjct  1523  AKTKLTQAAKRLQSNHRLILSGTPIQ-----------------------NNVLELWSLFD  1559

Query  356   FLMPGFLGTPIQNNVLELWSLFDFLMPGFLGTEKQFASRYARPILASRDPKSSPRDQEAG  415
             FLMP                       GFLGTEK F   Y++PILAS+DPK S +DQEAG
Sbjct  1560  FLMP-----------------------GFLGTEKLFNELYSKPILASKDPKCSTKDQEAG  1596

Query  416   VLAMEALHRQVLPLVLRRVKQDVLKDLPPKITQDYYCDLSPLQEKLYQDFAR--MKNLDL  473
             VLAMEALHRQVLP +LRR+K+DVL DLPPKI QD YC+LSPLQ +LY  F+R   K    
Sbjct  1597  VLAMEALHRQVLPFLLRRLKEDVLADLPPKIIQDRYCNLSPLQIRLYDYFSRTQFKETIK  1656

Query  474   NDVKQ----------------------NHVFQSLRYLQSVCNHPKLVLGPSHAQYEALVS  511
             N+V+                        H+FQ+L+YL+ +C HP  VL P H QY +++ 
Sbjct  1657  NEVEDENEDADEGGESKKKKGGNGGGATHIFQALQYLRKLCGHPSFVLNPEHPQYPSIMK  1716

Query  512   RPGL---NLSDIRHAAKLPALKQLLMDCGIGAS-----PGMSGSGPHYDPGAPPPSI---  560
                L   ++ DI H+ KL +LK+LL++CGIG S          S           +I   
Sbjct  1717  EFKLQPNDILDIAHSPKLVSLKELLLECGIGLSNVQQQQHQQQSKAAIAAATANETINES  1776

Query  561   LTQHRALIFCQLRAMLDIVENDLFKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDV  620
               QHR LIF Q+++MLDIVEN+LFK  +P VTYLR+DGSV +  RH+IV +FNSDPTIDV
Sbjct  1777  TNQHRVLIFAQMKSMLDIVENELFKKHLPSVTYLRMDGSVETMKRHSIVNQFNSDPTIDV  1836

Query  621   LLLTTQVGGLGLNLTGADTVIFVDHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLE  680
             LLLTT VGGLGLNLTGADTVIF++HDW+PMKDLQAMDRAHRIGQKKVVNVYRLIT  TLE
Sbjct  1837  LLLTTHVGGLGLNLTGADTVIFLEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITSGTLE  1896

Query  681   EKIMNLQKFKLLTANTVINSENRNLDTMATGKILDLFCL-DGQDSRQEAGS---------  730
             EKIM LQKFKL  ANTVIN +N +L TM+T ++L+LF   D Q S+Q   +         
Sbjct  1897  EKIMGLQKFKLNIANTVINHDNSSLQTMSTNELLNLFDYSDDQKSQQSKSTNLADYNNES  1956

Query  731   -----------SGTNPGGLKGLLDTLPELWDEREYEEEYDLSNFVQSLN  768
                        S  + G LK +LD+L ELWDE +Y EE++L+NF+  L+
Sbjct  1957  SISDTGEVTNNSNASGGKLKNILDSLGELWDESQYTEEFNLNNFMNQLS  2005


>Q57UN8_TRYB2 unnamed protein product
Length=1126

 Score = 247 bits (630),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 183/596 (31%), Positives = 265/596 (44%), Gaps = 113/596 (19%)

Query  158  YQQAGVNWLWFLRRYNLHGILCDDMGLGKTLQSICVLAGDQWCRHEEEGEETRLPSLVVC  217
            +Q+ G+ WL  L R  + GIL DDMGLGKT+Q   +L       H     + R PSL+V 
Sbjct  411  HQRDGLRWLLNLHRQRVGGILGDDMGLGKTIQIAAMLNA---LNH---SNQLRGPSLIVT  464

Query  218  PPTLTGHWMYEVLKFLPNKFLNPLQYAGPPH-EREKLRSRMKEH-NLIIASYDIIRKDNH  275
            P T+   W+ E+ ++ P      +  +      REKL   ++    +++ +Y  +R+   
Sbjct  465  PVTVLRQWVAEMHRWAPYVRTCVMHASSASTISREKLIDSVRGTPAVLLTTYAAVREHCR  524

Query  276  VFSEVQWNYCILDEGHVIKNDKAKSTRAIKSLRANHRLILSGTPIQNNVLELWSLFDFLM  335
            +     + Y ILDEGH I N +A  T A KS    HRLILSG                  
Sbjct  525  LLHNACFQYVILDEGHKISNPEATVTIAAKSFPTPHRLILSG------------------  566

Query  336  PGFLGTPIQNNVLELWSLFDFLMPGFLGTPIQNNVLELWSLFDFLMPGFLGTEKQFASRY  395
                                        TP+QN + ELW LFDF+ PG LGT ++F   +
Sbjct  567  ----------------------------TPVQNTLKELWCLFDFVKPGLLGTLRRFEEEF  598

Query  396  ARPILASRDPKSSPRDQEAGVLAMEALHRQVLPLVLRRVKQDVLKD-LPPKITQDYYCDL  454
              PI AS++ ++SP            LH  + P +LRR+K+ V+ D LP K  +   C L
Sbjct  599  EVPINASKNIRASPLALATAAETARVLHESISPFLLRRLKKQVMSDSLPEKYERVIRCPL  658

Query  455  SPLQEKLYQD-----------------------------------------FARMKNLDL  473
            S  Q + Y D                                         F  M++ + 
Sbjct  659  SDSQLEAYVDLLSSSRVQRLMSNTLSYTQLMGGLDRDGRDASGCLHIAGKRFQLMRDKEN  718

Query  474  NDVKQNHVFQSLRYLQSVCNHPKLVLGPSHAQYEALVSRPGLNLSDIRHAAKLPALKQLL  533
              V ++ +F  +  L+ +CNH  +        +            D+ +A    A K   
Sbjct  719  KGVVRHELFCVMHELRQICNHVDIFHMRQAKDFNYTDDMENNFFLDVVNAPTATARKA--  776

Query  534  MDCGIGASP-GMSGSGPHYDPGAPPPSILTQ---------HRALIFCQLRAMLDIVENDL  583
               G G +   M  + P    G+     L Q          RAL+F Q RAMLDI+EN  
Sbjct  777  --GGKGTTHFSMRSNRPVNYEGSSKLQTLRQLLKLWQRGGQRALVFSQTRAMLDIIEN--  832

Query  584  FKCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFV  643
              CE   +TY+R+DG+  S  R  ++ +FN D  I V LLTT+VGG+G+NL GAD V+  
Sbjct  833  -MCEQESLTYIRMDGTTNSLRRQELMDRFNEDDRIVVALLTTRVGGVGVNLIGADRVVIF  891

Query  644  DHDWSPMKDLQAMDRAHRIGQKKVVNVYRLITKNTLEEKIMNLQKFKLLTANTVIN  699
            D DW+P+ D QA +RA RIGQ + V VYRLI+  T+EE ++  Q  K      V++
Sbjct  892  DPDWNPVTDEQARERAWRIGQTRDVGVYRLISSGTVEEAVLRRQLAKTYVTEKVLH  947



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01460.1.1 Odorant

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBQ3_DROME  unnamed protein product                                 28.5    2.2  
A1ZBQ4_DROME  unnamed protein product                                 28.5    2.4  
RBP1_PLAF7  unnamed protein product                                   28.9    3.2  


>A1ZBQ3_DROME unnamed protein product
Length=131

 Score = 28.5 bits (62),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  145  NMKKKIYCVNECIGKKQELLNEDGSLNQEKIQAYVTAENFK  185
            + K  + C ++CI  K   ++  G L  +KI++Y    NFK
Sbjct  58   DAKDNVKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFK  98


>A1ZBQ4_DROME unnamed protein product
Length=132

 Score = 28.5 bits (62),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  145  NMKKKIYCVNECIGKKQELLNEDGSLNQEKIQAYVTAENFK  185
            + K  + C ++CI  K   ++  G L  +KI++Y    NFK
Sbjct  59   DAKDNVKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFK  99


>RBP1_PLAF7 unnamed protein product
Length=2971

 Score = 28.9 bits (63),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 36/69 (52%), Gaps = 9/69 (13%)

Query  96   DDNLMKKFIEKDKSIGKSCYRNVSAKMDELKTNQQMGDPMDFFSCEGLKNMKKKIYCVNE  155
            ++N MK++I   ++I K  Y N+ AK  E+++ Q      DF +       +K IY + E
Sbjct  841  ENNNMKQYITTIRNIQKIYYDNIYAKEKEIRSGQYYK---DFITS------RKNIYNIRE  891

Query  156  CIGKKQELL  164
             I K  +++
Sbjct  892  NISKNVDMI  900



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01470.1.1 Transcription

Length=156
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DICH_DROME  unnamed protein product                                   162     3e-49
Q9VUD1_DROME  unnamed protein product                                 157     3e-47
M9PFG6_DROME  unnamed protein product                                 158     3e-47


>DICH_DROME unnamed protein product
Length=382

 Score = 162 bits (410),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)

Query  27   EQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSEISKRLGAEWKLLTEMEKRPFIDEAKRL  86
            E HIKRPMNAFMVWSR+QRR+IA DNPKMHNSEISKRLGAEWKLL E EKRPFIDEAKRL
Sbjct  139  EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRL  198

Query  87   RAMHMKEHPDYKYRPRRKPKTP  108
            RA+HMKEHPDYKYRPRRKPK P
Sbjct  199  RALHMKEHPDYKYRPRRKPKNP  220


>Q9VUD1_DROME unnamed protein product
Length=388

 Score = 157 bits (398),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 79/87 (91%), Gaps = 1/87 (1%)

Query  21   SHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSEISKRLGAEWKLLTEMEKRPFI  80
            SH N    HIKRPMNAFMVWSR QRRK+A DNPKMHNSEISKRLGAEWKLLTE +KRPFI
Sbjct  113  SHHN-SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFI  171

Query  81   DEAKRLRAMHMKEHPDYKYRPRRKPKT  107
            DEAKRLRA+HMKEHPDYKYRPRRKPKT
Sbjct  172  DEAKRLRALHMKEHPDYKYRPRRKPKT  198


>M9PFG6_DROME unnamed protein product
Length=407

 Score = 158 bits (399),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 0/80 (0%)

Query  28   QHIKRPMNAFMVWSRIQRRKIALDNPKMHNSEISKRLGAEWKLLTEMEKRPFIDEAKRLR  87
             HIKRPMNAFMVWSR QRRK+A DNPKMHNSEISKRLGAEWKLLTE +KRPFIDEAKRLR
Sbjct  119  DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLR  178

Query  88   AMHMKEHPDYKYRPRRKPKT  107
            A+HMKEHPDYKYRPRRKPKT
Sbjct  179  ALHMKEHPDYKYRPRRKPKT  198



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01480.1.1 Carboxylic

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24201_DROME  unnamed protein product                                 221     1e-64
Q9VIB5_DROME  unnamed protein product                                 221     3e-64
Q24195_DROME  unnamed protein product                                 216     2e-62


>Q24201_DROME unnamed protein product
Length=556

 Score = 221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 160/517 (31%), Positives = 246/517 (48%), Gaps = 67/517 (13%)

Query  39   GKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCPQI  98
            G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C Q 
Sbjct  24   GQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWEG-------VRDCSQP  75

Query  99   FDASSNIE-VLTSTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSS  157
             D +  ++ V    E  EDCLYLNVYT     NV   +A     PV+ +IHGG F +G +
Sbjct  76   KDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIGEA  127

Query  158  HS--MTPHYLLEKDVVLVTIQYRLGILGFLSLETNE--IPGNMGFLDMLLALEWVNDHIR  213
            +     P Y +++DVVLVTIQYRLG LGF+SL++ E  +PGN G  D +LAL+W+ ++  
Sbjct  128  NREWYGPDYFMKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCA  187

Query  214  SFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDDLFHRAIIQSGSGLCDWSFENETGMGRQ  273
            SF GD NC+T+ G+SAGGA+  + + +   +  LFHR I+QSGS +C W++  +      
Sbjct  188  SFGGDPNCITVFGESAGGASTHYMMLTDQTQ-GLFHRGILQSGSAICPWAYNGDITHNPY  246

Query  274  FIEDLGCRLDNVDDSFVAECLRRKSLSDLFKTYYSM--------EYGGKFCQAVKQTHGK  325
             I  L       +D  V E L+     DL +   ++        +   +F  +++     
Sbjct  247  RIAKLVGYKGEDNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFRFGPSLEPFSTP  306

Query  326  KRFLTETPEESFAKGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLA  385
            +  +++ P+E        ++P+ +G T +EG         +LW   +           L 
Sbjct  307  ECVISKPPKEMMKTAWSNSIPMFIGNTSYEG---------LLWVPEV----------KLM  347

Query  386  HQFMEYTRLDVSAIVSHLVETQYFSQNY----ATMKDVIPAMSDLAGLAVLKSC-----V  436
             Q ++        I   L+ T+   +      A ++DV    S+      +  C     V
Sbjct  348  PQVLQQLDAGTPFIPKELLATEPSKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFV  407

Query  437  FHTARLLSSMH-----NSTFLYSFHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWD  491
            F   R++ S H        + Y + F       F YR     R   GV+H+DDL Y F  
Sbjct  408  FPALRVVHSRHAYAAGAPVYFYRYDFDSE-ELIFPYRIMRMGRGVKGVSHADDLSYQFSS  466

Query  492  ---PTMPLNDREQKQARTMVDLWTNFATYGYPFSEDV  525
                 +P   RE +     V +WT FA  G P+SE +
Sbjct  467  LLARRLPKESREYRNIERTVGIWTQFAATGNPYSEKI  503


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 162/517 (31%), Positives = 246/517 (48%), Gaps = 67/517 (13%)

Query  39   GKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCPQI  98
            G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C Q 
Sbjct  40   GQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWER-------VRDCSQP  91

Query  99   FDASSNIE-VLTSTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSS  157
             D +  ++ V    E  EDCLYLNVYT     NV   +A     PV+ +IHGG F +G +
Sbjct  92   KDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIGEA  143

Query  158  HS--MTPHYLLEKDVVLVTIQYRLGILGFLSLETNE--IPGNMGFLDMLLALEWVNDHIR  213
            +     P Y +++DVVLVTIQYRLG LGF+SL++ E  +PGN G  D +LAL+W+ ++  
Sbjct  144  NREWYGPDYFMKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCA  203

Query  214  SFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDDLFHRAIIQSGSGLCDWSFENETGMGRQ  273
            SF GD NC+T+ G+SAGGA+  + + +   +  LFHR I+QSGS +C W++  +      
Sbjct  204  SFGGDPNCITVFGESAGGASTHYMMLTDQTQ-GLFHRGILQSGSAICPWAYNGDITHNPY  262

Query  274  FIEDLGCRLDNVDDSFVAECLRRKSLSDLFKTYYSM----EYGGK----FCQAVKQTHGK  325
             I  L       +D  V E L+     DL +   ++    E   K    F  +++     
Sbjct  263  RIAKLVGYKGEDNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFAFGPSLEPFSTP  322

Query  326  KRFLTETPEESFAKGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLA  385
            +  +++ P+E        ++P+ +G T +EG         +LW   +           L 
Sbjct  323  ECVISKPPKEMMKTAWSNSIPMFIGNTSYEG---------LLWVPEV----------KLM  363

Query  386  HQFMEYTRLDVSAIVSHLVETQYFSQNY----ATMKDVIPAMSDLAGLAVLKSC-----V  436
             Q ++        I   L+ T+   +      A ++DV    S+      +  C     V
Sbjct  364  PQVLQQLDAGTPFIPKELLATEPSKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFV  423

Query  437  FHTARLLSSMH-----NSTFLYSFHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWD  491
            F   R++ S H        + Y + F       F YR     R   GV+H+DDL Y F  
Sbjct  424  FPALRVVHSRHAYAAGAPVYFYRYDFDSE-ELIFPYRIMRLGRGVKGVSHADDLSYQFSS  482

Query  492  ---PTMPLNDREQKQARTMVDLWTNFATYGYPFSEDV  525
                 +P   RE +     V +WT FA  G P+SE +
Sbjct  483  LLARRLPKESREYRNIERTVGIWTQFAATGNPYSEKI  519


>Q24195_DROME unnamed protein product
Length=554

 Score = 216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 153/503 (30%), Positives = 250/503 (50%), Gaps = 47/503 (9%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            K G+VRG    + + K   ++F+GIPYA PPVG +RF++P+P +PW   LN T+ + +  
Sbjct  26   KYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPM  85

Query  97   QIFDASSNIEVLTSTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVG-  155
            Q      N+ +L   E  EDCL+LNVY   +         S+K  PVI +I+GG F+ G 
Sbjct  86   Q-----RNM-LLGIVEGSEDCLHLNVYVKALK--------SEKPLPVIVWIYGGGFQKGE  131

Query  156  -SSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETN--EIPGNMGFLDMLLALEWVNDHI  212
             S    +P Y ++K VV V I YRL  LGFLSL+    ++PGN G  D ++AL W++ +I
Sbjct  132  ASRDIYSPDYFMKKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNI  191

Query  213  RSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDDLFHRAIIQSGSGLCDWSFENETGMGR  272
              FNGD N +TLMG+SAG A+V   +T+   R  LFH+AI+QSG  L +W    +     
Sbjct  192  AQFNGDPNNITLMGESAGSASVHVMMTTEQTR-GLFHKAIMQSGCALSEWVESPDNNWAF  250

Query  273  QFIEDLGCRLDNVDD---SFVAECLRRKSLS--------DLFKTYYSMEYGGKFCQAVKQ  321
            +  ++LG   D  D    SF+++   R+  +        D  +++    +G      ++ 
Sbjct  251  RLAQNLGYMGDEKDADVLSFLSKVSARQIAAIDQDVINLDEVRSFLLFAFG----PVIEP  306

Query  322  THGKKRFLTETPEESFAKGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKV  381
                     + P++  ++    ++PV++G    EG    ++V +  W    ++NF +   
Sbjct  307  YETDHCVWPKRPKDLLSEAWGNDIPVIVGGNSFEGLFSYQLVRKDPW---ALKNFHNI--  361

Query  382  QDLAHQFMEYTRLDVSAIVSHLVETQYFSQNYATMKDVIPAMSDLAGLAVLKSC-VFHTA  440
              L  +  E + L+   ++   ++  YF+       ++  A++  +   +      F  A
Sbjct  362  --LPREVRETSSLEGQDLLVRRLKQLYFNNEMQESMEMFEALNIFSHRQIWHDTHRFILA  419

Query  441  RLLSSMHNSTFLYSFHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWDPTMPLNDR-  499
            R   +    T+LY F F      + + R         GVAH+D+L YLF++      D+ 
Sbjct  420  RQSYAPKTPTYLYRFDFDS--PHFNQXRRLVCGDRIRGVAHADELSYLFYNIIASKLDKS  477

Query  500  --EQKQARTMVDLWTNFATYGYP  520
              E K    MV +WT+FA+ G P
Sbjct  478  SMEYKTIERMVGMWTSFASSGNP  500



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01490.1.1 Venom

Length=330
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BMT7_DROME  unnamed protein product                                 66.2    8e-12
A1ZA98_DROME  unnamed protein product                                 66.2    9e-12
GLT_DROME  unnamed protein product                                    53.9    1e-07


>Q9BMT7_DROME unnamed protein product
Length=574

 Score = 66.2 bits (160),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 111/250 (44%), Gaps = 18/250 (7%)

Query  15   NVDDSFVAECLRRKSLSDLFKT-----YYSMEYGGKFCQAVKQTHGKKRFLTETPEESFA  69
            N+    + + LRR + + L        Y+ +++   F   V++      FL   P +  A
Sbjct  270  NLSTVKLTKALRRINATKLLNAGDGLKYWDVDHMTNFRPVVEEGLEVDAFLNAHPMDMLA  329

Query  70   KGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLAHQFMEYT---RLD  126
            +G   ++P+LLG    EG+     V  +L ++ + ++F + +  +L  + +E+      D
Sbjct  330  QGMPTSIPLLLGTVPGEGAV---RVVNILGNETLRQSF-NLRFDELLQELLEFPASFSQD  385

Query  127  VSAIVSHLVETQYFSQNYATMKDVIPAMSDLAGLAVLKSCVFHTA-RLLSSMHNSTFLYS  185
                +  L+   YF   +   +  +    +L      K  +++T  + +    N  +LYS
Sbjct  386  RREKMMDLLVEVYFQGQHEVNELTVQGFMNLISDRGFKQPLYNTIHKNVCHTPNPVYLYS  445

Query  186  FHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWDPTM----PLNDREQKQARTMVDL  241
            F+++G  +    Y   N +   +GV H DDL+YLF  P +      N  E K   + VD 
Sbjct  446  FNYQGPLSYASAYTSANVTG-KYGVVHCDDLLYLFRSPLLFPDFQRNSTEAKVIHSFVDY  504

Query  242  WTNFATYGYP  251
            + +FA +G P
Sbjct  505  FVHFAKFGKP  514


>A1ZA98_DROME unnamed protein product
Length=579

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 111/250 (44%), Gaps = 18/250 (7%)

Query  15   NVDDSFVAECLRRKSLSDLFKT-----YYSMEYGGKFCQAVKQTHGKKRFLTETPEESFA  69
            N+    + + LRR + + L        Y+ +++   F   V++      FL   P +  A
Sbjct  275  NLSTVKLTKALRRINATKLLNAGDGLKYWDVDHMTNFRPVVEEGLEVDAFLNAHPMDMLA  334

Query  70   KGAVKNVPVLLGVTKHEGSSFLEVVFRVLWDDPIVENFTDFKVQDLAHQFMEYT---RLD  126
            +G   ++P+LLG    EG+     V  +L ++ + ++F + +  +L  + +E+      D
Sbjct  335  QGMPTSIPLLLGTVPGEGAV---RVVNILGNETLRQSF-NLRFDELLQELLEFPASFSQD  390

Query  127  VSAIVSHLVETQYFSQNYATMKDVIPAMSDLAGLAVLKSCVFHTA-RLLSSMHNSTFLYS  185
                +  L+   YF   +   +  +    +L      K  +++T  + +    N  +LYS
Sbjct  391  RREKMMDLLVEVYFQGQHEVNELTVQGFMNLISDRGFKQPLYNTIHKNVCHTPNPVYLYS  450

Query  186  FHFKGRFTKYFEYRDKNDSRFPHGVAHSDDLIYLFWDPTM----PLNDREQKQARTMVDL  241
            F+++G  +    Y   N +   +GV H DDL+YLF  P +      N  E K   + VD 
Sbjct  451  FNYQGPLSYASAYTSANVTG-KYGVVHCDDLLYLFRSPLLFPDFQRNSTEAKVIHSFVDY  509

Query  242  WTNFATYGYP  251
            + +FA +G P
Sbjct  510  FVHFAKFGKP  519


>GLT_DROME unnamed protein product
Length=1026

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 42/140 (30%), Positives = 68/140 (49%), Gaps = 21/140 (15%)

Query  142  QNYATMKDVIPAMSDLAGLAVLKSCVFHTARLLSSMHNS-----TFLYSFHFKGRFTKYF  196
            +  A+++ V P      GL  L + + + A +++S+  S      +LY+F ++G   ++ 
Sbjct  437  EQTASLQTVAP------GLLELSNYILYRAPVINSISQSYRSVPAYLYTFDYRGEHHRFG  490

Query  197  EYRDKNDSRFPHGV--AHSDDLIYLFWDP--TMPLNDREQKQARTMVDLWTNFATYGYPF  252
               +      P GV  + SDD +YLF  P     LN  ++  +R +V +W NFAT G P 
Sbjct  491  HLSNP----LPFGVDASLSDDSVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVP-  545

Query  253  SEDVPDWQPVANDSLGPFLR  272
            +     W P A    GPFLR
Sbjct  546  NPSSGVW-PQATSEYGPFLR  564



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01500.1.1 Carboxylic

Length=243
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24201_DROME  unnamed protein product                                 151     2e-42
Q9VIB5_DROME  unnamed protein product                                 151     3e-42
Q24195_DROME  unnamed protein product                                 148     2e-41


>Q24201_DROME unnamed protein product
Length=556

 Score = 151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 123/200 (62%), Gaps = 22/200 (11%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            + G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C 
Sbjct  22   EYGQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWEG-------VRDCS  73

Query  97   QIFDASSNIE-VLTSTEALEDCLYLNVYTPMISSNVNQTEASQKLFPVIFYIHGGSFRVG  155
            Q  D +  ++ V    E  EDCLYLNVYT    +NV   +A     PV+ +IHGG F +G
Sbjct  74   QPKDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIG  125

Query  156  SSHS--MTPHYLLEKDVVLVTIQYRLGYWVSFLSLETNE--IPGNMGFLDMLLALEWVND  211
             ++     P Y +++DVVLVTIQYRLG  + F+SL++ E  +PGN G  D +LAL+W+ +
Sbjct  126  EANREWYGPDYFMKEDVVLVTIQYRLGA-LGFMSLKSPELNVPGNAGLKDQVLALKWIKN  184

Query  212  HIRSFNGDKNCVTLMGQSAG  231
            +  SF GD NC+T+ G+SAG
Sbjct  185  NCASFGGDPNCITVFGESAG  204


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 123/200 (62%), Gaps = 22/200 (11%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            + G+VRG   +S +     +SF+GIPYA PPVG++RF++P+   PW          R C 
Sbjct  38   EYGQVRGIKRLSLYDVPY-FSFEGIPYAQPPVGELRFKAPQRPIPWER-------VRDCS  89

Query  97   QIFDASSNIE-VLTSTEALEDCLYLNVYTPMISSNVNQTEASQKLFPVIFYIHGGSFRVG  155
            Q  D +  ++ V    E  EDCLYLNVYT    +NV   +A     PV+ +IHGG F +G
Sbjct  90   QPKDKAVQVQFVFDKVEGSEDCLYLNVYT----NNVKPDKAR----PVMVWIHGGGFIIG  141

Query  156  SSHS--MTPHYLLEKDVVLVTIQYRLGYWVSFLSLETNE--IPGNMGFLDMLLALEWVND  211
             ++     P Y +++DVVLVTIQYRLG  + F+SL++ E  +PGN G  D +LAL+W+ +
Sbjct  142  EANREWYGPDYFMKEDVVLVTIQYRLGA-LGFMSLKSPELNVPGNAGLKDQVLALKWIKN  200

Query  212  HIRSFNGDKNCVTLMGQSAG  231
            +  SF GD NC+T+ G+SAG
Sbjct  201  NCASFGGDPNCITVFGESAG  220


>Q24195_DROME unnamed protein product
Length=554

 Score = 148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 119/199 (60%), Gaps = 19/199 (10%)

Query  37   KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQSPRPAQPWTTPLNATSLKRRCP  96
            K G+VRG    + + K   ++F+GIPYA PPVG +RF++P+P +PW   LN T+ + +  
Sbjct  26   KYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPM  85

Query  97   QIFDASSNIEVLTSTEALEDCLYLNVYTPMISSNVNQTEASQKLFPVIFYIHGGSFRVG-  155
            Q      N+ +L   E  EDCL+LNVY   +         S+K  PVI +I+GG F+ G 
Sbjct  86   Q-----RNM-LLGIVEGSEDCLHLNVYVKALK--------SEKPLPVIVWIYGGGFQKGE  131

Query  156  -SSHSMTPHYLLEKDVVLVTIQYRLGYWVSFLSLETN--EIPGNMGFLDMLLALEWVNDH  212
             S    +P Y ++K VV V I YRL   + FLSL+    ++PGN G  D ++AL W++ +
Sbjct  132  ASRDIYSPDYFMKKPVVFVAINYRLAA-LGFLSLKDPKLDVPGNAGLKDQVMALRWISQN  190

Query  213  IRSFNGDKNCVTLMGQSAG  231
            I  FNGD N +TLMG+SAG
Sbjct  191  IAQFNGDPNNITLMGESAG  209



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01510.1.1 Unknown

Length=93
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960G6_DROME  unnamed protein product                                 26.9    3.0  
Q8IPN1_DROME  unnamed protein product                                 26.6    4.0  
Q9VN51_DROME  unnamed protein product                                 26.6    4.0  


>Q960G6_DROME unnamed protein product
Length=2409

 Score = 26.9 bits (58),  Expect = 3.0, Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 20/38 (53%), Gaps = 1/38 (3%)

Query  44  RMTFRI-RRELLEMEQYHGKNTFVFKNDTKMQTTYLSQ  80
           +M F + +R  L   Q H  +   F  + ++QTTY SQ
Sbjct  9   QMAFSVSQRSCLPSHQVHSSDRVQFWQEVQVQTTYTSQ  46


>Q8IPN1_DROME unnamed protein product
Length=1226

 Score = 26.6 bits (57),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  17   SDSKTEKG--QITGAAGTMNSMKNFGLKQRMTFRIRRELLEMEQYHGKNTFVFKNDTKMQ  74
            ++ K++KG   I  ++    S+ +   KQR TF + +   E E+   + TF  +N+   +
Sbjct  639  TEDKSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCMENENPRR  698

Query  75   TTYLSQ  80
            T  + Q
Sbjct  699  TFCMQQ  704


>Q9VN51_DROME unnamed protein product
Length=1227

 Score = 26.6 bits (57),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  17   SDSKTEKG--QITGAAGTMNSMKNFGLKQRMTFRIRRELLEMEQYHGKNTFVFKNDTKMQ  74
            ++ K++KG   I  ++    S+ +   KQR TF + +   E E+   + TF  +N+   +
Sbjct  639  TEDKSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCMENENPRR  698

Query  75   TTYLSQ  80
            T  + Q
Sbjct  699  TFCMQQ  704



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01520.1.1 Unknown

Length=113
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q385K2_TRYB2  unnamed protein product                                 28.1    1.6  
Q5LJN5_DROME  unnamed protein product                                 27.7    2.2  
Q9U3Y5_DROME  unnamed protein product                                 26.2    9.6  


>Q385K2_TRYB2 unnamed protein product
Length=408

 Score = 28.1 bits (61),  Expect = 1.6, Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 3/92 (3%)

Query  8    YDFRETRKHQGSSLPYLFSKVKRMPEGLRSLGAFPVDNGDFDIVSPVTS-DTIAITVLFA  66
            Y  R  +KHQ S  P + + V  +   LR +GA    N +   V   TS    A T    
Sbjct  33   YVERVVQKHQNS--PRVRNSVNYVARKLRQIGAMKTLNPEEHQVGEETSCAKSARTDRKH  90

Query  67   SISPAPLHSRGNGTMKKYKKNTPTINNNVSRL  98
            S SP+P   R    +K  K+N+      + +L
Sbjct  91   SYSPSPFEGRIPAALKSAKRNSEVCKTPMGKL  122


>Q5LJN5_DROME unnamed protein product
Length=4559

 Score = 27.7 bits (60),  Expect = 2.2, Method: Composition-based stats.
 Identities = 15/49 (31%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  3     IRRIVYDFRETRKHQGSSLPYLFSKVKRMPEGLRSLGAFPVDNGDFDIV  51
             +R+  Y+F++T   Q + LP  + KVKR+    + L A P+ +   D++
Sbjct  1249  LRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIA-PIQSYQVDLI  1296


>Q9U3Y5_DROME unnamed protein product
Length=4559

 Score = 26.2 bits (56),  Expect = 9.6, Method: Composition-based stats.
 Identities = 14/49 (29%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  3     IRRIVYDFRETRKHQGSSLPYLFSKVKRMPEGLRSLGAFPVDNGDFDIV  51
             +R+  Y+F++T   Q + LP  + KVKR+    + L A P+ +   +++
Sbjct  1249  LRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIA-PIQSYQVNLI  1296



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01530.1.1 Unknown

Length=90
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VK46_DROME  unnamed protein product                                 32.0    0.039
HS7C3_DICDI  unnamed protein product                                  25.4    8.3  
Q8WSN4_DROME  unnamed protein product                                 25.4    8.8  


>Q9VK46_DROME unnamed protein product
Length=264

 Score = 32.0 bits (71),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  33  MSQFYQPGS--GQMP-QDSSFSFDMPDQYGSELNFQNF  67
           MSQF  P    G  P  D+S++FDMP ++G ELNFQ F
Sbjct  1   MSQFGGPNDFYGSAPSADASYNFDMP-EFGQELNFQTF  37


>HS7C3_DICDI unnamed protein product
Length=630

 Score = 25.4 bits (54),  Expect = 8.3, Method: Composition-based stats.
 Identities = 11/37 (30%), Positives = 21/37 (57%), Gaps = 0/37 (0%)

Query  18   FTLQTSDLIIVLRTKMSQFYQPGSGQMPQDSSFSFDM  54
            F  + SDL  ++   +S+FYQ  +   P  ++F+ D+
Sbjct  593  FNQKISDLESIVNPILSKFYQGNNNPKPTTTTFNQDL  629


>Q8WSN4_DROME unnamed protein product
Length=720

 Score = 25.4 bits (54),  Expect = 8.8, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 15/22 (68%), Gaps = 1/22 (5%)

Query  38   QPGSGQMP-QDSSFSFDMPDQY  58
            +PGSGQMP Q S FS  + + Y
Sbjct  659  EPGSGQMPLQVSQFSIFLKNVY  680



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01540.1.1 Protein

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLP1_DROME  unnamed protein product                                   116     1e-31
A0JL24_DROME  unnamed protein product                                 117     1e-30
Q0E8F8_DROME  unnamed protein product                                 117     1e-30


>SLP1_DROME unnamed protein product
Length=322

 Score = 116 bits (291),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 0/78 (0%)

Query  40   KPPYSYASLIRLAISNAPQGRMTLNEIYQFITHTFPYYREANAGWKNSIRHNLSLNKCFT  99
            KPPYSY +LI +AI ++P+ R+TLN IYQ++ + FPY++    GW+NSIRHNLSLNKCFT
Sbjct  120  KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFT  179

Query  100  KVARPKDDPGKGSYWAID  117
            K+ R  DDPGKG+YW +D
Sbjct  180  KIPRSYDDPGKGNYWILD  197


>A0JL24_DROME unnamed protein product
Length=654

 Score = 117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 82/130 (63%), Gaps = 14/130 (11%)

Query  40   KPPYSYASLIRLAISNAPQGRMTLNEIYQFITHTFPYYR-EANAGWKNSIRHNLSLNKCF  98
            KPPYSYA LI  AIS AP  ++TL+ IY FI   +PYYR E N GW+NSIRHNLSLN+ F
Sbjct  447  KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYF  506

Query  99   TKVARPKDDPGKGSYWAIDYNHTAD--DGPSKKKVK-----------LPRVSPYSPVECN  145
             KVAR +D+PGKGS+W ID +  A   D   KK+ +           +PR +P SP   +
Sbjct  507  IKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMD  566

Query  146  NSNSSSDVHN  155
            NS  SS + +
Sbjct  567  NSRESSPLQD  576


>Q0E8F8_DROME unnamed protein product
Length=740

 Score = 117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 82/130 (63%), Gaps = 14/130 (11%)

Query  40   KPPYSYASLIRLAISNAPQGRMTLNEIYQFITHTFPYYR-EANAGWKNSIRHNLSLNKCF  98
            KPPYSYA LI  AIS AP  ++TL+ IY FI   +PYYR E N GW+NSIRHNLSLN+ F
Sbjct  447  KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYF  506

Query  99   TKVARPKDDPGKGSYWAIDYNHTAD--DGPSKKKVK-----------LPRVSPYSPVECN  145
             KVAR +D+PGKGS+W ID +  A   D   KK+ +           +PR +P SP   +
Sbjct  507  IKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMD  566

Query  146  NSNSSSDVHN  155
            NS  SS + +
Sbjct  567  NSRESSPLQD  576



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01550.1.1 Protein

Length=281
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SY87_DROME  unnamed protein product                                 149     2e-44
Q9VHT3_DROME  unnamed protein product                                 147     1e-43
Q4GYQ3_TRYB2  unnamed protein product                                 132     2e-37


>Q8SY87_DROME unnamed protein product
Length=178

 Score = 149 bits (375),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 117/187 (63%), Gaps = 14/187 (7%)

Query  96   NIRHNWYQTEKQVVVDALIKQAKAETTQVNIDQNSVDIVVTLDPSSSTQHRLHLNLYRPI  155
            ++RH+WYQ+E +VV+  L+K A  +   V I Q  V +       ++  + L L L  PI
Sbjct  2    SVRHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHM-------TADGYELDLKLLHPI  54

Query  156  DPTTSSFRILGTKIEVKLAKTSDERWSDLEAKEETKAPSAPKTPYKRDWDKVA---QQIE  212
                SS++   TK+E+ LAK +  RW +LE        +AP  P  ++WD++    ++I+
Sbjct  55   VVERSSYKAFSTKVEITLAKETGIRWENLEEA----IVAAPVKPKAKNWDQLVSEEEKID  110

Query  213  DEKKEGEAALNELFQKIYGEGSDEVRKAMNKSFLESGGTVLSTNWDEVKRSTVDIKPPEG  272
            D++ +GEAAL  LF+KIY   S EV+KAMNKSF ESGGTVLSTNW+EV +  V +KPP G
Sbjct  111  DKEAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNG  170

Query  273  LEYKKWD  279
             E+++W+
Sbjct  171  TEFREWE  177


>Q9VHT3_DROME unnamed protein product
Length=178

 Score = 147 bits (370),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 117/187 (63%), Gaps = 14/187 (7%)

Query  96   NIRHNWYQTEKQVVVDALIKQAKAETTQVNIDQNSVDIVVTLDPSSSTQHRLHLNLYRPI  155
            ++RH+WYQ+E +VV+  L+K A  +   V I Q  V +       ++  + L L L  PI
Sbjct  2    SVRHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHM-------TADGYELDLKLLHPI  54

Query  156  DPTTSSFRILGTKIEVKLAKTSDERWSDLEAKEETKAPSAPKTPYKRDWDKVA---QQIE  212
                SS++   TK+E+ LAK +  RW +LE        +AP  P  ++WD++    ++I+
Sbjct  55   VVERSSYKAFSTKVEITLAKETGIRWENLEEA----IVAAPVKPKAKNWDQLVSEEEKID  110

Query  213  DEKKEGEAALNELFQKIYGEGSDEVRKAMNKSFLESGGTVLSTNWDEVKRSTVDIKPPEG  272
            +++ +GEAAL  LF+KIY   S EV+KAMNKSF ESGGTVLSTNW+EV +  V +KPP G
Sbjct  111  EKEAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNG  170

Query  273  LEYKKWD  279
             E+++W+
Sbjct  171  TEFREWE  177


>Q4GYQ3_TRYB2 unnamed protein product
Length=221

 Score = 132 bits (331),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 114/220 (52%), Gaps = 22/220 (10%)

Query  82   LEGTAPPPPTPTVQNIRHNWYQTEKQVVVDALIKQAKAETTQVNIDQNSVDIVVTLDPSS  141
            ++ ++     P   N+R  W+QT  QV     +K+ +    + ++ + S+ + + LDPS 
Sbjct  1    MDASSAATTKPFQGNVRCEWFQTPSQVTFTFYVKERQRGDVRADVTEQSLTVSIRLDPSG  60

Query  142  STQHRLHLNLYRPIDPTTSSFRILGTKIEVKLAKTSDERWSDLEAKEETKA---------  192
                      Y P+   +++  I G K+EV++ K  +++W  LEA E+            
Sbjct  61   REYQYNVERFYAPLAEASATINISGMKVEVQVRKAVEQQWPTLEAPEDDVVLPSTSGGTP  120

Query  193  ---------PSAPKTPY----KRDWDKVAQQIEDEKKEGEAALNELFQKIYGEGSDEVRK  239
                      +A   PY     RDW  V    +DEK EG+ ALN LFQKIYG G+DE R+
Sbjct  121  TTSTIAGLPATAKDLPYPNSRGRDWSAVKLDDDDEKPEGDQALNALFQKIYGNGTDEQRR  180

Query  240  AMNKSFLESGGTVLSTNWDEVKRSTVDIKPPEGLEYKKWD  279
            AM KSF+ES GTVLSTNW +V    V  +PP G+E KK++
Sbjct  181  AMMKSFVESNGTVLSTNWADVGNRHVTTEPPTGMEEKKYE  220



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01560.1.1 Collagen

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CO4A1_DROME  unnamed protein product                                  165     1e-43
CO4A1_CAEEL  unnamed protein product                                  128     2e-31
Q9VMV5_DROME  unnamed protein product                                 119     2e-28


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 153/341 (45%), Positives = 179/341 (52%), Gaps = 32/341 (9%)

Query  93   RDSYNRANESSSYYPGRDR-TPYNRTYYERDNFLVVNQRGDSANCTPKCFAEKGSKGAQG  151
            +DS    N +   +P  D     +     R +    N     A C PKC AEKG++G  G
Sbjct  36   QDSVKHYNRNEPKFPIDDSYDIVDSAGVARGDLPPKNCTAGYAGCVPKCIAEKGNRGLPG  95

Query  152  EPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPG  211
              G TG+ G+ GFPG EG  G+KGQ+G P   GP GQ+GD G+ G PG  G  G+ G  G
Sbjct  96   PLGPTGLKGEMGFPGMEGPSGDKGQKGDP---GPYGQRGDKGERGSPGLHGQAGVPGVQG  152

Query  212  IAGLPGAPGL---DGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPAL-TGIHNKG  267
             AG PGAPG+   DGC+G DG PGL GL G  GPRG+ G  G KGEKGEPA   G + KG
Sbjct  153  PAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKG  212

Query  268  QKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGVGFE-----  322
            +KGEP   G  G  G+ G  G PGE G +GD GP G  GP G  G KG  G         
Sbjct  213  EKGEP---GWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKP  269

Query  323  GAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSG  382
            GA G KG KGEP    P    KP+          +GP GD G KG+       GL G  G
Sbjct  270  GAPGIKGEKGEPASSFPV---KPTHT-------VMGPRGDMGQKGEP------GLVGRKG  313

Query  383  TPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRK  423
             PG +   G  G  GEKGLPG PG RGR G  GPP    +K
Sbjct  314  EPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQK  354


 Score = 118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 152/295 (52%), Gaps = 35/295 (12%)

Query  145   GSKGAQGEPGLTGMPGQ---------QGFPGGEGSPGEKGQRGPPG-------PSGPQGQ  188
             G +G +GEPGL+G+PG          QGF G  G  GE+G RG PG         G +G 
Sbjct  1171  GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGS  1230

Query  189   KGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGL  248
             +G+ G TG+ G  G  G+ G  G+AG  G  GL G  G  G  G+PG +G +GPRG  G 
Sbjct  1231  QGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGY  1290

Query  249   PG--DKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPG  306
             PG   KGEKG P           G PG +G  G  G PG IG  G PG  G+ G +G PG
Sbjct  1291  PGVTIKGEKGLP-----------GRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPG  1339

Query  307   PYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANT-PTGFVGPAGDKGD  365
             P GP G KG    G  G+ G  G  G PG PG  G+  P   +      GF G  GDKGD
Sbjct  1340  PIGPAGSKGER--GLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGD  1397

Query  366   KGDEGP---PGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
             +G +GP   PG  G +GD+G PG     G  G PGE+G  GP G  GRDG  G P
Sbjct  1398  RGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLP  1452


 Score = 108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 144/383 (38%), Positives = 171/383 (45%), Gaps = 97/383 (25%)

Query  130  RGDSANCTPKCFAE-KGSKGAQGEPGLTGM------PGQQGFPGGEGSPGEKGQRGPPGP  182
            +GD       C A  KG KG  G PG+ G       PG++G+PG  G  G  GQ GPPG 
Sbjct  563  KGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGE  622

Query  183  SGPQGQKGDMGKTGQ---------------------PGFPGINGIQGFPGIAGLPGAP--  219
             G  G+ G  G TG+                     PG PG  G+QGF G  GLPG P  
Sbjct  623  KGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGP  682

Query  220  ----GLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTG----------IHN  265
                G  G  G  G+PG  G  G  G  G+PG+PG    KGEP   G             
Sbjct  683  KGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQS-IKGEPGFHGRDGAKGDKGSFGR  741

Query  266  KGQKGEPGADGID-------GARGMPGDIGPPGEPGP------------KGDMGPIGPPG  306
             G+KGEPG+  +D       G +G PG  G PG PG             KG+ GP GPPG
Sbjct  742  SGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPG  801

Query  307  P------YGPKGEKGNDG-VGFEGAKGDKGFKGEPGPPGPPG-NGKPSLLQANTPTGFVG  358
                    GP+GEKGN G VG  G  G  G +G PG  G PG  G+P + +   P G  G
Sbjct  802  VEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPG-PMGPPG  860

Query  359  PAGDKGDKGDEGPPGPQGL------------RGDSGTPGDQCRPGE------------PG  394
              G +G+KGD GP GP G             RGD+G PG   RPG              G
Sbjct  861  LNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAG  920

Query  395  LPGEKGLPGPPGLRGRDGFAGPP  417
            + G  G+PG  G+RGRDG  G P
Sbjct  921  VAGPPGVPGIDGVRGRDGAKGEP  943


 Score = 106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 148/432 (34%), Positives = 181/432 (42%), Gaps = 142/432 (33%)

Query  126   VVNQRGDSANCTPKCFA-------------EKGSKGAQGEPGLTGMPGQQG---------  163
             +V ++GD     P   A               G+KG  G PGL GMPG +G         
Sbjct  906   IVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDG  965

Query  164   ---FPGGEGSPGEKGQRGPPGPSGPQGQKG---------------------------DMG  193
                F G  G+PG++G  G PG SG +G KG                           D G
Sbjct  966   PKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQG  1025

Query  194   KTGQPGFPGINGI------QGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPG  247
               G PG  G++G+      QGFPG+ G PG PG     G  G PG  GL G  GP G PG
Sbjct  1026  LAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG  1085

Query  248   LPGDK--------------------------------GEKGEPALTGIHNK-GQKGEPGA  274
              PG+K                                GEKGE  L G+  + G+KG  GA
Sbjct  1086  WPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGA  1145

Query  275   DGIDGARGM---------------PGDIGPPGE------PGPKGDMGPI------GPPGP  307
              GI GA GM               PGD G  GE      PG KG+ GP+      G PGP
Sbjct  1146  PGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGP  1205

Query  308   YGPKGEKGNDGV--------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGP  359
              G +G +G  G+        G +G++G++G+ GE G  G  G            TG  G 
Sbjct  1206  KGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGL-----------TGPAGV  1254

Query  360   AGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLP-----GEKGLPGPPGLRGRDGFA  414
             AG KGD+G +GPPG  GL G  G  GD    GE G P     GEKGLPG PG  GR G  
Sbjct  1255  AGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLI  1314

Query  415   GPPAPLVRKEIP  426
             G P  +  + +P
Sbjct  1315  GAPGLIGERGLP  1326


 Score = 103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 172/360 (48%), Gaps = 72/360 (20%)

Query  144   KGSKGAQGEPGLTGMPGQQGF------PGGEGSPGEKGQRGPPGPSGPQG---QKGDMGK  194
             +G KG+QGE G TG  G+QG        G  G+ G++G +GPPG SG  G    KGD+G 
Sbjct  1225  RGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGP  1284

Query  195   TGQPGFPG--INGIQGFPGI------AGLPGAPGL---DGCNGTDGSPGLPGLEGPMGP-  242
              G+ G+PG  I G +G PG        GL GAPGL    G  G  G PGL GL GP+GP 
Sbjct  1285  RGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPA  1344

Query  243   -----RGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKG  297
                  RG  G PG  G+ G P   G+     KG+ G  G  G RG+ G  G  G+ G +G
Sbjct  1345  GSKGERGLAGSPGQPGQDGFPGAPGL-----KGDTGPQGFKGERGLNGFEGQKGDKGDRG  1399

Query  298   DMGPIGPPGPYGPKGE------KGNDG-------VGFEGAKGDKGFKGEPGPPGPPGNGK  344
               GP G PG  G KG+       GNDG        GF G KG  G  G PG PG    G+
Sbjct  1400  LQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQ--KGE  1457

Query  345   PSLLQA------------NTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPG-  391
             P +L              N P G  G  G++G  G +G  G +G RG  G  G+  RPG 
Sbjct  1458  PGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGP  1517

Query  392   --EPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIPVTKVFQDYLAG-LDSRESQGRGV  448
               + G PGE+G  G  GL G+ G  G PAP             DYL G L +R SQ   V
Sbjct  1518  KGDRGEPGERGYEGAIGLIGQKGEPGAPAPAAL----------DYLTGILITRHSQSETV  1567


 Score = 101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 128/315 (41%), Positives = 153/315 (49%), Gaps = 68/315 (22%)

Query  144   KGSKGAQGEPGL-------TGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTG  196
             KG +G +G+PGL        G  G QG  G  G  GE+G+RG  GP+G  G KGD G  G
Sbjct  1206  KGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQG  1265

Query  197   QPGFPGINGI------------QGFPGIA-----GLPGAPGLDGCNGTDGSPGLPGLEGP  239
              PG  G+NGI             G+PG+      GLPG PG +G  G  G+PGL      
Sbjct  1266  PPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGL------  1319

Query  240   MGPRGFPGLPGDKGEKGEPALTGIHN-KGQKGEPGADGIDGARGMPGDIGPPGEPGPKGD  298
             +G RG PGL       GEP L G+    G  G  G  G+ G+ G PG  G PG PG KGD
Sbjct  1320  IGERGLPGL------AGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGD  1373

Query  299   MGPIGPPGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVG  358
              GP       G KGE+G +G  FEG KGDKG +G  GP G PG     L+     TG+ G
Sbjct  1374  TGP------QGFKGERGLNG--FEGQKGDKGDRGLQGPSGLPG-----LVGQKGDTGYPG  1420

Query  359   PAGDKG---DKGDEGPPGPQGLRGDSGTPGDQCRPGEPGL---------------PGEKG  400
               G+ G     G+ G  GP+G  G  GTPG   + GEPG+                G KG
Sbjct  1421  LNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKG  1480

Query  401   LPGPPGLRGRDGFAG  415
              PG PG RG  G  G
Sbjct  1481  EPGRPGERGLIGIQG  1495


 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 143/301 (48%), Gaps = 27/301 (9%)

Query  129  QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEK--GQRGPPGPSGPQ  186
            Q+GD+          KG  G  G PGL G  G++GF G  G+PG+   G+ G PG +G  
Sbjct  483  QKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAP  542

Query  187  GQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFP  246
            GQKGD G+ G PG  G  GI+G  G        G  G  GT G PG+PG +G  GP G  
Sbjct  543  GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGER  602

Query  247  GLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPG  306
            G PG++G  G          GQ G PG  G DG  G+PG  G PG+P    D+  I P  
Sbjct  603  GYPGERGHDG--------INGQTGPPGEKGEDGRTGLPGATGEPGKPALC-DLSLIEPL-  652

Query  307  PYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDK  366
                KG+KG  G    GAKG +GFKG  G PG PG             GF G  G  G  
Sbjct  653  ----KGDKGYPGA--PGAKGVQGFKGAEGLPGIPG--------PKGEFGFKGEKGLSGAP  698

Query  367  GDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIP  426
            G++G PG  G  G  G PG   + GEPG  G  G  G  G  GR G  G P      EI 
Sbjct  699  GNDGTPGRAGRDGYPGIPGQSIK-GEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK  757

Query  427  V  427
            +
Sbjct  758  M  758


 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 145/300 (48%), Gaps = 42/300 (14%)

Query  151  GEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQ------GQKGDMGKTGQPGFPGIN  204
            G PG  G PGQ+G  G  G+PG+KG  G  G  G +      G KGD G +G PG PG +
Sbjct  534  GTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKD  593

Query  205  GIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTGIH  264
            G +G PG  G PG  G DG NG  G PG  G +G  G      LPG  GE G+PAL  + 
Sbjct  594  GARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTG------LPGATGEPGKPALCDLS  647

Query  265  N----KGQKGEPGA------DGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEK  314
                 KG KG PGA       G  GA G+PG  GP GE G KG+ G  G PG  G  G  
Sbjct  648  LIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRA  707

Query  315  GNDGV---------------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQ--ANTPTGFV  357
            G DG                G +GAKGDKG  G  G  G PG+     ++  A    G  
Sbjct  708  GRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEP  767

Query  358  GPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
            G  G  G  G++G PG +G  G  G  G Q   G PG+ G +GL GP G +G  G  G P
Sbjct  768  GQTGMPGPPGEDGSPGERGYTGLKGNTGPQ---GPPGVEGPRGLNGPRGEKGNQGAVGVP  824


 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 144/296 (49%), Gaps = 37/296 (13%)

Query  143   EKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQP---G  199
             ++G  G  G  G+ G  G+QG  G  G PGEKG  G PG  G  G  G  G  G P   G
Sbjct  1109  DQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVG  1168

Query  200   FPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLP-------GDK  252
             +PG  G +G PG++GLPG  G  G  G  G  G PG +G  G RG PGLP       GDK
Sbjct  1169  YPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDK  1228

Query  253   GEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKG  312
             G +GE   TG   KG++GE G  G  G  G  GD G  G PG  G  G  G  G  GP+G
Sbjct  1229  GSQGERGYTG--EKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRG  1286

Query  313   EKGNDGVGFEGAKG---------DKGFKGEPGPPGPPG----NGKPSLLQANTPTGFVGP  359
             E G  GV  +G KG          +G  G PG  G  G     G+P L+    P   +GP
Sbjct  1287  EIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGP---IGP  1343

Query  360   AGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAG  415
             AG KG++         GL G  G PG    PG PGL G+ G  G  G RG +GF G
Sbjct  1344  AGSKGER---------GLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEG  1390


 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 152/328 (46%), Gaps = 52/328 (16%)

Query  130   RGDS----ANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGP  185
             RGD+     +  P    EKG  G  G  G+ G PG  G  G  G  G KG+ G PG  G 
Sbjct  892   RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGM  951

Query  186   QGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGP---  242
              G KGD G  G  G  G  G+ G PG  G  G PG+ G  G  G+ GL G +GP+G    
Sbjct  952   PGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGP  1011

Query  243   ---------------------RGFPGLPGDKGEKGEPALTG-------IHNKGQKGEPGA  274
                                  +G  G+PG+KG +G P L G          KGQKGEPG 
Sbjct  1012  PGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGP  1071

Query  275   DGIDGARGMPGDIGPPGE--------------PGPKGDMGPIGPPGPYGPKGEKGNDGV-  319
              G+ G  G  G  G PGE              PG KGD G  G  G  G  GEKG  G+ 
Sbjct  1072  SGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQ  1131

Query  320   GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRG  379
             G  G  G+KG  G PG PG P  G   L  A    G VG  GD+GDKG+ G  G  GL+G
Sbjct  1132  GVWGQPGEKGSVGAPGIPGAP--GMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKG  1189

Query  380   DSGTPGDQCRPGEPGLPGEKGLPGPPGL  407
             ++G  G Q   G PG  GE+G+ G PGL
Sbjct  1190  ETGPVGLQGFTGAPGPKGERGIRGQPGL  1217


 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 166/346 (48%), Gaps = 75/346 (22%)

Query  117  TYYERDNFLVVNQRGDSAN-CTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKG  175
            ++  +    V+  RGD      P     KG  G +G+ GL G  G++G PGG   PG++G
Sbjct  284  SFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGG---PGDRG  340

Query  176  QRGPPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLP-------------------  216
            ++G  GP G  GQKGD G+ G  G PG  G +G PG AG                     
Sbjct  341  RQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTP  400

Query  217  ------------GAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTGIH  264
                        GAPG  G NG DG   LPG +G  G +G  GLPG  G +G P      
Sbjct  401  GPPGPKGPRGYVGAPGPQGLNGVDG---LPGPQGYNGQKGGAGLPGRPGNEGPP------  451

Query  265  NKGQKGEPGADGIDGARGMPGDIGPPGEPGP------KGDMGPIGPPGPYGPKGEKGNDG  318
              G+KGE G  G++G +G    IGP G PGP      KGD G  G    YG +G KG+ G
Sbjct  452  --GKKGEKGTAGLNGPKG---SIGPIGHPGPPGPEGQKGDAGLPG----YGIQGSKGDAG  502

Query  319  V----GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGP  374
            +    G +G+KG++GFKG  G PG    G+P         G  G AG  G KGD G PG 
Sbjct  503  IPGYPGLKGSKGERGFKGNAGAPGDSKLGRP---------GTPGAAGAPGQKGDAGRPGT  553

Query  375  QGLRGDSGTPGD---QCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
             G +GD G  GD   +C     G  G+KG  G PG+ G+DG  GPP
Sbjct  554  PGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPP  599


 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 166/356 (47%), Gaps = 81/356 (23%)

Query  143   EKGSKGAQGEPGLTGMPGQ---QGFPGGEGSPG------EKGQRGPPGPSG---------  184
             ++G  GA G+ GL GMPG+   QGFPG +G PG      EKGQ+G PGPSG         
Sbjct  1023  DQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAG  1082

Query  185   --------------------PQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGC  224
                                 P G+KGD G++G  G  GING +G  G+ G+ G PG  G 
Sbjct  1083  TPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGS  1142

Query  225   NGTDGSPGLPGLEGPMGPRGFP---GLPGDKGEKGEPALTGIHN-KGQKGEPGADGIDGA  280
              G  G PG PG++G  G  G P   G PGD+G+KGEP L+G+   KG+ G  G  G  GA
Sbjct  1143  VGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGA  1202

Query  281   RGMPGDIGPPGEPG-------PKGDMGPIGPPGPYGPKGEKGNDGV----GFEGAKGDKG  329
              G  G+ G  G+PG        +GD G  G  G  G KGE+G  G+    G  GAKGD+G
Sbjct  1203  PGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRG  1262

Query  330   FKGEPGPPGPPGNGKPSLLQANTPTGFVGPAG--DKGDKGDEGPPGPQG---------LR  378
              +G PG  G   NG P       P G +G  G   KG+KG  G PG  G         L 
Sbjct  1263  LQGPPGASGL--NGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLI  1320

Query  379   GDSGTPGDQCRPG---------------EPGLPGEKGLPGPPGLRGRDGFAGPPAP  419
             G+ G PG    PG               E GL G  G PG  G  G  G  G   P
Sbjct  1321  GERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGP  1376


 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 145/299 (48%), Gaps = 53/299 (18%)

Query  144   KGSKGAQGEPGLTGMPGQQGFPGG----EGSPGEKGQRGPPGPS---GPQGQKGDMGKTG  196
              G  GA+G+ G  G  G++G PG     E     KG +G PG +   GP G+ G  G+ G
Sbjct  727   HGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERG  786

Query  197   QPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKG  256
               G  G  G QG PG+ G  G  G  G  G  G+ G+PG  G  G RG PG  G  G +G
Sbjct  787   YTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRG  846

Query  257   EPALT--------GIHN-KGQKGE---------PGADGI------DGARGMPGDIGPPGE  292
             EP ++        G++  +G+KG+         PGADG        G  G+PG  G PG 
Sbjct  847   EPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGI  906

Query  293   PGPKGDMGPIGPPGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANT  352
              G KGD+GPIGP G  GP G  G DGV     +G  G KGEPG P               
Sbjct  907   VGEKGDVGPIGPAGVAGPPGVPGIDGV-----RGRDGAKGEPGSP---------------  946

Query  353   PTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRD  411
               G VG  G+KGD+G  G  GP+G  G +G PG +   G PG+ G KG  G  GL G D
Sbjct  947   --GLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGND  1003


 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 114/234 (49%), Gaps = 33/234 (14%)

Query  137   TPKCFAEKGSKGAQGEPGLTGMPG---------QQGFPGGEGSPGEKGQRGPPGPSGPQG  187
              P    E+G  G  GEPGL G+PG         ++G  G  G PG+ G  G PG  G  G
Sbjct  1316  APGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTG  1375

Query  188   QKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGP---RG  244
              +G  G+ G  GF G  G +G  G+ G  G PGL G  G  G PGL G +GP+G    RG
Sbjct  1376  PQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERG  1435

Query  245   FP---------GLPGDKGEKGEPALT----------GIHNKGQKGEPGADGIDGARGMPG  285
             F          G PG  G+KGEP +                G KGEPG  G  G  G+ G
Sbjct  1436  FTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQG  1495

Query  286   DIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGP  339
             + G  GE G  G+ G +G PGP G +GE G    G+EGA G  G KGEPG P P
Sbjct  1496  ERGEKGERGLIGETGNVGRPGPKGDRGEPGER--GYEGAIGLIGQKGEPGAPAP  1547


 Score = 36.6 bits (83),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 63/139 (45%), Gaps = 35/139 (25%)

Query  126   VVNQRGDSANCTPKCFAEKGSKGAQGEPGLTG------------MPGQQGFPGG------  167
             +V Q+GD+    P      G  GA GE G TG            +PGQ+G PG       
Sbjct  1409  LVGQKGDTG--YPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGP  1466

Query  168   ------------EGSPGEKGQRGPPGPSGPQGQKGD---MGKTGQPGFPGINGIQGFPGI  212
                         +G PG  G+RG  G  G +G+KG+   +G+TG  G PG  G +G PG 
Sbjct  1467  KGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGE  1526

Query  213   AGLPGAPGLDGCNGTDGSP  231
              G  GA GL G  G  G+P
Sbjct  1527  RGYEGAIGLIGQKGEPGAP  1545


>CO4A1_CAEEL unnamed protein product
Length=1759

 Score = 128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 138/347 (40%), Positives = 163/347 (47%), Gaps = 59/347 (17%)

Query  125  LVVNQRGDSANCTPKCFA-----EKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGP  179
            + V+       C P C       E+G+ G  GEPG  G PGQ G  G  G+PG  G  G 
Sbjct  24   IHVDAAAACKGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGD  83

Query  180  PGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGP  239
             G  G +G +GD G  G PG PG+ G+ G PG+ G  G PG   CNGTDG PG+PGL GP
Sbjct  84   FGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPG---CNGTDGFPGMPGLAGP  140

Query  240  MGPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDM  299
             G  G  G PG  G  G P   G++++G+KG  G  G  G  G+PG+ G PG  G KGD 
Sbjct  141  PGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDP  200

Query  300  GPIGPPGPYGPKGEKGNDGVGFEGAK----------------------------------  325
            GP G PG  G  G KG  GV   G K                                  
Sbjct  201  GPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPV  260

Query  326  ---GDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGL-----  377
               G KG KG  GP GPPG     +L  + P G+ G  G KGD GD G  G +G      
Sbjct  261  GPAGVKGEKGRDGPVGPPG-----MLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPG  315

Query  378  -RGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGF---AGPPAPL  420
              G+ G+ G+Q   G PG PG KG  G PG  GR GF    GP  PL
Sbjct  316  NYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPL  362


 Score = 107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 157/312 (50%), Gaps = 63/312 (20%)

Query  148  GAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPS-----GPQGQKGDMGKTGQPGFPG  202
            G QGEPGL G+ G++G    +GS G  G +GPPG S     G  G KG+ G  G PG PG
Sbjct  656  GLQGEPGLAGIDGKRGR---QGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPG  712

Query  203  INGIQGFPG-------IAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEK  255
              G +G P        +AG PG  G+ G  G  G+ GLPGL GP+GP G+PG PG++G  
Sbjct  713  AQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMD  772

Query  256  GEPALTGIHN----KGQKGEPGADGIDGARGMPG-----------------DIGPPGE--  292
            G P   G+H     +GQ+GE G +GIDG  G PG                   G PG+  
Sbjct  773  GLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVG  832

Query  293  -PGPKGDMGPIGPPGPYGPKGEKGNDGV-GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQA  350
             PGP GD G  G PGP    G  G DG+ G  G  G+ G  G+ G PG PG+        
Sbjct  833  YPGPNGDAGAAGLPGP---DGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGS--------  881

Query  351  NTPTGFVGPAGDKGDKGDEGPPGPQ------GLRGDSGTPGDQCRPGEPGLPGEKGLPGP  404
                G  G  G  G KG +G PG +      G  G++G PG     G PG PG++G PG 
Sbjct  882  ---RGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGS  938

Query  405  PGLRGRDGFAGP  416
            P   G+DG+ GP
Sbjct  939  P---GQDGYPGP  947


 Score = 100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 163/342 (48%), Gaps = 50/342 (15%)

Query  132  DSANC-TPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGP-PGPSGPQGQK  189
            D  +C  P    + GS G+ G  G  G+PG  G+PG +G  GE    GP   P+G  G K
Sbjct  568  DHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEI--VGPMENPAGIPGLK  625

Query  190  GDMGKTGQPGFPGINGIQG---------FPGIAGLPGAPGLDGCNGTDGSPGLPGLEGP-  239
            GD G  G PG PG +G+ G         FPG+ G PG  G+DG  G  GS G+PGL+GP 
Sbjct  626  GDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPP  685

Query  240  ----------------MGPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGI------  277
                             G  G PGLPG +G +G PA   I N+   G+PG DG+      
Sbjct  686  GDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQ-VAGQPGVDGMPGLPGD  744

Query  278  ---DGARGMPGDIGP---PGEPGPKGDMGPIGPPGPYGPKGEKGNDG-VGFEGAKGDKGF  330
               DG  G+PG +GP   PG PG +G  G  G PG +G  G +G  G VGF G  GD G 
Sbjct  745  RGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCG-  803

Query  331  KGEPGPPGPPGNGKPSLLQANTPTGF---VGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQ  387
              EPG  G PG          T  GF   VG  G  GD G  G PGP G  G  G PG  
Sbjct  804  --EPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTP  861

Query  388  CRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIPVTK  429
              PGE G+ G+ G PG PG RG  G  G      R   P T+
Sbjct  862  GYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTR  903


 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 154/350 (44%), Gaps = 61/350 (17%)

Query  129   QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ  188
             Q  D     P    E G  G  G PG  G PGQQG  G +G PG  G+ G PG  G  GQ
Sbjct  1124  QGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQ  1183

Query  189   ---KGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGF  245
                KG+ G  GQPG+PG  G  G PG  G PGAPG +G NG  G  G PGL G  G  G 
Sbjct  1184  PGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQ  1243

Query  246   PGLPGDK---------------GEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPP  290
             PGLPG                 G  G+         GQ G PG DG+ GA G+ G+ G P
Sbjct  1244  PGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSP  1303

Query  291   GE---------------PGPKGDMGPIGPPGPYGPKGEKGNDGV----GFEGAKGDKGFK  331
             G+               PG  G+ G  G  G  G  G  G  GV    G  G +GD G  
Sbjct  1304  GQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGED  1363

Query  332   GEPGPPGPPG-NGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRP  390
             G PG PG PG NG P         G  G +GD G  G  G PG +G RGD G PG     
Sbjct  1364  GYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLD  1423

Query  391   GEPGLPGEKGLPGP-----------------------PGLRGRDGFAGPP  417
             G PG PG +GLPGP                       PGL G +G +GPP
Sbjct  1424  GLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPP  1473


 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 128/328 (39%), Positives = 147/328 (45%), Gaps = 63/328 (19%)

Query  144   KGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFPGI  203
             KG  G  G+PG  G  GQ G PG  G PG  G+ G  G  G  GQ G  G++GQPG PG+
Sbjct  1187  KGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGL  1246

Query  204   --------------------------------NGIQGFPGIAGLPGAPGLDG--------  223
                                              G  G+PG+ GLPGAPGL+G        
Sbjct  1247  PGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQY  1306

Query  224   -------------CNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTGIHNKGQKG  270
                            G  G  GLPGL+G  G  G PG PG  G +G P L G  + G+ G
Sbjct  1307  GMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEG--DCGEDG  1364

Query  271   EPGADGIDGARGMPGDIGPPGEPGPKG---DMGPIGPPGPYGPKGEKGNDGVGFEGAKGD  327
              PGA G  G+ G PG+ G PG PG +G   D G  G PG  G KG +G+DG  F G  G 
Sbjct  1365  YPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDG--FPGRDGL  1422

Query  328   KGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQ  387
              G  G PG  G PG   P  +    P G  G  G  G+KG  G PG  GL G  G  G  
Sbjct  1423  DGLPGRPGREGLPG---PMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYP  1479

Query  388   CRPGEPGLPGEKGLPGPPGLRGRDGFAG  415
               PG  G PG  GL G PG  G  GF G
Sbjct  1480  GAPGTDGYPGPPGLSGMPGHGGDQGFQG  1507


 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 136/276 (49%), Gaps = 12/276 (4%)

Query  150  QGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFPGINGIQGF  209
            QG  G  G+ G++G  G  G PG  G  GPPG  G +GQKGD+G  GQ       G +G 
Sbjct  257  QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQ------RGKRGK  310

Query  210  PGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKG--EPALTGIHNKG  267
             G+ G  G  G  G  G  G+PG PG +G  G  G+PG PG +G+ G   P   G    G
Sbjct  311  DGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAG  370

Query  268  QKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGVGFEGAKGD  327
              G  G DG+ G +G+PG  G PG  GP+G +G  G PG  G  G  G    G  G  G 
Sbjct  371  PHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGY  430

Query  328  KGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQ  387
             GF GEPG PG PG+               GP G  G  G +G PG  G  GD G  G++
Sbjct  431  PGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEK  490

Query  388  CRPG----EPGLPGEKGLPGPPGLRGRDGFAGPPAP  419
              PG    + G PG  GLPG PG+ GR G  G P P
Sbjct  491  GFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGP  526


 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 151/328 (46%), Gaps = 36/328 (11%)

Query  120  ERDNFLVVNQRGDSA-NCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRG  178
            ++ +     QRG    +  P  + EKGS+G QG  G  G PG +G  G  G PG  G  G
Sbjct  295  QKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEG  354

Query  179  PPGPSGPQGQ-KGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLE  237
              GP GP G+  G+ G  G  GF G+ G +G PG  GLPG  G  G  G  G+PG PG++
Sbjct  355  DCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGID  414

Query  238  GP-----------------MGPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGA  280
            G                   G  G PG PGD G  GE  L G   +G  G  G  G DG 
Sbjct  415  GMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGF  474

Query  281  RGMPGDIGPPGEPGPKG----DMGPIGPPGPYGPKGEKGNDGVGFEGAKGDKGFKGEPGP  336
             G+PGDIG PG  G KG     +  +GPPG  G  GE G          G  G  G PGP
Sbjct  475  PGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPG--------MPGRIGVDGYPGP  526

Query  337  PGPPGNGKPSLLQANTPTGFVGPAGDKG---DKGDEGPPGPQGLRGDSGTPGDQCRPGEP  393
            PG   NG+        P G  G AGD G     G  GPPGP G  GD G PG   +PG  
Sbjct  527  PG--NNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSA  584

Query  394  GLPGEKGLPGPPGLRGRDGFAGPPAPLV  421
            G  G  G PG PG+ G  G  G    +V
Sbjct  585  GSDGLSGSPGLPGIPGYPGMKGEAGEIV  612


 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 148/296 (50%), Gaps = 29/296 (10%)

Query  145   GSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFPGIN  204
             G  G++GE GL G+ G++G    +G+PG +GQ G PG SG   + G  G+ G  G+PG  
Sbjct  877   GQPGSRGESGLVGIDGKKGR---DGTPGTRGQDGGPGYSG---EAGAPGQNGMDGYPGAP  930

Query  205   GIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEPALTGIH  264
             G QG+PG  G  G PG  G  G DG  G PGL G  G  G PGL G+ GE+G   L G+ 
Sbjct  931   GDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVP  990

Query  265   NK-GQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGN-------  316
                G+ G  G  G+ GA G PG +G  GEPG  G  G  G PG     G+ G+       
Sbjct  991   GYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPD  1050

Query  317   --------DGV-GFEGAKGDKG--FKGEPGPPGPPG----NGKPSLLQANTPTGFVGPAG  361
                     DG+ G  G +GD G  + G PG  G PG    +G   +       G  G  G
Sbjct  1051  GPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPG  1110

Query  362   DKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
              KG+ G  G PG QG  G  G PG +   GE G PG  G PG PG +GR+G  G P
Sbjct  1111  LKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYP  1166


 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 129/350 (37%), Positives = 150/350 (43%), Gaps = 72/350 (21%)

Query  126   VVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGP  185
             +  +RGD+ +  P      G  G  G  GL G+PG  G+PG  G PG KG+ G PG  G 
Sbjct  1064  LNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGR  1123

Query  186   QGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGF  245
             QG     G  GQPG  G  G  GFPG  G PG PG  G  G  G PG+PG          
Sbjct  1124  QGND---GIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGEN--------  1172

Query  246   PGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPP  305
              GLPG +G+ G+P L G    G  G+PG  G  G  G PGD+G PG PG  GD G  G  
Sbjct  1173  -GLPGLRGQDGQPGLKG--ENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRD  1229

Query  306   GP-----------------------------------------YGPKGEKGNDGV-GFEG  323
             G                                          YGP G+ G DG  G +G
Sbjct  1230  GQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDG  1289

Query  324   AKGDKGFKGEPGPPG----------------PPGNGKPSLLQANTPTGFVGPAGDKGDKG  367
               G  G  GEPG PG                P   G+  L   +   G  G  G  G  G
Sbjct  1290  LPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPG  1349

Query  368   DEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
              EG PG +G  G+ G PG    PG  G PGE+GLPG PG +GR G  G P
Sbjct  1350  VEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYP  1399


 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 148/328 (45%), Gaps = 65/328 (20%)

Query  145   GSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKG------------DM  192
             G  GA G+ G  G PGQ G+PG  G PGE G  G PG  G  G  G              
Sbjct  925   GYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSR  984

Query  193   GKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMG-----------  241
             G  G PG+PG +G  G PG+ G  G PG  G  G  G+PG  G  G  G           
Sbjct  985   GLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDV  1044

Query  242   -------PR------GFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGID---------G  279
                    P       G PGL G++G+ G+         GQ G+ G DG+D         G
Sbjct  1045  GYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPG  1104

Query  280   ARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV----------GFEGAKGDKG  329
               GMPG  G  G PG  G  G  G PG  G +GE G DG           G +G +G+KG
Sbjct  1105  ITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKG  1164

Query  330   FKGEPGPPGPPG----NGKPSLLQANTPT---GFVGPAGDKGDKGDEGPPGPQGLRGDSG  382
             + G PG  G PG    +G+P L   N      G+ G AG  G  GD G PG  G  GD+ 
Sbjct  1165  YPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDN-  1223

Query  383   TPGDQCRPGEPGLPGEKGLPGPPGLRGR  410
               G+Q R G+PGL GE G PG PGL GR
Sbjct  1224  --GNQGRDGQPGLRGESGQPGQPGLPGR  1249


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 112/207 (54%), Gaps = 19/207 (9%)

Query  155   LTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ---KGDMGKTGQPGFPGINGIQGFPG  211
             L G PG++G PG +G  G  G  G PG  G +G    +GD G+ G PG PG  G  G+PG
Sbjct  1320  LPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPG  1379

Query  212   IAGLPGAPGL---DGCNGTDGSPGLPGLEGPMGPRGFP------GLPGDKGEKGEPALTG  262
               GLPG PG     G NG  G+PG PG++GP G  GFP      GLPG  G +G P    
Sbjct  1380  ERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMA  1439

Query  263   IHNKGQKGEPGADGIDGAR---GMPGD---IGPPGEPGPKGDMGPIGPPGPYGPKGEKGN  316
             +  +   G+PG +G  G +   G+PGD    GPPG+ G  G  G  G PGP G  G  G+
Sbjct  1440  MAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGH  1499

Query  317   DG-VGFEGAKGDKGFKGEPGPPGPPGN  342
              G  GF+GA G  G  G PG PG PG+
Sbjct  1500  GGDQGFQGAAGRTGNPGLPGTPGYPGS  1526


 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 154/345 (45%), Gaps = 55/345 (16%)

Query  126  VVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPP-----  180
            +  Q+GD  +   +   ++G  G  G  G  G  G+QG  G  G PG KG  G P     
Sbjct  292  LKGQKGDLGDAGQR--GKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGR  349

Query  181  -------GPSGPQGQ-KGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPG  232
                   GP GP G+  G+ G  G  GF G+ G +G PG  GLPG  G  G  G  G+PG
Sbjct  350  PGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPG  409

Query  233  LPGLEGP-----------------MGPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGAD  275
             PG++G                   G  G PG PGD G  GE  L G   +G  G  G  
Sbjct  410  QPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQS  469

Query  276  GIDGARGMPGDIGPPGEPGPKG----DMGPIGPPGPYGPKGEKGNDG-VGFEGAKGDKGF  330
            G DG  G+PGDIG PG  G KG     +  +GPPG  G  GE G  G +G +G  G  G 
Sbjct  470  GRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGN  529

Query  331  KGEPG------PPGPPGN-GKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGT  383
             GE G      P G PGN G P     N   G  GP GD GD G  G PG  G  G  G 
Sbjct  530  NGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGL  589

Query  384  PGDQCRPGEPGLPGEKG----LPGP-------PGLRGRDGFAGPP  417
             G    PG PG PG KG    + GP       PGL+G  G  G P
Sbjct  590  SGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLP  634


 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 145/337 (43%), Gaps = 74/337 (22%)

Query  137  TPKCFAEKGSKGAQGEPGL----TGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDM  192
             P    + G  G +G PG      G PG  G PG  G PG  G  G PGP G  G++G+ 
Sbjct  477  IPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGED  536

Query  193  GKTGQPGFPGINGIQGFP------------------GIAGLPGAPGLDGCNGTDGSPGLP  234
                  G PG  G  GFP                  G+ G PG PG  G +G  GSPGLP
Sbjct  537  CGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLP  596

Query  235  GLEGPMGPRGFPGLPGDKGE--------KGEPALTGIHNK--------------------  266
            G+ G      +PG+ G+ GE         G P L G H                      
Sbjct  597  GIPG------YPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPG  650

Query  267  -----GQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV-G  320
                 G +GEPG  GIDG RG  G +G PG  GP GD  P G PG  G KGE+G DG+ G
Sbjct  651  QNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFP-GQPGTPGYKGERGADGLPG  709

Query  321  FEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTP--TGFVGPAGDKGDKGDEGPPGPQGLR  378
              GA+G +G          P   +     A  P   G  G  GD+G  G  G PGP G  
Sbjct  710  LPGAQGPRGI---------PAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPD  760

Query  379  GDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAG  415
            G  GTPG++   G PG PG  G PG  G +G  GF G
Sbjct  761  GYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNG  797


 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 130/367 (35%), Positives = 153/367 (42%), Gaps = 97/367 (26%)

Query  141  FAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGF  200
            F + GSKGA+G+ GL G PG  G  G +G PG KG+ G PG +G  G        G PG 
Sbjct  84   FGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDG------FPGMPGL  137

Query  201  ---PGINGIQGFPGIAGLPGAPGLDGCN--------------------GTDGSPGLPGLE  237
               PG +G  G PG  GL G PG  G N                    G  G PGL G +
Sbjct  138  AGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAK  197

Query  238  GPMGPRGFPGLPGDKGEKGEPAL--TGIHN------------------------------  265
            G  GP G PG PG  G KG   +  +G+                                
Sbjct  198  GDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQ  257

Query  266  -----KGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPI------------GPPGPY  308
                  G KGE G DG  G  GM G  GPPG PG KG  G +            G PG Y
Sbjct  258  GPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNY  317

Query  309  GPKGEKGNDGV----GFEGAKGDK---------GFKGEPGPPGPPGNGKPSLLQANTPTG  355
            G KG +G  G+    G+ G KG           GF+G+ GP GP G G       +   G
Sbjct  318  GEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGT-GEAGPHGAQG  376

Query  356  FVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLP-----GEKGLPGPPGLRGR  410
            F G  G KG  G +G PGP G RG  G PG   +PG  G+P     G++G  G PG  G 
Sbjct  377  FDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGE  436

Query  411  DGFAGPP  417
             G  G P
Sbjct  437  PGLPGEP  443


 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 145/304 (48%), Gaps = 52/304 (17%)

Query  145   GSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTGQPGFPGIN  204
             G +GA G PGL G  G  G+PG   +PGE+G  G PG  G  G+ G  G+ G+ GF GI+
Sbjct  743   GDRGADGLPGLPGPVGPDGYPG---TPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGID  799

Query  205   GIQGFPGI-----------------AGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPG  247
             G  G PG+                  G PG  G  G NG  G+ GLPG +G  G  G PG
Sbjct  800   GDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPG  859

Query  248   LPGDKGEKGEPALTGIHNK-GQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPG  306
              PG  GE G     G   + G +GE G  GIDG +G  G       PG +G  G  G  G
Sbjct  860   TPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDG------TPGTRGQDGGPGYSG  913

Query  307   PYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDK  366
               G  G+ G DG  + GA GD+G+ G PG  G PG   PS +      G VG  G +G+ 
Sbjct  914   EAGAPGQNGMDG--YPGAPGDQGYPGSPGQDGYPG---PSGIPGED--GLVGFPGLRGEH  966

Query  367   GDEGPPG---------PQGLRGDSGTPGDQCRPGEPGL------P---GEKGLPGPPGLR  408
             GD G PG          +GL G  G PG+    G PGL      P   GE G PG PG R
Sbjct  967   GDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYR  1026

Query  409   GRDG  412
             G+ G
Sbjct  1027  GQPG  1030


 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 144/370 (39%), Gaps = 80/370 (22%)

Query  144  KGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ-----------KGDM  192
             G  G  G  G  G+ G +G PG +G PG  G RGP G  G  GQ           KGD 
Sbjct  366  TGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDR  425

Query  193  GKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDK  252
            G+ G PGF G  G+ G PG  G PG  GL G +      G PGL+G  G  GFPG+PGD 
Sbjct  426  GEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD----IQGPPGLDGQSGRDGFPGIPGDI  481

Query  253  GEKGEPALTGIHNKG--QKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGP  310
            G+ G     G    G  + G PG  G+ G  GMPG IG  G PGP G+ G  G    Y P
Sbjct  482  GDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCP  541

Query  311  KGEKGNDG----------------------------------VGFEGAKGDKGFKGEPGP  336
             G  GN G                                   G +G  G  G  G PG 
Sbjct  542  DGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGY  601

Query  337  PGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQ---------------------  375
            PG  G     +     P G  G  GD G  G  G PG                       
Sbjct  602  PGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEP  661

Query  376  GLRGDSGTPGDQCRPGEPGL--------PGEKGLPGPPGLRGRDGFAGPPAPLVRKEIPV  427
            GL G  G  G Q   G PGL        PG+ G PG  G RG DG  G P     + IP 
Sbjct  662  GLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPA  721

Query  428  TKVFQDYLAG  437
                 + +AG
Sbjct  722  PLRIVNQVAG  731


 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 129/292 (44%), Gaps = 60/292 (21%)

Query  140   CFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQR------------GPPGPSGPQG  187
              +   G  G  G PGL G+PG  G  G  GSPG+ G              G PG  G  G
Sbjct  1272  IYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPG  1331

Query  188   QKGDMGKTGQPGFPGINGIQGFPGIAG---------LPGAPGLDGCNGTDGSPGLPGLEG  238
               G  G  G PG PG+ G++G PG+ G          PGAPG +G  G  G PG+PG +G
Sbjct  1332  LDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQG  1391

Query  239   PMGPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGD  298
               G  G+PG PG  G KG         +G  G PG DG+DG  G PG  G PG P     
Sbjct  1392  RSGDNGYPGAPGQPGIKGP--------RGDDGFPGRDGLDGLPGRPGREGLPG-PMAMAV  1442

Query  299   MGPIGPPGPYGPKGEKGNDGV----GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPT  354
               P G PG  G  GEKG  G+    G  G  G  G+ G PG  G PG   P L      +
Sbjct  1443  RNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPG--PPGL------S  1494

Query  355   GFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPG  406
             G  G  GD+G +G  G                  R G PGLPG  G PG PG
Sbjct  1495  GMPGHGGDQGFQGAAG------------------RTGNPGLPGTPGYPGSPG  1528


 Score = 30.4 bits (67),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 45/107 (42%), Gaps = 26/107 (24%)

Query  320  GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRG  379
            G +G +G+ GF GEPG PG PG                         G EG PG  G+ G
Sbjct  43   GTKGERGNPGFGGEPGHPGAPGQ-----------------------DGPEGAPGAPGMFG  79

Query  380  DSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIP  426
              G  GD    G  G  G++GLPG PG  G  G  G P     + IP
Sbjct  80   AEGDFGDM---GSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIP  123


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 161/324 (50%), Gaps = 49/324 (15%)

Query  140   CFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPS-----GPQGQKGDMGK  194
               A  G KG  GE GLT   G  G+P   G+PG KGQRGP G S     G  G+KG++G 
Sbjct  1015  VAAYSGIKGDDGESGLT---GPIGYP---GAPGAKGQRGPVGDSQPALDGVAGRKGEVGS  1068

Query  195   TGQPGFPGINGIQGFPGIAGLPGA---PGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGD  251
              G  G PG +G++G  G  GLPG    PG  G  G  G PG  G+ G  G  GFPG  G 
Sbjct  1069  PGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGP  1128

Query  252   KGEKGEPALTGIHNK-GQKGEPGADGIDGA----------------------------RG  282
             KG +GE  + G+  + GQ G+ G  G+ G                             RG
Sbjct  1129  KGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRG  1188

Query  283   MPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDG----VGFEGAKGDKGFKGEPGPPG  338
               GD G  GE G +GDMGPIG  GP G KGE+G+ G    +GF+GA+G KGF+G+ GP G
Sbjct  1189  FTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRG  1248

Query  339   PPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTPGDQ--CRPGEPGLP  396
             PPG   P+        G  G AG  G  G +G PGP G  G +G  G +     G PG  
Sbjct  1249  PPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQ  1308

Query  397   GEKGLPGPPGLRGRDGFAGPPAPL  420
             G+ G PG PG  GR G  GP   L
Sbjct  1309  GDVGFPGAPGHNGRHGLIGPKGEL  1332


 Score = 107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 154/332 (46%), Gaps = 53/332 (16%)

Query  125  LVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPG------EKGQRG  178
            LV     D   C       KG KG  G PG  G+PG +G  G  G PG      EKG  G
Sbjct  22   LVSVTLADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVG  81

Query  179  PPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEG  238
              G  G +G +GD+G  G+ G+PGI G  G PG    PG  G+DGC+G  G  G  G  G
Sbjct  82   EYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGT---PGPRGIDGCDGRPGMQGPSGAPG  138

Query  239  PMGPRGFPGLPGDKGEKGEPALTGIHNKGQKG------------------EPGADGIDGA  280
              G RG PG PG +G  GE    GI++KG KG                  + G+ G  G 
Sbjct  139  QNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGY  198

Query  281  RGMPGDIGPPGEPGPKGDMG-----PIGPPGPYGPKGEKGNDGVG-------FEGAKGDK  328
             G+ G+ G PG PGPKGD G     P    GP G KGE G+   G        +G KG  
Sbjct  199  AGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYV  258

Query  329  GFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGTP---G  385
            G +G+ GP GP G             G VG  G  G +G+ G PG +G  G  G P   G
Sbjct  259  GLQGDEGPQGPTGE-----------QGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFG  307

Query  386  DQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPP  417
            D+   G PG  G  GL G PG RG DGF G P
Sbjct  308  DKGMKGAPGWTGADGLDGSPGERGEDGFTGMP  339


 Score = 102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 147/410 (36%), Positives = 174/410 (42%), Gaps = 98/410 (24%)

Query  126   VVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGP  185
              +  RG+  +  P      G  GA+G PG TG  GQQG PG  G  GE G  G  G  G 
Sbjct  744   AIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQ  803

Query  186   QGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGF  245
             +G  G     G+ G PG +GI+GFPG  G PG  GL    G  G  G+ G +GP G  G 
Sbjct  804   RGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGL---AGRPGPKGVKGEQGPDGAVGQ  860

Query  246   PGLPGDKGEKGEPALTGIHN---------------KGQKGE-------------------  271
              GLPG+KG++G+  +                    KGQKGE                   
Sbjct  861   TGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFS  920

Query  272   --------------PGADGIDGARGMPGDIGPPGEP---GPKGDMGPIGPPGPYGPKGEK  314
                           PG+ GI G  GM G+IG  GE    G +GD+GP GP G +GPKG  
Sbjct  921   GRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLS  980

Query  315   GNDG-VGFEGAKGDKGFKGEPGPPGPPGN----------------------------GKP  345
             G+DG  G+ GA G  G KGE G PG PG                             G P
Sbjct  981   GDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAP  1040

Query  346   SLLQANTPTGFVGPA--GDKGDKGDEGPPGPQGL---------RGDSGTPGDQCRPGEPG  394
                    P G   PA  G  G KG+ G PGP GL         RGD G PG Q RPGEPG
Sbjct  1041  GAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPG  1100

Query  395   LPGEKGLPGPPGLRGRDGFAGPPAPLVRKEIPVTKVFQDYLAGLDSRESQ  444
               G  G PG  G+ G  G  G P P    + P     +  + GLD R  Q
Sbjct  1101  AKGLGGYPGRNGINGLKGATGFPGP----QGPKGPQGESGVVGLDGRNGQ  1146


 Score = 102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 135/398 (34%), Positives = 168/398 (42%), Gaps = 110/398 (28%)

Query  132   DSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRG------------P  179
             +  N         G +G  G  GL G+PG  G PG  G  GE G+RG            P
Sbjct  908   NGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGP  967

Query  180   PGPSGPQGQKGDMGKTGQPGFPGINGI------QGFPGIAGLPGAPGLDGCNGTDGSPGL  233
              GP+G  G KG  G  G  G+PG NG+       G PG  G PGA G+   +G  G  G 
Sbjct  968   RGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGE  1027

Query  234   PGLEGPMGPRGFPGLPGDKGEKG-----EPALTGIH-NKGQKGEPGADGI---------D  278
              GL GP+   G+PG PG KG++G     +PAL G+   KG+ G PG +G+          
Sbjct  1028  SGLTGPI---GYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQR  1084

Query  279   GARGMPGDIGPPGEPGPK------------GDMGPIGPPGPYGPKGEKGNDGV-------  319
             G RG+PG  G PGEPG K            G  G  G PGP GPKG +G  GV       
Sbjct  1085  GDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRN  1144

Query  320   -------------------------------------------GFEGAKGDKGFKGEPGP  336
                                                        GF G +G +G +GE G 
Sbjct  1145  GQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGD  1204

Query  337   PGPPG-------NGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGL-----RGDSGTP  384
              GP G        G+   +      GF G  G KG +GD+GP GP G+     +GD G  
Sbjct  1205  MGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA  1264

Query  385   GDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAPLVR  422
             G   R G PG  G+KG PGPPG  G +G  G   P ++
Sbjct  1265  GLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQ  1302


 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 126/332 (38%), Positives = 157/332 (47%), Gaps = 39/332 (12%)

Query  106   YPGRDRTPYNRTYYE--RDNFLVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQG  163
              PGR     +R++Y     +  +  +RG+  +  P  F   G  GA+GE G  G  GQ G
Sbjct  1173  IPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFI--GPPGAKGERGDIGYAGQLG  1230

Query  164   FPGGEGSPGEKGQRGPPGP-----------------SGPQGQKGDMGKTGQPGFPGINGI  206
             F G EG  G +G +GP GP                  G  G+ G  G+ G PG PG NG 
Sbjct  1231  FDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGP  1290

Query  207   QGFPGIAG--LPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGEKGEP--ALTG  262
              G  G  G  + G PG  G  G  G+PG  G  G +GP+G  G  G +GE+GE   A+ G
Sbjct  1291  NGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVG  1350

Query  263   ----IHNKGQKGEPGADGIDGARGMPG------DIGPPGEPGPKGDMGPIGPPGPYGPKG  312
                 I + G +GEPG DG  G +G PG       +G PG  GP GD G  G  G  G  G
Sbjct  1351  RQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVG  1410

Query  313   EKGNDGVGFEGAKGDKGFKGEPGPPGPPGN----GKPSLLQANTPTGFVGPAGDKGDKGD  368
              KG  GV +  +    G +GEPG  G  G     G P L+      G VG  GD+G+ G 
Sbjct  1411  PKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGY  1470

Query  369   EGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKG  400
              G  GPQG RGD G  G    PG  GLPG +G
Sbjct  1471  TGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG  1502


 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 136/291 (47%), Gaps = 35/291 (12%)

Query  155  LTGMPGQQGFPGGEGSPGEKGQRGP------PGPSGPQGQKGDMGKTGQPGFPGINGIQG  208
              G+PG  G+ G  G PGEKG RG        GP GP+GQ+GD G  G  G  G  G+ G
Sbjct  502  FRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTG  561

Query  209  FPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKGE--KGEPALTGIHNK  266
              G+ GL G PG  G  G  G  G+PG  G +G  G  G   + G   KGE   TG  + 
Sbjct  562  PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTG--DS  619

Query  267  GQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV-------  319
            G +G+ G DG  G  G  G  G  GE G +GD G  G  G  G  G  G DG        
Sbjct  620  GHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATT  679

Query  320  ---------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANT----PTGFVGPAGDKGDK  366
                     G++G KG++G  G+ G  G  G   P  +  NT      G+ GP G KG K
Sbjct  680  PKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAK  739

Query  367  GDEGPPGPQGLRGDSG-----TPGDQCRPGEPGLPGEKGLPGPPGLRGRDG  412
            G++G  G +G  GD G      PG     G PG  G+ G  G PGL GRDG
Sbjct  740  GEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDG  790


 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 148/378 (39%), Gaps = 101/378 (27%)

Query  129   QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ  188
             QRG   +  P      G KG  G PG  G+PG+ G          KGQRG  G  G QG+
Sbjct  1045  QRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGL---------KGQRGDRGLPGQQGR  1095

Query  189   KGDMGKTGQPGFPGINGIQGFPGIAGLPG------------APGLDGCNGTDGSPGLPGL  236
              G+ G  G  G+PG NGI G  G  G PG              GLDG NG  G  G  GL
Sbjct  1096  PGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGL  1155

Query  237   ----------------------------------------------EGPMGPRGFPGLPG  250
                                                           +G MGP GF G PG
Sbjct  1156  IGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPG  1215

Query  251   DKGEKGEPALTG------------------------IHNKGQKGEPGADGIDGARGMPGD  286
              KGE+G+    G                        I    +KG+ G  G+DG  G PG 
Sbjct  1216  AKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGH  1275

Query  287   IGPPGEPGPKGDMGPIGPPGPYGPK-----GEKGNDGVGFEGAKGDKGFKGEPGPPGPPG  341
              G  G PGP G+ GP G  G  GP+     G +G+  VGF GA G  G  G  GP G  G
Sbjct  1276  FGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGD--VGFPGAPGHNGRHGLIGPKGELG  1333

Query  342   NGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDS---GTPGDQCRPGEPGLPGE  398
             +      +  +    VG  GD GD G +G PG  G +G+    G PG   R G PG  G 
Sbjct  1334  DMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGP  1393

Query  399   KGLPGPPGLRGRDGFAGP  416
              G  G  G+ G DG  GP
Sbjct  1394  TGDAGWGGIDGMDGLVGP  1411


 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 150/348 (43%), Gaps = 73/348 (21%)

Query  141  FAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGK------  194
              + G  G +G+ G  G  G+ G  G +G  GE GQRG  G +G QG+ G+ G+      
Sbjct  613  IGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGA  672

Query  195  ------------TGQPGFPGI------NGIQGFPGIAGLP------------------GA  218
                         G+PG+ GI      +G  GF G+ G P                  G 
Sbjct  673  PGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGP  732

Query  219  PGLDGCNGTDGSPGLPG-----------LEGPMGPRGFPGLPGDKGEKGEPAL-------  260
             G+ G  G  G+ GL G           + GP+G +G+PG  GD G++G P L       
Sbjct  733  KGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEP  792

Query  261  ---TGIHNKGQKGEPGADGI---------DGARGMPGDIGPPGEPGPKGDMGPIGPPGPY  308
                GI  KGQ+G PG + I          G +G PGD+G PG+ G  G  GP G  G  
Sbjct  793  GLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQ  852

Query  309  GPKGEKGNDGV-GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKG  367
            GP G  G  G+ G +G +GD           P  NG+ +   A    G VG  G  G  G
Sbjct  853  GPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNG  912

Query  368  DEGPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAG  415
             +G  G  G RG  G  G Q  PG PG+PG  G+ G  G RG  G+ G
Sbjct  913  AKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNG  960


 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 136/305 (45%), Gaps = 38/305 (12%)

Query  145  GSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQKGDMGKTG--------  196
            GS G +G  GLTG  G QG    +G+PG  G +G PGP+G  G+ G +G  G        
Sbjct  549  GSHGNRGAIGLTGPRGVQGL---QGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEV  605

Query  197  ---QPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGLPGLEGPMGPRGFPGLPGDKG  253
               + G  G  G  G  G  G  G  G DG +G+ G  G  G  G  G  G+ G  G+ G
Sbjct  606  GSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPG  665

Query  254  EKGEPALTGIHNKGQK----GEPGADGIDGARGMPGDI---GPPGEPGPKGDMGPIGPPG  306
              G     G +    K    GEPG DGI G RG  GD    G  GEP P       G PG
Sbjct  666  RDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPG  725

Query  307  PYGPKGEKGNDGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDK  366
              G  G KG  G   +G +G  G +GE G  GP G   P  + A    G+ GP GD G +
Sbjct  726  EDGYTGPKGVKGA--KGEQGAIGLRGEIGDRGPAGEVIPGPVGAK---GYPGPTGDYGQQ  780

Query  367  GDEGPPGPQ---------GLRGDSGTPGDQCRPGE---PGLPGEKGLPGPPGLRGRDGFA  414
            G  G PG           G +G  G PG +   GE   PG  G KG PG  G  G+ G A
Sbjct  781  GAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLA  840

Query  415  GPPAP  419
            G P P
Sbjct  841  GRPGP  845


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 162/370 (44%), Gaps = 80/370 (22%)

Query  130  RGDSANCTPKCFAEKGSKGAQGEPG------------LTGMPGQQGFPGGEGSPGEKGQR  177
            +GD+   +   ++  G  GA+GEPG            L G  G  G  G EG  G  G++
Sbjct  214  KGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQ  273

Query  178  GPPGPSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSP------  231
            G  G +G  G +G++G  G+ G PG +G  G  G  G+ GAPG  G +G DGSP      
Sbjct  274  GAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGED  333

Query  232  ---GLPGLEGPMGPRGF------PGLPGDKGEKGEPALTG----------------IHNK  266
               G+PG++G  GP G         LPG  G +G+    G                I   
Sbjct  334  GFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLA  393

Query  267  GQKGEPGADGIDG-----ARGMPGDIGPPGEPGPKGDMGPIGPPGPYGPKGEKGNDGV--  319
            GQ G+PG +G  G      RG  GD G  G PGP+G  G  G PG YG  GE G + V  
Sbjct  394  GQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGP  453

Query  320  ----------GFEGAKGDKGFKGEPGPPGPPGNGKPSLLQANTP--------------TG  355
                      G EG +GD+G  G PG  G PG G   +    +                G
Sbjct  454  KGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNG  513

Query  356  FVGPAGDKGDKGDE------GPPGPQGLRGDSGTPGDQCRPGEPGLPGEKGLPGPPGLRG  409
              G  G+KG +GD+      GP GP+G  GD+G PG     G  GL G +G+ G  G  G
Sbjct  514  LRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG  573

Query  410  RDGFAGPPAP  419
            R G  G P P
Sbjct  574  RAGHKGLPGP  583


 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 124/389 (32%), Positives = 155/389 (40%), Gaps = 99/389 (25%)

Query  122  DNFLVVNQRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPG  181
            D+   V +  D+          +G +G QG  G  G  G+ G PG  G  G  G+RG PG
Sbjct  239  DSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPG  298

Query  182  PSGPQGQKGDMGKTGQPGFPGINGIQGFPGIAGLPGAPGLDGCNGTDGSPGL------PG  235
              G  G+ GD G  G PG+ G +G+ G PG  G  G  G+ G  G  G PG+        
Sbjct  299  KDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKS  358

Query  236  LEGPMGPRGF------------------------------PGLPGDKG------------  253
            L GP+G +G                               PGL G +G            
Sbjct  359  LPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGD  418

Query  254  --------------EKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDM  299
                          E G P   G+H     GEPG + + G +G PG  G PG  G +GD 
Sbjct  419  YGFIGPPGPQGPPGEAGLPGRYGLH-----GEPGQN-VVGPKGEPGLNGQPGLEGYRGDR  472

Query  300  GPIGPPGPYGPKGEKGN--------DGVGFEGAKGDKGFKGEPGPPGPPGNGKPSLLQAN  351
            G +G PG  G  GE  N           GF G  GD G+ G  G PG  G     L   +
Sbjct  473  GEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKG-----LRGDD  527

Query  352  TPTGFVGPAGDKGDKGDEGPPG------------PQGLRGDSGTPGDQCRPGEPGLPGEK  399
             P    GP G +G +GD G PG            P+G++G  G PG   R G  GLPG  
Sbjct  528  CPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG---RAGHKGLPGPA  584

Query  400  GLPGPPGLRGR---DGFAGPPAPLVRKEI  425
            G+PG PG  G    DG A     L + EI
Sbjct  585  GIPGEPGKVGAAGPDGKAIEVGSLRKGEI  613


 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 89/172 (52%), Gaps = 16/172 (9%)

Query  129   QRGDSANCTPKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQGQ  188
             +RG+S         + G  G QGEPG  G  G+QG+P   G PG+ G+ G PGP GP   
Sbjct  1340  ERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYP---GLPGKNGRVGAPGPRGP---  1393

Query  189   KGDMGKTGQPGFPGINGIQGFPGIA--------GLPGAPGLDGCNGTDGSPGLPGLEGPM  240
              GD G  G  G  G+ G +G PG+         G  G PGLDG  G +G  G PGL G  
Sbjct  1394  TGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQ  1453

Query  241   GPRGFPGLPGDKGEKGEPALTGIHNKGQKGEPGADGIDGARGMPGDIGPPGE  292
             G RG  G  GD+GE G     G   +GQ+G+ G  G+ GA G+ G  GP GE
Sbjct  1454  GQRGAVGYRGDQGEVGYTGADG--PQGQRGDKGYMGLTGAPGLRGLPGPQGE  1503


 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 152/424 (36%), Gaps = 150/424 (35%)

Query  138  PKCFAEKGSKGAQGEPGLTGMPGQQGFPGGEGSPGEKGQRGPPGPSGPQ-----------  186
            P    + G  G  G  G+ G  G+ G  G  G+PG+ G RGPPG  G Q           
Sbjct  104  PGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGI  163

Query  187  ---GQKGDMGKT------------------GQPGFPGINGIQGFPGIAG-----------  214
               G KG+ G+T                  G  G+ G+ G +G PG+ G           
Sbjct  164  NSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSEL  223

Query  215  ---LPGAPGL---------------DGCNGTDGSPGLPGLEGPMGPR------GFPGLPG  250
               L G PG                D   G  G  GL G EGP GP       G  GLPG
Sbjct  224  PYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPG  283

Query  251  DKGEKGEPALTG----------IHNKGQKGEPGADGIDGARGMPGDIGPPGEPGPKGDMG  300
             +GE G P   G            +KG KG PG  G DG  G PG+ G  G  G  G  G
Sbjct  284  ARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQG  343

Query  301  PIGPPGPY---------GPKGEKGNDG-------------------VGFEGAKGDKGFKG  332
              GPPG Y         GP G +G+ G                   +G  G  GD G  G
Sbjct  344  GAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNG  403

Query  333  EPGPPGPPGNGKPSL-----------------------LQANTPTGFVGPAGDKGDKGDE  369
              GPPG    G+                          L        VGP G+ G  G  
Sbjct  404  SRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQP  463

Query  370  GPPGPQGLRGDSGTPGDQCRPGE----------------PGLPGE------KGLPGPPGL  407
            G  G +G RG+ G PGD+  PGE                 GLPG+      +GLPG  GL
Sbjct  464  GLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGL  523

Query  408  RGRD  411
            RG D
Sbjct  524  RGDD  527


 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 50/96 (52%), Gaps = 2/96 (2%)

Query  324  AKGDKGFKGEPGPPGPPGNGKPSLLQANTPTGFVGPAGDKGDKGDEGPPGPQGLRGDSGT  383
             KG KG  G PGP G PG   P+      P G  GP G+KGD G+ G  G +G RGD G 
Sbjct  40   CKGIKGRMGAPGPIGVPGLEGPA--GDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP  97

Query  384  PGDQCRPGEPGLPGEKGLPGPPGLRGRDGFAGPPAP  419
             G+   PG  G  GE G PGP G+ G DG  G   P
Sbjct  98   KGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGP  133



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01570.1.1 Collagen

Length=1536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMV5_DROME  unnamed protein product                                 619     0.0   
O18407_DROME  unnamed protein product                                 610     0.0   
CO4A1_DROME  unnamed protein product                                  534     2e-161


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1539 (45%), Positives = 839/1539 (55%), Gaps = 62/1539 (4%)

Query  4     TRHRY-VIFYVFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGN  62
              RH   ++  V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG 
Sbjct  6     LRHLSGLLGVVYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGP  61

Query  63    PGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGL  122
              GD GP G  GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+
Sbjct  62    AGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGI  121

Query  123   DGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQ  182
             DGC+G  G  G +G PG +G RG  G  GQ+G  G+ GEGGINSKGTKG  G  G PG  
Sbjct  122   DGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGV  181

Query  183   GPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPG  242
             GP G  G+RG  G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG   
Sbjct  182   GPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG---  238

Query  243   PIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQ  302
                 D+         + KG KG  G +GD GP G  GE+G  GR G+       G +G  
Sbjct  239   ----DSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEI  288

Query  303   GREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDR  362
             G  G RGK GKDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  
Sbjct  289   GGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPP  348

Query  363   GIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPK  422
             GIYDP+L K  PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP 
Sbjct  349   GIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP  408

Query  423   GISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGV  482
             G S  GEAG  G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G 
Sbjct  409   GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGY  468

Query  483   QGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDC  542
             +GDRG+ G+ G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC
Sbjct  469   RGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDC  528

Query  543   GFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQG  602
               C  G  G +G+ G+    G PG  G  G +G  G RG  G  G PG  G  G  G  G
Sbjct  529   PVCNAGPRGPRGQEGDT---GYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAG  585

Query  603   IEGPPGPPGAPGKLAPLSRVDIARA--VGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQ  660
             I G PG  GA G       V   R   +GD G  G +G  G +G  G  G  G+K   G+
Sbjct  586   IPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSK---GE  642

Query  661   PGRKGEKGPYGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEPGTPGD  720
              G  G++G YG  G +GRDG PGR+G  G+ G  AT PK YL G+ GYDG+ GE G  GD
Sbjct  643   RGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGD  702

Query  721   MGLKGEAGD----TISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGE  776
              G KG  G+     I       GE GY G        G +GE G  G +G  GD GP GE
Sbjct  703   TGFKGVKGEPNPGQIYDNTGEPGEDGYTG---PKGVKGAKGEQGAIGLRGEIGDRGPAGE  759

Query  777   PGISLQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIFFPGP  836
                 + GP G KG PG  GD+G +GA G  G  G PGL G  G KG RG  G+ +   G 
Sbjct  760   ---VIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEV-IQGE  815

Query  837   PGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDMLP  896
              G PGR G KG PGD G  G  G+ G  G KGV G +G  G  G+TGLPG KG+ GD L 
Sbjct  816   IGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLV  875

Query  897   GYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRGQQGDPGPDGIP  956
             G PG  G PG  G +   G KG  G  G+ G +G  G KGS G  G RG  G+ G  G+P
Sbjct  876   GPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLP  935

Query  957   GRPGRVLHPGATGIPGDKGDIGPPGSTGFVGKPGLQGLPGNKGEQGRRGTPGPVGQMGPP  1016
             G PG    PG  G  G++G+IG  G  G +G  G  G  G KG  G  G  G  G  G P
Sbjct  936   GSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLP  995

Query  1017  GAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGES  1076
             G KG  G+ G  G PG  G +A+SG++GD GE G TGP+GYPG PG  G+ GP+GD   +
Sbjct  996   GRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPA  1055

Query  1077  IDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLNG  1136
             +DG  G  G  G  G NGLPGR G KG  G  G  G +G  GEPG KG  G  G  G+NG
Sbjct  1056  LDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGING  1115

Query  1137  THGWPGEPGPRGPPGVKGEPGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIG  1196
               G  G PGP+GP G +GE G+    GL G  G  GD+GPRG  G  G  G +G+ G++G
Sbjct  1116  LKGATGFPGPQGPKGPQGESGV---VGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVG  1172

Query  1197  LP---ENIIVAT--KGDFGEPGMTGLTGEKGWRGDVGWPGRNGTKGLPGAIGPQGEPGFP  1251
             +P   EN+   +  +G  G+ G+ G  GE+G  G +G+ G  G KG  G IG  G+ GF 
Sbjct  1173  IPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFD  1232

Query  1252  GYQGPKGPVGMRGPPGIPGLTDVMLAERGDPGRDGLPGRDGKPGLPGVKGAPGEYGIDGP  1311
             G +G KG  G +GP G PG+T  + AE+GD G  GL GR G+PG  G KGAPG  G +GP
Sbjct  1233  GAEGLKGFQGDQGPRGPPGIT--LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGP  1290

Query  1312  PGPPGAPGLSRKGNP---GKPGYPGRIVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRPI  1368
              G  G  G   +G P   G  G+PG    G  G  GL G  G+ G  G +GE GE G  I
Sbjct  1291  NGAIGHRGPQIQGPPGPQGDVGFPG--APGHNGRHGLIGPKGELGDMGRQGERGESGYAI  1348

Query  1369  PGPRGQPGLIGIAGT---NGAKGETGPPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGT  1425
              G +G  G IG  G    +GAKGE G PG  G  G  G PG    RG  GD G  G+DG 
Sbjct  1349  VGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGP---RGPTGDAGWGGIDGM  1405

Query  1426  PGEKGFQGEPGDTLAYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGN  1485
              G  G +G+PG T +Y++     R G+ G  G +G  G +G  G  GL G+ G  G  G 
Sbjct  1406  DGLVGPKGQPGVTYSYSM----ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGY  1461

Query  1486  PGPQGSLGQPGDAGPDGRPGSPGPVGFQGIPGAPGLPAP  1524
              G QG +G  G  GP G+ G  G +G  G PG  GLP P
Sbjct  1462  RGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGP  1500


 Score = 310 bits (795),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 483/1330 (36%), Positives = 588/1330 (44%), Gaps = 262/1330 (20%)

Query  60    EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
              G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190   RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97    GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
               +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250   TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154   GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
             G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310   GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206   -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                              RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370   GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235   ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                        G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430   PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285   GR-------------------PGIDGYPGIKGV---KGVQGRE---------GWRGKEGK  313
             G                    PG DGY G++G+   KG++G +         G RG+EG 
Sbjct  485   GEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314   DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
              G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545   TGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374   PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
              G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605   VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429   EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
             E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663   EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467   PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
              PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723   EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526   PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRM-----  574
             PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+      
Sbjct  783   PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  575   ----GEKGSRGPDGKMGP---PGNKGLDGK--------------------HGTQGIEGPP  607
                 G KG +GPDG +G    PGNKG  G                     HG +G +G  
Sbjct  843   PGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEV  902

Query  608   GPPGAPGKLAPLSRVDIA---RAVGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRK  664
             G  G  G+      +  +     +G+ GLQG+ G PG  GLPG++G  G +G  G  GR+
Sbjct  903   GSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQ  962

Query  665   ---------GEKGPYGAPGDEGRDGLPGRNGVPGSKGDP------------ATIPKEYLR  703
                      GE GP G  GD+G DG PG NG+PG KG+                    ++
Sbjct  963   GDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIK  1022

Query  704   GDAGYDGLP---GEPGTPGDMGLKGEAGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPG  760
             GD G  GL    G PG PG  G +G  GD+  +   + G KG  G       PG  G  G
Sbjct  1023  GDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG  1082

Query  761   IPGDKGIPGDSGPIGEPGIS-------LQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPG  813
               GD+G+PG  G  GEPG           G  G KG  G PG  GPKG QG +G+ GL G
Sbjct  1083  QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDG  1142

Query  814   LPGQSGGKGDRGSVG------------------------ESIFFPGPPGTPGRPGSKGEP  849
               GQ G +G RG +G                        +  F+ G  G  G  G +GE 
Sbjct  1143  RNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQ  1202

Query  850   GDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEE------GDMLPGYPGTPG  903
             GD GP+G+ G PG  G +G  G  G  G  G  GL G +G++      G  LP   G  G
Sbjct  1203  GDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEG  1262

Query  904   VPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGP--LGPRGQQGDPGPDGIPGRPGR  961
             V G+ G  G  G  G  G  G PG +G  G  G RGP   GP G QGD G  G PG  GR
Sbjct  1263  VAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGR  1322

Query  962   VLHPGATGIPGDKGDIGPPGSTGF--------VGKPGLQGLPGNKGEQGRRGTPGPVGQM  1013
                 G  G  GD G  G  G +G+        +G  G QG PG  G +G +G PG  G+ 
Sbjct  1323  HGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKN  1382

Query  1014  GPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDL  1073
             G  GA G  G  GDAG+ G DG     GL G KG+PG T        PG  GEPG  G  
Sbjct  1383  GRVGAPGPRGPTGDAGWGGIDG---MDGLVGPKGQPGVTYSYSMA-RPGDRGEPGLDGFQ  1438

Query  1074  GESIDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPG  1133
             GE  DG     G+ G  GF G  G  G +G  G +G  G  G QG+ G KGY GL G PG
Sbjct  1439  GEEGDG-----GAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPG  1493

Query  1134  LNGTHGWPGE  1143
             L G  G  GE
Sbjct  1494  LRGLPGPQGE  1503


>O18407_DROME unnamed protein product
Length=1761

 Score = 610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/1530 (45%), Positives = 833/1530 (54%), Gaps = 63/1530 (4%)

Query  12    YVFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGP  71
              V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG  GD GP G 
Sbjct  15    VVYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGR  70

Query  72    PGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGA  131
              GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+DGC+G  G 
Sbjct  71    AGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGM  130

Query  132   PGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGER  191
              G +G PG +G RG  G   Q+G  G+ GEGGINSKGTKG  G  G PG  GP G  G+R
Sbjct  131   QGPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDR  190

Query  192   GPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQK  251
             G  G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG       D+   
Sbjct  191   GSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG-------DSLSG  243

Query  252   PGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKE  311
                   + KG KG  G +GD GP G  GE+G  GR G+       G +G  G  G RGK 
Sbjct  244   VLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEIGGPGERGKP  297

Query  312   GKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDK  371
             GKDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  GIYDP+L K
Sbjct  298   GKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTK  357

Query  372   IEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAG  431
               PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP G S  GEAG
Sbjct  358   SLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAG  417

Query  432   VDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGV  491
               G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G +GDRG+ G+
Sbjct  418   DYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGL  477

Query  492   QGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPG  551
              G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC  C  G  G
Sbjct  478   PGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRG  537

Query  552   VKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPPG  611
              +G+ G+    G PG  G  G +G  G RG  G  G PG  G  G  G  GI G PG  G
Sbjct  538   PRGQEGD---TGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVG  594

Query  612   APGKLAPLSRVDIARA--VGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRKGEKGP  669
             A G       V   R   +GD G  G +G  G +G  G  G  G+K   G+ G  G++G 
Sbjct  595   AAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSK---GERGETGQRGD  651

Query  670   YGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEPGTPGDMGLKGEAGD  729
             YG  G +GRDG PGR+G  G+ G  AT PK YL G+ GYDG+ GE G  GD G KG  G+
Sbjct  652   YGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGE  711

Query  730   ----TISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGEPGISLQGPT  785
                  I       GE GY G        G +GE G  G +G  GD GP GE    + GP 
Sbjct  712   PNPGQIYDNTGEPGEDGYTG---PKGVKGAKGEQGAIGLRGEIGDRGPAGE---VIPGPV  765

Query  786   GFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIFFPGPPGTPGRPGS  845
             G KG PG  GD+G +GA G  G  G PGL G  G KG RG  G+ +   G  G PGR G 
Sbjct  766   GAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEV-IQGEIGPPGRSGI  824

Query  846   KGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDMLPGYPGTPGVP  905
             KG PGD G  G  G+ G  G KGV G +G  G  G+TGLPG KG+ GD L G PG  G P
Sbjct  825   KGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQP  884

Query  906   GMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRGQQGDPGPDGIPGRPGRVLHP  965
             G  G +   G KG  G  G+ G +G  G KGS G  G RG  G+    G+PG PG    P
Sbjct  885   GRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGN--LQGLPGSPGIPGLP  942

Query  966   GATGIPGDKGDIGPPGSTGFVGKPGLQGLPGNKGEQGRRGTPGPVGQMGPPGAKGVIGDY  1025
             G  G  G++G+IG  G  G +G  G  G  G KG  G  G  G  G  G PG KG  G+ 
Sbjct  943   GMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNP  1002

Query  1026  GDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGESIDGEPGYPG  1085
             G  G PG  G +A+SG++GD GE G TGP+GYPG PG+ G+ GP+GD   ++DG  G  G
Sbjct  1003  GFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKG  1062

Query  1086  SNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLNGTHGWPGEPG  1145
               G  G NGLPGR G KG  G  G  G +G  GEPG KG  G  G  G+NG     G PG
Sbjct  1063  EVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPG  1122

Query  1146  PRGPPGVKGEPGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIGLP---ENII  1202
             P+GP G +GE G+    GL G  G  GD+GPRG  G  G  G +G+ G++G+P   EN+ 
Sbjct  1123  PQGPKGPQGESGV---VGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLR  1179

Query  1203  VAT--KGDFGEPGMTGLTGEKGWRGDVGWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPV  1260
               +  +G  G+ G+ G  GE+G  G +G+ G  G KG  G IG  G+ GF G +G KG  
Sbjct  1180  DRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQ  1239

Query  1261  GMRGPPGIPGLTDVMLAERGDPGRDGLPGRDGKPGLPGVKGAPGEYGIDGPPGPPGAPGL  1320
             G +GP G PG+T  + AE+GD G  GL GR G+PG  G KGAPG  G +GP G  G  G 
Sbjct  1240  GDQGPRGPPGIT--LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGP  1297

Query  1321  SRKGNP---GKPGYPGRIVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRPIPGPRGQPGL  1377
               +G P   G  G+PG    G  G  GL G  G+ G  G +GE GE G  I G +G  G 
Sbjct  1298  QIQGPPGPQGDVGFPG--APGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGD  1355

Query  1378  IGIAGT---NGAKGETGPPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGE  1434
             IG  G    +GAKGE G PG  G  G  G PG    RG  GD G  G+DG  G  G +G+
Sbjct  1356  IGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGP---RGPTGDAGWGGIDGMDGLVGPKGQ  1412

Query  1435  PGDTLAYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGNPGPQGSLGQ  1494
             PG T +Y++     R G+ G  G +G  G +G  G  GL G+ G  G  G  G QG +G 
Sbjct  1413  PGVTYSYSM----ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGY  1468

Query  1495  PGDAGPDGRPGSPGPVGFQGIPGAPGLPAP  1524
              G  GP G+ G  G +G  G PG  GLP P
Sbjct  1469  TGADGPQGQRGDKGYMGLTGAPGLRGLPGP  1498


 Score = 305 bits (782),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 481/1328 (36%), Positives = 582/1328 (44%), Gaps = 260/1328 (20%)

Query  60    EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
              G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190   RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97    GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
               +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250   TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154   GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
             G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310   GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206   -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                              RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370   GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235   ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                        G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430   PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285   GR-------------------PGIDGYPGIKGVKGVQGREGW------------RGKEGK  313
             G                    PG DGY G++G+ G +G  G             RG+EG 
Sbjct  485   GEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314   DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
              G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545   TGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374   PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
              G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605   VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429   EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
             E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663   EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467   PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
              PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723   EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526   PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRM-----  574
             PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+      
Sbjct  783   PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  575   ----GEKGSRGPDGKMGP---PGNKGLDG--------------KHGTQGIEGPPGPPGAP  613
                 G KG +GPDG +G    PGNKG  G              ++G Q   G  G  G  
Sbjct  843   PGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEV  902

Query  614   GKLAPLSRVDIARAVGDQG-------LQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRK--  664
             G L    +     ++G  G       LQG+ G PG  GLPG++G  G +G  G  GR+  
Sbjct  903   GSLGQNGQNGAKGSIGFSGRRGLLGNLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD  962

Query  665   -------GEKGPYGAPGDEGRDGLPGRNGVPGSKGDP------------ATIPKEYLRGD  705
                    GE GP G  GD+G DG PG NG+PG KG+                    ++GD
Sbjct  963   IGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGD  1022

Query  706   AGYDGLP---GEPGTPGDMGLKGEAGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIP  762
              G  GL    G PG PG  G +G  GD+  +   + G KG  G       PG  G  G  
Sbjct  1023  DGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQR  1082

Query  763   GDKGIPGDSGPIGEPGIS-------LQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLP  815
             GD+G+PG  G  GEPG           G  G K   G PG  GPKG QG +G+ GL G  
Sbjct  1083  GDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPGPQGPKGPQGESGVVGLDGRN  1142

Query  816   GQSGGKGDRGSVG------------------------ESIFFPGPPGTPGRPGSKGEPGD  851
             GQ G +G RG +G                        +  F+ G  G  G  G +GE GD
Sbjct  1143  GQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGD  1202

Query  852   EGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEE------GDMLPGYPGTPGVP  905
              GP+G+ G PG  G +G  G  G  G  G  GL G +G++      G  LP   G  GV 
Sbjct  1203  MGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA  1262

Query  906   GMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGP--LGPRGQQGDPGPDGIPGRPGRVL  963
             G+ G  G  G  G  G  G PG +G  G  G RGP   GP G QGD G  G PG  GR  
Sbjct  1263  GLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHG  1322

Query  964   HPGATGIPGDKGDIGPPGSTGF--------VGKPGLQGLPGNKGEQGRRGTPGPVGQMGP  1015
               G  G  GD G  G  G +G+        +G  G QG PG  G +G +G PG  G+ G 
Sbjct  1323  LIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGR  1382

Query  1016  PGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGE  1075
              GA G  G  GDAG+ G DG     GL G KG+PG T        PG  GEPG  G  GE
Sbjct  1383  VGAPGPRGPTGDAGWGGIDG---MDGLVGPKGQPGVTYSYSMA-RPGDRGEPGLDGFQGE  1438

Query  1076  SIDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLN  1135
               DG     G+ G  GF G  G  G +G  G +G  G  G QG+ G KGY GL G PGL 
Sbjct  1439  EGDG-----GAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLR  1493

Query  1136  GTHGWPGE  1143
             G  G  GE
Sbjct  1494  GLPGPQGE  1501


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 534 bits (1375),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 665/1573 (42%), Positives = 810/1573 (51%), Gaps = 170/1573 (11%)

Query  25    SHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEW  84
             +  +G  GC  +      G  GLPG  G  G++G  G PG    +GP G  G++G  G +
Sbjct  72    NCTAGYAGCVPKCIAE-KGNRGLPGPLGPTGLKGEMGFPGM---EGPSGDKGQKGDPGPY  127

Query  85    GETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKR  144
             G+ G+KG RG  G  G  G  G+QG  G PG PG  G DGC+G DG PG+ G+ G  G R
Sbjct  128   GQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPR  187

Query  145   GEFGADGQRGLRGDPG-EGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGER  203
             G  G  G +G +G+P  E G  +KG KGE G  G  GL GP+G  GE+G  G  GPYG +
Sbjct  188   GYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAK  247

Query  204   GPRGQIGFPGPRGDPGAENVGPT--GVRGEDGDVGEPGPPGPIIEDTEQKPGNISYSFKG  261
             GPRG+ G    +G+ GA   GP   G  G  G+ GEP    P+      KP   +++  G
Sbjct  248   GPRGEHGL---KGEKGASCYGPMKPGAPGIKGEKGEPASSFPV------KP---THTVMG  295

Query  262   PKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAG  321
             P+G  G +G+ G  G KGE G  G  G+DG    KG KG+ G  G RG++G  G PG  G
Sbjct  296   PRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQ---KGEKGLPGGPGDRGRQGNFGPPGSTG  352

Query  322   VKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEP-------  374
              KGD+G PGL   +G PG PG KG+ G  G  G  G  G  G          P       
Sbjct  353   QKGDRGEPGL---NGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPR  409

Query  375   ---GVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAG  431
                G  GPQG  G  G PG  GYNG+ G  GL GR G  GPPG             GE G
Sbjct  410   GYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGK-----------KGEKG  458

Query  432   VDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGV  491
               G  GP G  G  G PG PG  G KG  G+   G  G  G  G  G+ G++G +G+ G 
Sbjct  459   TAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGF  518

Query  492   QGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPG  551
             +G  G PG  K   G PG PG+ G PG +GD G PG PG+ G  G KG+  G C   R G
Sbjct  519   KGNAGAPGDSK--LGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAG  576

Query  552   VKGEAGEAAINGIPGD------PGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEG  605
              KG+ G + + GIPG       PG  G  GE+G  G +G+ GPPG KG DG+ G  G  G
Sbjct  577   PKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATG  636

Query  606   PPGPPGAPGKLAPLSRVDIARAVGDQGL------QGMKGYPGSEGLPGLVGPPGAKGFPG  659
              PG P     L  LS ++  +  GD+G       +G++G+ G+EGLPG+ GP G  GF  
Sbjct  637   EPGKP----ALCDLSLIEPLK--GDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGF--  688

Query  660   QPGRKGEKGPYGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGY---DGLPGEPG  716
                 KGEKG  GAPG++G  G  GR+G PG       IP + ++G+ G+   DG  G+ G
Sbjct  689   ----KGEKGLSGAPGNDGTPGRAGRDGYPG-------IPGQSIKGEPGFHGRDGAKGDKG  737

Query  717   TPGDMGLKGEAGDTISSEVNM--KGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPI  774
             + G  G KGE G     E+ M  KG KG PG       PG +G PG  G  G+ G++GP 
Sbjct  738   SFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQ  797

Query  775   GEPGISLQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIFFP  834
             G PG+  +GP G  G  G  G+ G  G  G  G  GL G+PG++G  G RG  G  I  P
Sbjct  798   GPPGV--EGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG--ISRP  853

Query  835   GPPGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDM  894
             GP G PG  G +GE GD GP G  G PG DG  G  G +G  GL G +G PG+ GE+GD+
Sbjct  854   GPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDV  913

Query  895   LP----GYPGTPGVPGMPGLKGITGDKG---STGLDGTPGPDGDRGKKGSRGPLGPRGQQ  947
              P    G  G PGVPG+ G++G  G KG   S GL G PG  GDRG  G+ GP G  G  
Sbjct  914   GPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVT  973

Query  948   GDPG---PDGIPGRPGRVLHPGATGIPGDKGDIGPPGSTG---FVGKPGLQGLPGNKGEQ  1001
             G PG   P GIPG  G     GATG+ G+ G +G  G  G    +G  G QGL G  G+Q
Sbjct  974   GAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQ  1033

Query  1002  GRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLP  1061
             G  G PG  G  G PG  G  G  GDA   G+ GE   SGL+GD      TGP G PG P
Sbjct  1034  GLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGD------TGPAGTPGWP  1087

Query  1062  GIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPG  1121
             G  G PG       ++ G  G PG  G  G +G+ GR G  G  G   E G +G  G+PG
Sbjct  1088  GEKGLPG------LAVHGRAGPPGEKGDQGRSGIDGRDGINGEKG---EQGLQGVWGQPG  1138

Query  1122  PKGYAGLAGLPGLNGTHGWP---------GEPGPRGPPGVKGEPGMDGDPGLSGNPGIPG  1172
              KG  G  G+PG  G  G P         G PG RG    KGEPG+      SG PG+ G
Sbjct  1139  EKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGD---KGEPGL------SGLPGLKG  1189

Query  1173  DRGPRGGPGLSGAPGPKGE---PGDIGLPENI--IVATKGDFGEPGMTGLTGEKGWRGDV  1227
             + GP G  G +GAPGPKGE    G  GLP  +  I   KG  GE G TG  GE+G RG  
Sbjct  1190  ETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLT  1249

Query  1228  GWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPVGMRGPPGIPGLTDVMLAERGDPGRDGL  1287
             G  G  G KG  G  GP G  G  G  G KG +G RG  G PG+T  +  E+G PGR G 
Sbjct  1250  GPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVT--IKGEKGLPGRPGR  1307

Query  1288  PGRD---------GKPGLPGVKGAPGEYGIDGPPGPPGAPGLSRKGNPGKPGYPGRIVEG  1338
              GR          G+ GLPG+ G PG  G+ GP GP G+ G   +G  G PG PG+  +G
Sbjct  1308  NGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKG--ERGLAGSPGQPGQ--DG  1363

Query  1339  LPGLPGLPGEDGKPGTPGVRGEPGEPG-------RPIPGPRGQPGLIGIAGTNGAKGETG  1391
              PG PGL G+ G  G  G RG  G  G       R + GP G PGL+      G KG+TG
Sbjct  1364  FPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLV------GQKGDTG  1417

Query  1392  PPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQWTRGRAG  1451
              PG  G +G  G P   G+RGF G  G  G DGTPG  G +GEPG       +   G+ G
Sbjct  1418  YPGLNGNDGPVGAP---GERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPG  1474

Query  1452  EIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGNPGPQGSLGQPGDAGPDGRPGSPGPVG  1511
               GP+G  G PG  GL G +G +G  G+ GL G  G  G  G  GD G  G  G  G +G
Sbjct  1475  RNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIG  1534

Query  1512  FQGIPGAPGLPAP  1524
               G  G PG PAP
Sbjct  1535  LIGQKGEPGAPAP  1547


 Score = 381 bits (978),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 504/1253 (40%), Positives = 600/1253 (48%), Gaps = 189/1253 (15%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGE-----------  89
              +G+ GLPG +G  G +G  G PG  G +GPPG  G++G  G  G  G            
Sbjct  420   LNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPG  479

Query  90    -KGMRGDKGF-----QGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIA--GIPGTS  141
              +G +GD G      QG KG AG+ GYPG     G KG  G  G  GAPG +  G PGT 
Sbjct  480   PEGQKGDAGLPGYGIQGSKGDAGIPGYPG---LKGSKGERGFKGNAGAPGDSKLGRPGTP  536

Query  142   GKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYG  201
             G  G  G  G  G  G PG+ G    G KG+ G        GP+G  G  G PG  G  G
Sbjct  537   GAAGAPGQKGDAGRPGTPGQKG--DMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDG  594

Query  202   ERGPRGQIGFPGPRGDPGAE-NVGPTGVRGEDGDVGEPGPPG----PIIEDTEQKPGNIS  256
              RGP G+ G+PG RG  G     GP G +GEDG  G PG  G    P + D      ++ 
Sbjct  595   ARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDL-----SLI  649

Query  257   YSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGR  316
                KG KG PGA G +G  G KG  G+PG PG  G  G KG KG+ G  G  G  G+ GR
Sbjct  650   EPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGR  709

Query  317   PGDAGVKGD--KGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEP  374
              G  G+ G   KG PG  GRDG+ G+ GS G  G  G PG      D        +K EP
Sbjct  710   DGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCAL--DEIKMPAKGNKGEP  767

Query  375   GVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKG-ISIPGEAGVD  433
             G TG  GP G  G PGE GY G      L+G TG  GPPG+ GP G  G     G  G  
Sbjct  768   GQTGMPGPPGEDGSPGERGYTG------LKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAV  821

Query  434   GTPGPPGQPGVYGPPGIPGLPGPKGQQGVTI---IGPPGQDGVPGQDGFKGVQGDRGDPG  490
             G PG PG+ G+ G PG  G PGP+G+ G++    +GPPG           G+QG++GD G
Sbjct  822   GVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPG---------LNGLQGEKGDRG  872

Query  491   VQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRP  550
               GP G PG            GS G+PG  GD G PG+ GRPG+ G KG+          
Sbjct  873   PTGPIGFPGA----------DGSVGYPGDRGDAGLPGVSGRPGIVGEKGD---------V  913

Query  551   GVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPP  610
             G  G AG A   G+PG  G  GR G KG  G  G +G PGNKG  G  G  G +G  G  
Sbjct  914   GPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVT  973

Query  611   GAPGKLAPLSRVDIARAVGDQGLQGMKG---------------YPGSEGLPGLVGPPGAK  655
             GAPGK  P     ++ A GD+G  G+ G                 G +G  GL G PG +
Sbjct  974   GAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQ  1033

Query  656   GFPGQPGRKGEKGPYGAPGDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEP  715
             G  G PG   EKG  G PG +G  GLPG     G KG+P       LRGD G  G PG P
Sbjct  1034  GLDGMPG---EKGNQGFPGLDGPPGLPGDASEKGQKGEPGP---SGLRGDTGPAGTPGWP  1087

Query  716   GTPGDMGLKGEAGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIG  775
             G                       EKG PG           G  G PG+KG  G SG  G
Sbjct  1088  G-----------------------EKGLPGLA-------VHGRAGPPGEKGDQGRSGIDG  1117

Query  776   EPGISLQGPTGFKGRPGRPGDWGPKGAQGATGIQGLPGLPGQS------------GGKGD  823
               GI+     G KG  G  G WG  G +G+ G  G+PG PG              G  GD
Sbjct  1118  RDGIN-----GEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGD  1172

Query  824   RGSVGESIFFPGPPGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETG  883
             RG  GE       PG  G PG KGE G  G  G+ G PGP G +G+ G  GLP       
Sbjct  1173  RGDKGE-------PGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPAT-----  1220

Query  884   LPGLKGEEGDM----LPGYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRG  939
             +P ++G++G        G  G  G  G+ G  G+ G KG  GL G PG  G  G  G++G
Sbjct  1221  VPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKG  1280

Query  940   PLGPRGQQGDPG-----PDGIPGRPGRVLHPGATGIPGDKGDIGPPGSTGFVGKPGLQGL  994
              +GPRG+ G PG       G+PGRPGR    G  G PG  G+ G PG     G+PGL GL
Sbjct  1281  DIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPG---LAGEPGLVGL  1337

Query  995   PG------NKGEQGRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGE  1048
             PG      +KGE+G  G+PG  GQ G PGA G+ GD G  G+ GE G + F G +GDKG+
Sbjct  1338  PGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGD  1397

Query  1049  PGQTGPMGYPGL---------PGIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRP  1099
              G  GP G PGL         PG+ G  GP+G  GE      G+ G  GRDG +G PG P
Sbjct  1398  RGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGER-----GFTGPKGRDGRDGTPGLP  1452

Query  1100  GNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGLNGTHGWPGEPGPRGPPGVKGEPGMD  1159
             G KG  G L   GPKG  G+PG  G  G  G PG  G  G  GE G +G  G+ GE G  
Sbjct  1453  GQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNV  1512

Query  1160  GDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIGLPENI-IVATKGDFGE  1211
             G PG  G+ G PG+RG  G  GL G  G  G P    L     I+ T+    E
Sbjct  1513  GRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSE  1565


 Score = 365 bits (938),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 527/1336 (39%), Positives = 626/1336 (47%), Gaps = 249/1336 (19%)

Query  373   EPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGI-SIPGEAG  431
             E G  G  GP+GP G  GE G+ G  GP G +G+ G+PGP G  G  G +G   + G+AG
Sbjct  87    EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAG  146

Query  432   VDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGV  491
             V         PGV GP G PG PG  G+ G       GQDG+PG +G  G+ G RG  G 
Sbjct  147   V---------PGVQGPAGNPGAPGINGKDGCD-----GQDGIPGLEGLSGMPGPRGYAGQ  192

Query  492   QGPKGIPGQ-----GKPIRGPPGEPGSPGFPGLEGDVGFPGLPGR---------------  531
              G KG  G+     G   +G  GEPG  G  GL G  GFPG  G                
Sbjct  193   LGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGE  252

Query  532   PGLKGPKGNDC-GFCPPGRPGVKGEAGEAA-------INGIPGDPGAPGRMGEKGSRGPD  583
              GLKG KG  C G   PG PG+KGE GE A        + + G  G  G+ GE G  G  
Sbjct  253   HGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRK  312

Query  584   GKMGPPGNKGLDGKHGTQGIEGPPGPPGAPGKLAPLSRVDIARAVGDQGLQGMKGYPGSE  643
             G+ GP G+ GLDG+ G +G+ G PG                     D+G QG  G PGS 
Sbjct  313   GEPGPEGDTGLDGQKGEKGLPGGPG---------------------DRGRQGNFGPPGST  351

Query  644   GLPGLVGPPGAKGFPGQPGRKGEKGPYGAP------------------------------  673
             G  G  G PG  G PG PG+KGE G  GA                               
Sbjct  352   GQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGY  411

Query  674   -GDEGRDGLPGRNGVPGSKGDPATIPKEYLRGDAGYDGLPGEPGTPGDMGLKGEAGDTIS  732
              G  G  GL G +G+PG +G           G  G  GLPG PG  G  G KGE G   +
Sbjct  412   VGAPGPQGLNGVDGLPGPQG---------YNGQKGGAGLPGRPGNEGPPGKKGEKG---T  459

Query  733   SEVNM-KGEKGYPGXXXXXXAPGFEGEPGIPGD--KGIPGDSGPIGEPGIS-LQGPTGFK  788
             + +N  KG  G  G        G +G+ G+PG   +G  GD+G  G PG+   +G  GFK
Sbjct  460   AGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFK  519

Query  789   GRPGRPGDW--------GPKGAQGATGIQGLPGLPGQSGGKGDRGSVG--ESIFFPGPPG  838
             G  G PGD         G  GA G  G  G PG PGQ G  G +G VG   S    GP G
Sbjct  520   GNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKG  579

Query  839   ---TPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGE---TGLPGLKGEEG  892
                T G PG  G+ G  GP G RG PG  G  G+ G  G PG  GE   TGLPG  GE G
Sbjct  580   DKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPG  639

Query  893   -------DMLPGYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRG  945
                     ++    G  G PG PG KG+ G KG+ GL G PGP G+ G KG +G  G  G
Sbjct  640   KPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPG  699

Query  946   QQGDPGP---DGIPGRPGRVL--HPGATGIPGDKGDIGPPGSTGFVGKPGLQGL------  994
               G PG    DG PG PG+ +   PG  G  G KGD G  G +G  G+PG   L      
Sbjct  700   NDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMP  759

Query  995   -PGNKGEQGRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTG  1053
               GNKGE G+ G PGP G+ G PG +G  G  G+ G  G  G     GL G +GE G  G
Sbjct  760   AKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQG  819

Query  1054  PMGYPG---------LPGIPGEPGPLGDLGES----------------------------  1076
              +G PG         +PG  G+PGP G+ G S                            
Sbjct  820   AVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGF  879

Query  1077  --IDGEPGYPGSNGRDGFNGLPGRPGNKGSMGALGEVGPKGFQGEPGPKGYAGLAGLPGL  1134
                DG  GYPG  G  G  G+ GRPG  G  G +G +GP G  G   P G  G+ G+ G 
Sbjct  880   PGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAG---PPGVPGIDGVRGR  936

Query  1135  NGTHGWPGEPGPRGPPGVKGE---PGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGE  1191
             +G  G PG PG  G PG KG+   PG DG  G +G  G PG RGP G PG+SGA G KG 
Sbjct  937   DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGA  996

Query  1192  PGDIG----------LPENIIVATKGD---FGEPGMTGLTGEKGWRGDVGWPGRNGTKGL  1238
              G  G               ++  KGD    G PG  GL G  G +G+ G+PG +G  GL
Sbjct  997   TGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGL  1056

Query  1239  PGAI---GPQGEPGFPGYQGPKGPVGMRGPPGIPGLTDVMLA-------ERGDPGRDGLP  1288
             PG     G +GEPG  G +G  GP G  G PG  GL  + +        E+GD GR G+ 
Sbjct  1057  PGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGID  1116

Query  1289  GRDG------KPGLPGVKGAPGEYGIDGPPGPPGAPGLSRKGNPGKP----GYPG-RIVE  1337
             GRDG      + GL GV G PGE G  G PG PGAPG+             GYPG R  +
Sbjct  1117  GRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDK  1176

Query  1338  GLPGLPGLPGEDGKPGTPGVRGEPGEPG-RPIPGPRGQPGLIG----IAGTNGAKGETGP  1392
             G PGL GLPG  G+ G  G++G  G PG +   G RGQPGL      I G  G++GE   
Sbjct  1177  GEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGE---  1233

Query  1393  PGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQWTRGRAGE  1452
                    GY G  G +G+RG    TG  G+ G  G++G QG PG   A  L    G  G+
Sbjct  1234  ------RGYTGEKGEQGERGL---TGPAGVAGAKGDRGLQGPPG---ASGLNGIPGAKGD  1281

Query  1453  IGPRGGEGLPGIDGLPGGKGLKGYPGD---VGLRGNPGPQGSLGQPGDAGPDGRPGSPGP  1509
             IGPRG  G PG+  + G KGL G PG     GL G PG  G  G PG AG  G  G PGP
Sbjct  1282  IGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGP  1340

Query  1510  VGFQGIPGAPGLPAPP  1525
             +G  G  G  GL   P
Sbjct  1341  IGPAGSKGERGLAGSP  1356


 Score = 323 bits (827),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 467/1188 (39%), Positives = 546/1188 (46%), Gaps = 219/1188 (18%)

Query  505   RGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGI  564
             +G  G PG  G  GL+G++GFPG+ G  G KG KG+      PG  G +G+ GE    G+
Sbjct  88    KGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGD------PGPYGQRGDKGERGSPGL  141

Query  565   PGDPGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPPGAPGKLAPL-SRVD  623
              G  G PG  G  G+ G  G  G  G  G DG  G +G+ G PGP G  G+L     + +
Sbjct  142   HGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGE  201

Query  624   IARAVGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRKGEKGPYGAPGDEGRDGL--  681
              A+  GD   +G KG PG  G  GL GP   +GFPG+ G +G+ GPYGA G  G  GL  
Sbjct  202   PAKENGDY-AKGEKGEPGWRGTAGLAGP---QGFPGEKGERGDSGPYGAKGPRGEHGLKG  257

Query  682   -----------PGRNGVPGSKGDPATI----PKEYLRGDAGYDGLPGEPGTPGDMGLKGE  726
                        PG  G+ G KG+PA+     P   + G  G  G  GEPG  G  G  G 
Sbjct  258   EKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGP  317

Query  727   AGDTISSEVNMKGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGEPGIS-LQGPT  785
              GDT       KGEKG PG       PG  G  G  G  G  G  G  GEPG++ L G  
Sbjct  318   EGDTGLD--GQKGEKGLPG------GPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNP  369

Query  786   GFKGRPGRPGDWGPK----------------------------GAQGATGIQGLPGLPGQ  817
             G KG PGR G  G                              GA G  G+ G+ GLPG 
Sbjct  370   GQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGP  429

Query  818   SGGKGDRGSVGESIFFPGPPGTPGRPGSKGEPG---------------------------  850
              G  G +G  G     PG PG  G PG KGE G                           
Sbjct  430   QGYNGQKGGAG----LPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKG  485

Query  851   DEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEGDMLPGYPGTPGVPGMPGL  910
             D G  GY GI G  G  G+ G  GL G  GE G  G  G  GD   G PGTPG  G PG 
Sbjct  486   DAGLPGY-GIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQ  544

Query  911   KGITGDKGSTGLDGTPGPDGDRGKKGSRGPLGPRGQQGDPGPDGIPGR------PGRVLH  964
             KG  G  G+ G  G  G  GD G K S    GP+G +G  G  GIPG+      PG   +
Sbjct  545   KGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGY  604

Query  965   PGATGIPGDKGDIGPPGSTGFVGKPGLQGLPGN---------------KGEQGRRGTPGP  1009
             PG  G  G  G  GPPG  G  G+ GL G  G                KG++G  G PG 
Sbjct  605   PGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGA  664

Query  1010  VGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQGDKGEPGQTGPMGYPGLPGIPGEPGP  1069
              G  G  GA+G+ G  G  G  G  GE   SG  G+ G PG+ G  GYPG+PG       
Sbjct  665   KGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPG-------  717

Query  1070  LGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKGSMG--ALGEVG--PKGFQGEPGPKGY  1125
                  +SI GEPG+ G +G  G  G  GR G KG  G  AL E+    KG +GEPG  G 
Sbjct  718   -----QSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGM  772

Query  1126  AG---LAGLPGLNGTHGWPGEPGPRGPPGVKGEPGMDGDPGLSGN------PGIPGDRGP  1176
              G     G PG  G  G  G  GP+GPPGV+G  G++G  G  GN      PG PG  G 
Sbjct  773   PGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGL  832

Query  1177  RGGPGLSGAPGPKGEPGDIGLPENIIVATKGDFGEPGMTGLTGEKGWRG-----------  1225
             RG PG +G PGP+GEPG         ++  G  G PG+ GL GEKG RG           
Sbjct  833   RGIPGRNGQPGPRGEPG---------ISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGAD  883

Query  1226  -DVGWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPVGMRGPPGIPGLTDV-----MLAER  1279
               VG+PG  G  GLPG  G  G  G  G  GP GP G+ GPPG+PG+  V        E 
Sbjct  884   GSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEP  943

Query  1280  GDPGRDGLPGRDGKPGLPGVKGAPGEYGIDGPPG---PPGAPGLS-RKGNPGKPGYPGR-  1334
             G PG  G+PG  G  G PG  G  G  G+ G PG   P G PG+S  KG+ G  G  G  
Sbjct  944   GSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGND  1003

Query  1335  ---------IVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRP-IPGPRGQPGLIGIAGTN  1384
                         GL G+ G  G  G PG  G+ G PGE G    PG  G PGL G A   
Sbjct  1004  GPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEK  1063

Query  1385  GAKGETGPPG---DTGVEGYPGTPGAKG--------------DRGFIGDTGLPGMDGTPG  1427
             G KGE GP G   DTG  G PG PG KG              ++G  G +G+ G DG  G
Sbjct  1064  GQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGING  1123

Query  1428  EKGFQGEPGDTLAYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLK------GYPGDVG  1481
             EKG QG         LQ   G+ GE G  G  G+PG  G+ G  G        GYPGD G
Sbjct  1124  EKGEQG---------LQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRG  1174

Query  1482  LRGNPGPQGSLGQPGDAGP---DGRPGSPGPVGFQGIPGAPGLPAPPP  1526
              +G PG  G  G  G+ GP    G  G+PGP G +GI G PGLPA  P
Sbjct  1175  DKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVP  1222


 Score = 279 bits (713),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 364/964 (38%), Positives = 466/964 (48%), Gaps = 143/964 (15%)

Query  38    TCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKG  97
              C+   I  L G+KG  G  GA+G  G  G +G PG PG +G   E+G  GEKG+ G  G
Sbjct  643   LCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKG---EFGFKGEKGLSGAPG  699

Query  98    FQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADG------  151
               G  GRAG  GYPG PG    KG  G +G DGA G  G  G SG++GE G+        
Sbjct  700   NDGTPGRAGRDGYPGIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKM  758

Query  152   -QRGLRGDPGEGGI----NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPR  206
               +G +G+PG+ G+       G+ GE G  G+ G  GP+GP G  GP G  GP GE+G +
Sbjct  759   PAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQ  818

Query  207   GQIGFPG------------------PRGDPGAEN---VGPTGVRGEDGDVGEPGPPGPII  245
             G +G PG                  PRG+PG      +GP G+ G  G+ G+ GP GPI 
Sbjct  819   GAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPI-  877

Query  246   EDTEQKPGNISY-SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGR  304
                    G++ Y   +G  G+PG  G  G  G KG+ G  G  G+ G PG+ G+ GV+GR
Sbjct  878   -GFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGR  936

Query  305   EGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGI  364
             +G +G+ G  G  G  G KGD+GAPG  G  G  G  G+ G  G  G+PG+ G +GD+G 
Sbjct  937   DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGA  996

Query  365   YDPTLDKIEPG---------VTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGI  415
                T +    G         + G +G  G  G PG+ G +G PG  G QG  G  GPPG+
Sbjct  997   TGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGL  1056

Query  416   VGPIGPKGISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTI---IGPPGQDG  472
              G           E G  G PGP G  G  GP G PG PG KG  G+ +    GPPG+ G
Sbjct  1057  PGDAS--------EKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKG  1108

Query  473   VPGQ---DGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPG--------------  515
               G+   DG  G+ G++G+ G+QG  G PG+ K   G PG PG+PG              
Sbjct  1109  DQGRSGIDGRDGINGEKGEQGLQGVWGQPGE-KGSVGAPGIPGAPGMDGLPGAAGAPGAV  1167

Query  516   -FPGLEGDVGFPGLPGRPGLKGPKG--NDCGFC----PPGRPGVKGEAGE-AAINGIPGD  567
              +PG  GD G PGL G PGLKG  G     GF     P G  G++G+ G  A +  I GD
Sbjct  1168  GYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGD  1227

Query  568   PGAPGRMGEKGSRGPDGKMGPPGNKGLDGKHGTQGIEGPPGPPGAPGKLAPLSRVDIARA  627
              G+ G  G  G +G  G+ G  G  G+ G  G +G++GPPG  G  G         I  A
Sbjct  1228  KGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNG---------IPGA  1278

Query  628   VGDQGLQGMKGYPGSEGLPGLVGPPGAKGFPGQPGRKGEKGPYGAPGDEGRDGLPGRNGV  687
              GD G +G  GYPG       V   G KG PG+PGR G +G  GAPG  G  GLPG  G 
Sbjct  1279  KGDIGPRGEIGYPG-------VTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGE  1331

Query  688   PGSKGDPATIPKEYLRGDAGY---------DGLPGEPGTPGDMGLKGEAGDT-ISSEVNM  737
             PG  G P  I     +G+ G          DG PG PG  GD G +G  G+  ++     
Sbjct  1332  PGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQ  1391

Query  738   KGEKGYPGXXXXXXAPGFEGEPGIPGDKGIPGDSGPIGEPGIS-LQGPTGFKGRPGRPG-  795
             KG+KG  G       PG  G+ G  G  G+ G+ GP+G PG     GP G  GR G PG 
Sbjct  1392  KGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGL  1451

Query  796   -----------------------DWGPKGAQGATGIQGLPGLPGQSGGKGDRGSVGESIF  832
                                      GPKG  G  G +GL G+ G+ G KG+RG +GE+  
Sbjct  1452  PGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGET--  1509

Query  833   FPGPPGTPGRPGSKGEPGDEGPVGYRGIPGPDGRKGVAGPKGLPGLTGETGLPGLKGEEG  892
                  G  GRPG KG+ G+ G  GY G  G  G+KG  G      L   TG+   +  + 
Sbjct  1510  -----GNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQS  1564

Query  893   DMLP  896
             + +P
Sbjct  1565  ETVP  1568


 Score = 230 bits (587),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 315/791 (40%), Positives = 385/791 (49%), Gaps = 105/791 (13%)

Query  821   KGDRGSVGESIFFPGPPGTPGRPGSKGEPGDEGPVG---YRGIPGPDGRKGVAGPKGLPG  877
             KG+RG        PGP G  G  G  G PG EGP G    +G PGP G++G  G +G PG
Sbjct  88    KGNRG-------LPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPG  140

Query  878   LTGETGLPGLKGEEGDMLPGYPGTPGVPGMPGLKGITGDKGSTGLDGTPGPDGDRGKKGS  937
             L G+ G+PG++G  G+     PG PG+ G  G  G  G  G  GL G PGP G  G+ GS
Sbjct  141   LHGQAGVPGVQGPAGN-----PGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGS  195

Query  938   RGPLG-PRGQQGD--PGPDGIPGRPGRVLHPGATGIPGDKGDIGPPGSTGFVGKPGLQGL  994
             +G  G P  + GD   G  G PG  G     G  G PG+KG+ G  G  G  G  G  GL
Sbjct  196   KGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGL  255

Query  995   PGNKGEQG----RRGTPGPVGQMGPPGA-------KGVIGDYGDAGYPGEDGESAFSGLQ  1043
              G KG       + G PG  G+ G P +         V+G  GD G  GE G     G  
Sbjct  256   KGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEP  315

Query  1044  GDKGEPGQTGPMGYPGLPGIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKG  1103
             G +G+ G  G  G  GLPG PG+ G  G+ G    G  G  G  G  G NGLPG PG KG
Sbjct  316   GPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPP--GSTGQKGDRGEPGLNGLPGNPGQKG  373

Query  1104  SMGALGEVGPKG-------------------------FQGEPGPKGYAGLAGLPGLNGTH  1138
               G  G  G  G                         + G PGP+G  G+ GLPG  G +
Sbjct  374   EPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYN  433

Query  1139  G------WPGEPGPRGPPGVKGEPGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEP  1192
             G       PG PG  GPPG KGE          G  G+ G +G  G  G  G PGP+G+ 
Sbjct  434   GQKGGAGLPGRPGNEGPPGKKGE---------KGTAGLNGPKGSIGPIGHPGPPGPEGQK  484

Query  1193  GDIGLPENIIVATKGDFG---EPGMTGLTGEKGWRGDVGWPG-----RNGTKGLPGAIGP  1244
             GD GLP   I  +KGD G    PG+ G  GE+G++G+ G PG     R GT G  GA G 
Sbjct  485   GDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQ  544

Query  1245  QGEPGFPGYQGPKGPVGMRGPPGIPGLTDVMLAERGDPGRDGLPG---RDGKPGLPGVKG  1301
             +G+ G PG  G KG +G++G  G    +      +GD G  GLPG   +DG  G PG +G
Sbjct  545   KGDAGRPGTPGQKGDMGIKGDVGGK-CSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERG  603

Query  1302  APGEYG---IDGPPGPPGAPGLS-RKGNPGKPGYPGR-------IVEGLPGLPGLPGEDG  1350
              PGE G   I+G  GPPG  G   R G PG  G PG+       ++E L G  G PG  G
Sbjct  604   YPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPG  663

Query  1351  KPGTPGVRGEPGEPGRPIPGPRGQPGLIGIAGTNGAKGETGPPGDTGVEGYPGTPGA--K  1408
               G  G +G  G PG  IPGP+G+ G  G  G +GA G  G PG  G +GYPG PG   K
Sbjct  664   AKGVQGFKGAEGLPG--IPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIK  721

Query  1409  GDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQW-TRGRAGEIGPRGGEGLPGIDGL  1467
             G+ GF G  G  G  G+ G  G +GEPG      ++   +G  GE G  G  G PG DG 
Sbjct  722   GEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGS  781

Query  1468  PGGKGLKGYPGDVGLRGNPGPQGSLG------QPGDAGPDGRPGSPGPVGFQGIPGAPGL  1521
             PG +G  G  G+ G +G PG +G  G      + G+ G  G PG+PG  G +GIPG  G 
Sbjct  782   PGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQ  841

Query  1522  PAPPPPPPPSR  1532
             P P   P  SR
Sbjct  842   PGPRGEPGISR  852


 Score = 153 bits (386),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 241/645 (37%), Positives = 290/645 (45%), Gaps = 148/645 (23%)

Query  985   FVGKPGLQGLPGNKGEQGRRGTPGPVGQMGPPGAKGVIGDYGDAGYPGEDGESAFSGLQG  1044
              + + G +GLPG  G  G +G  G  G  GP G KG  GD G  G  G+ GE    GL G
Sbjct  84    CIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHG  143

Query  1045  DKGEPGQTGPMGYPGLPGIPGEPGPLGDLGESIDGEPGYPGSNGRDGFNGLPGRPGNKGS  1104
               G PG  GP G PG PGI G+ G         DG+ G PG    +G +G+PG  G  G 
Sbjct  144   QAGVPGVQGPAGNPGAPGINGKDG--------CDGQDGIPG---LEGLSGMPGPRGYAGQ  192

Query  1105  MGALGEVG---------PKGFQGEPGPKGYAGLAGLPGLNGTHGWPGEPGPRGPPGVKGE  1155
             +G+ GE G          KG +GEPG +G AGLAG  G  G  G  G+ GP G  G +GE
Sbjct  193   LGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGE  252

Query  1156  PGMDGDPGLSGNPGIPGDRGPRGGPGLSGAPGPKGEPGDIGL-----PENIIVATKGDFG  1210
              G+ G+ G S             GP   GAPG KGE G+        P + ++  +GD G
Sbjct  253   HGLKGEKGASCY-----------GPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMG  301

Query  1211  ---EPGMTGLTGEKGWRGDVGWPGRNGTKGLPGAIGPQGEPGFPGYQGPKGPVGMRGPPG  1267
                EPG+ G  GE G  GD G  G+ G KGLPG  G +G  G  G  G  G  G RG PG
Sbjct  302   QKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPG  361

Query  1268  IPGLTDVMLAERGDPGRDGLPGRDGKPGLPG-------------------------VKGA  1302
             + GL        G+PG+ G PGR G  G PG                           GA
Sbjct  362   LNGLP-------GNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGA  414

Query  1303  PGEYGIDGPPGPPGAPGLSRKGNPGKPGYPGRIVEGLPGLPGLPGEDGKPGTPGV-----  1357
             PG  G++G  G PG  G +  G  G  G PGR     PG  G PG+ G+ GT G+     
Sbjct  415   PGPQGLNGVDGLPGPQGYN--GQKGGAGLPGR-----PGNEGPPGKKGEKGTAGLNGPKG  467

Query  1358  ----------------RGEPGEPGRPIPGPRGQ------PGLIGIAGTNGAKGETGPPGD  1395
                             +G+ G PG  I G +G       PGL G  G  G KG  G PGD
Sbjct  468   SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGD  527

Query  1396  TGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTLAYNLQWTRGRAGEIGP  1455
             + + G PGTPGA G  G  GD G PG   TPG+KG  G  GD      + +  RAG  G 
Sbjct  528   SKL-GRPGTPGAAGAPGQKGDAGRPG---TPGQKGDMGIKGDVGG---KCSSCRAGPKGD  580

Query  1456  RGGEGLPGIDGLPGGKG---LKGYPGDVGLRGNPGPQGSLGQPGDAGPDGRPGSPGPVG-  1511
             +G  GLPGI G  G +G    +GYPG+   RG+ G  G  G PG+ G DGR G PG  G 
Sbjct  581   KGTSGLPGIPGKDGARGPPGERGYPGE---RGHDGINGQTGPPGEKGEDGRTGLPGATGE  637

Query  1512  --------------------------F---QGIPGAPGLPAPPPP  1527
                                           QG  GA GLP  P P
Sbjct  638   PGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGP  682


 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 98/210 (47%), Gaps = 25/210 (12%)

Query  1320  LSRKGNPGKPGYPGRIVEGLPGLPGLPGEDGKPGTPGVRGEPGEPGRPIPGPRGQPGLIG  1379
             ++ KGN G PG  G    GL G  G PG +G  G  G +G+PG        P GQ G  G
Sbjct  85    IAEKGNRGLPGPLGPT--GLKGEMGFPGMEGPSGDKGQKGDPG--------PYGQRGDKG  134

Query  1380  IAGTNGAKGETGPPGDTGVEGYPGTPGAKGDRGFIGDTGLPGMDGTPGEKGFQGEPGDTL  1439
               G+ G  G+ G PG  G  G PG PG  G  G  G  G+PG++G        G PG   
Sbjct  135   ERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEG------LSGMPG---  185

Query  1440  AYNLQWTRGRAGEIGPRGGEGLPGIDGLPGGKGLKGYPGDVGLRGNPGPQGSLGQPGDAG  1499
                    RG AG++G +G +G P  +     KG KG PG  G  G  GPQG  G+ G+ G
Sbjct  186   ------PRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERG  239

Query  1500  PDGRPGSPGPVGFQGIPGAPGLPAPPPPPP  1529
               G  G+ GP G  G+ G  G     P  P
Sbjct  240   DSGPYGAKGPRGEHGLKGEKGASCYGPMKP  269



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01580.1.1 Collagen

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CO4A1_CAEEL  unnamed protein product                                  280     4e-81
Q9VMV5_DROME  unnamed protein product                                 253     3e-72
O18407_DROME  unnamed protein product                                 250     4e-71


>CO4A1_CAEEL unnamed protein product
Length=1759

 Score = 280 bits (715),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 267/605 (44%), Positives = 317/605 (52%), Gaps = 50/605 (8%)

Query  10   IFYVFILIFSVC---FQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDT  66
            +    +L+ S C     +   + C GCA    C C G  G  G  G  G  G  G PG  
Sbjct  9    LTAAVVLLSSFCQDRIHVDAAAACKGCAP--PCVCPGTKGERGNPGFGGEPGHPGAPGQD  66

Query  67   GPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCN  126
            GP+G PG PG  G  G++G+ G KG RGD+G  G  G  GLQG  G PG  G +G+ GCN
Sbjct  67   GPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCN  126

Query  127  GTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINS---KGTKGESGVYGIPGLQG  183
            GTDG PG+ G+ G  G+ G+ G  G+ GL G PGEGG+NS   KG KGESG  G+PGL G
Sbjct  127  GTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPG  186

Query  184  PRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDV--------  235
                    G PG +G  G+ GP G  GFPG  G  G   V  +GV+GE G          
Sbjct  187  ------NSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQ  240

Query  236  --GEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYP  293
                P    PI  +  Q P        GP G+ G +G  GP G  G  G+ G PG   YP
Sbjct  241  PGSYPWASKPIEMEVLQGP-------VGPAGVKGEKGRDGPVGPPGMLGLDGPPG---YP  290

Query  294  GIKGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLP  353
            G+KG KG  G  G RGK GKDG PG+ G KG +G  GL G   +PG PG+KG  G PG P
Sbjct  291  GLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGG---TPGYPGTKGGAGEPGYP  347

Query  354  GLQGPEGDRGIYDPTLDKI-EPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGP  412
            G  G EGD G   P  +   E G  G QG  G +G  G  G++G PGP G +G  G PG 
Sbjct  348  GRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGA  407

Query  413  PGIVGPIGPKGISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDG  472
            PG  G  G  G +  G+ G DG PG  G+PG+ G PG  G PG  G  G  I GPPG DG
Sbjct  408  PGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDG  467

Query  473  VPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRP  532
              G+DGF G+ GD GDPG  G KG PG G    GPPG  G PG PG+ G +G  G PG P
Sbjct  468  QSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPP  527

Query  533  GLKGPKGNDCGFCPPGRPGVKGEAG------------EAAINGIPGDPGAPGRMGEKGSR  580
            G  G +G DCG+CP G PG  G+ G                +G  G PGAPG+ G  GS 
Sbjct  528  GNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSD  587

Query  581  GPDGK  585
            G  G 
Sbjct  588  GLSGS  592


 Score = 173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 245/649 (38%), Positives = 298/649 (46%), Gaps = 112/649 (17%)

Query  29    GCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETG  88
             G  G A  +    +   G+PG KG  G+ G  G PG  G  G PG PG+ G  G  GE G
Sbjct  603   GMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPG  662

Query  89    EKGMRGDKGFQGPKGRAGLQGYPGP--PGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGE  146
               G+ G +G QG  G  GLQG PG   PG PG  G  G  G DG PG+ G  G  G    
Sbjct  663   LAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAP  722

Query  147   FGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPR  206
                  Q  + G PG  G+   G  G+ G  G+PGL GP GP       GY G  GERG  
Sbjct  723   LRIVNQ--VAGQPGVDGM--PGLPGDRGADGLPGLPGPVGPD------GYPGTPGERGMD  772

Query  207   GQIGFPGPRGDPGAE-NVGPTGVRGEDGDVGEPGPPG---------PIIEDTEQKPGNIS  256
             G  GFPG  G+PG     G  G  G DGD GEPG  G            E     PG + 
Sbjct  773   GLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVG  832

Query  257   Y----------------SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKG  300
             Y                 + G  G+PG  G  G  G+ G+ G PG+PG  G  G+ G+ G
Sbjct  833   YPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDG  892

Query  301   VQGREGWRGKEGKDGRPGDA---------------GVKGDKGAPGLAGRDGSPGEPGSKG  345
              +GR+G  G  G+DG PG +               G  GD+G PG  G+DG PG  G  G
Sbjct  893   KKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPG  952

Query  346   DEGLPGLPGLQGPEGDRGI----------YDPTLDKI--------------EPGVTGPQG  381
             ++GL G PGL+G  GD G+              LD +               PG  G  G
Sbjct  953   EDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPG  1012

Query  382   PIGPRGEPGEDGYNGKPGPPGLQGRTGEPGP------------------PGIVGPIGPKG  423
              +G  GEPG  GY G+PG PG     G+PG                   PG+ G  G  G
Sbjct  1013  FVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNG  1072

Query  424   ISIPGEAGVDGTPGPPGQPGV------YGPPGIPGLPGPKGQQGVT-IIGPPGQDGVPGQ  476
              S PG  G+ G PG  G  G+       G PGI G+PG KG+ G+  + G  G DG+PGQ
Sbjct  1073  DSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQ  1132

Query  477   DGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKG  536
              G +G  G+ G PG  G  G PGQ    +G  GE G PG PG  G  G  G  G+PGLKG
Sbjct  1133  PGLEGECGEDGFPGSPGQPGYPGQ----QGREGEKGYPGIPGENGLPGLRGQDGQPGLKG  1188

Query  537   PKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGK  585
               G D      G+PG  G AG+    G  G PGAPG  G+ G++G DG+
Sbjct  1189  ENGLD------GQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQ  1231


 Score = 171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 235/611 (38%), Positives = 294/611 (48%), Gaps = 91/611 (15%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G  G PGE G+ G +GA G PG  G  G  G  GK+G  G  G  G+ G  G  G  G  
Sbjct  859   GTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAP  918

Query  103   GRAGLQGYPGPPG---YPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADG--------  151
             G+ G+ GYPG PG   YPG  G DG  G  G PG  G+ G  G RGE G +G        
Sbjct  919   GQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGEC  978

Query  152   ----QRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRG  207
                  RGL G PG       G  G  G+ G+PG  G  G +GE G PG  G  G+ G  G
Sbjct  979   GEEGSRGLDGVPG-----YPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPG  1033

Query  208   QIGFPGPRGD----------PGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISY  257
              + +PG  GD                G  G+ GE GD G+  P  P +     +PG+  Y
Sbjct  1034  NLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSG---QPGDAGY  1090

Query  258   S----------FKGPKGMPGARGDRGPYGL---KGERGVPGRPGIDGYPGIKGVKGVQGR  304
                        + G  GMPG +G+ G  GL   +G  G+PG+PG++G  G  G  G  G+
Sbjct  1091  DGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQ  1150

Query  305   EGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGI  364
              G+ G++G++G  G  G+ G+ G PGL G+DG   +PG KG+ GL G PG  G  G  G 
Sbjct  1151  PGYPGQQGREGEKGYPGIPGENGLPGLRGQDG---QPGLKGENGLDGQPGYPGSAGQLGT  1207

Query  365   YDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTG------------EPGP  412
                      PG  G  G  G  G+PG  G +G+PG PGL GR G             PG 
Sbjct  1208  PGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGA  1267

Query  413   PG--IVGPIGPKGISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVT-------  463
             PG  I GP        PG+AG DG PG  G PG    PG+ G PG  GQ G+        
Sbjct  1268  PGQDIYGP--------PGQAGQDGYPGLDGLPGA---PGLNGEPGSPGQYGMPGLPGGPG  1316

Query  464   ---IIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLE  520
                + G PG+ G+PG DG +G  G  G PGV G +G+PG    + G  GE G PG PG  
Sbjct  1317  ESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPG----LEGDCGEDGYPGAPGAP  1372

Query  521   GDVGFP---GLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEK  577
             G  G+P   GLPG PG +G  G++     PG+PG+KG  G+    G  G  G PGR G +
Sbjct  1373  GSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGRE  1432

Query  578   GSRGPDGKMDR  588
             G  GP     R
Sbjct  1433  GLPGPMAMAVR  1443


 Score = 167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 247/661 (37%), Positives = 300/661 (45%), Gaps = 127/661 (19%)

Query  41   CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGF--  98
              G VG  G KG +G +G  G PG  G DGPPG PG +G  G+ G+ G++G RG  G   
Sbjct  256  LQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPG  315

Query  99   -QGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGI----------PGTSGKRGEF  147
              G KG  G QG  G PGYPG KG  G  G  G PG  G            G +G  G  
Sbjct  316  NYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQ  375

Query  148  GADGQRGLRGDPGEGG----------INSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ  197
            G DG +G +G PG  G          + + G  G+ G+ G+PG    +G  GE G PG+ 
Sbjct  376  GFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFA  434

Query  198  GPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISY  257
            G  G  G  G  G+PG  G PG +  GP G+ G+ G  G PG PG I        G+  Y
Sbjct  435  GEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDI--------GDPGY  486

Query  258  SFKGPKGMPGARGDR----GPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGK  313
            S  G KG PG   ++    G  GL GE G+PGR G+DGYPG  G  G +G +     +G 
Sbjct  487  S--GEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGV  544

Query  314  DGRPGDAGV---------------KGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGP  358
             G  GD G                 GD G PG  G+ GS G  G  G  GLPG+PG  G 
Sbjct  545  PGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGM  604

Query  359  EGDRG-IYDPTLDKI-EPGVTGPQGPIGPRGEPGED---------------GYNGKPGPP  401
            +G+ G I  P  +    PG+ G  G  G  G PG D               G  G+PG  
Sbjct  605  KGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLA  664

Query  402  GLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQG  461
            G+ G+ G  G  GI G  GP G S PG+      PG PG  G  G  G+PGLPG +G +G
Sbjct  665  GIDGKRGRQGSLGIPGLQGPPGDSFPGQ------PGTPGYKGERGADGLPGLPGAQGPRG  718

Query  462  V--------TIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ-------GKP---  503
            +         + G PG DG+PG  G +G  G  G PG  GP G PG        G P   
Sbjct  719  IPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFP  778

Query  504  -IRGPPG---EPGSPGFPGLEGDVGFPGL--------------------PGRPGLKGPKG  539
             + G PG   + G  GF G++GD G PGL                    PG+ G  GP G
Sbjct  779  GLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNG  838

Query  540  NDCGFCPPG---------RPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMDRLE  590
            +      PG          PG  G  GEA +NG  G PG PG  GE G  G DGK  R  
Sbjct  839  DAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDG  898

Query  591  T  591
            T
Sbjct  899  T  899


 Score = 166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 265/696 (38%), Positives = 315/696 (45%), Gaps = 151/696 (22%)

Query  36    RLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGP---PGPPGKEGIM------GEWGE  86
             R+     G  G+ G  G+ G  GA+G PG  GP GP   PG PG+ G+       G  GE
Sbjct  724   RIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGE  783

Query  87    TGEKGMRGDKGFQGPKGRA---GLQGY-----------------PGPPGYPGPKGL----  122
              G +G +G+ GF G  G     GL GY                 PG  GYPGP G     
Sbjct  784   PGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAA  843

Query  123   -----DGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSK----GTKGES  173
                  DG  G DG PG  G PG +G  G+ GA GQ G RG+ G  GI+ K    GT G  
Sbjct  844   GLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTR  903

Query  174   GVYGIPGLQGPRGPMGERGPPGYQGPYGER---GPRGQIGFPGPRGDPGAEN-VGPTGVR  229
             G  G PG  G  G  G+ G  GY G  G++   G  GQ G+PGP G PG +  VG  G+R
Sbjct  904   GQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLR  963

Query  230   GEDGDVGEP---------------GPPG-PIIEDTEQKPG----NISYSFKGPKGMPGAR  269
             GE GD G P               G PG P    T+  PG    +    F G  G PG  
Sbjct  964   GEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTP  1023

Query  270   GDRGPYGLKGERGVPGRPG---------------IDGYPGIKGVKGVQGREGWRGKEGKD  314
             G RG  G  G    PG+PG                DG PG+ G +G  G + + G  G  
Sbjct  1024  GYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNG-DSYPGNPGLS  1082

Query  315   GRPGDAGVKG------------DKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDR  362
             G+PGDAG  G              G PGL G  G PG PG +G++G+PG PGL+G  G+ 
Sbjct  1083  GQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGED  1142

Query  363   GIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGY------NGKPGPPGLQGRTGEPGPPGIV  416
             G          PG  G +G  G  G PGE+G       +G+PG  G  G  G+PG PG  
Sbjct  1143  GFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSA  1202

Query  417   GPIGPKGIS----IPGEAGVDGTPGPPGQPGV---YGPPGIPGLPGPK------------  457
             G +G  G       PGE G +G  G  GQPG+    G PG PGLPG              
Sbjct  1203  GQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDD  1262

Query  458   ---GQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ--------GKPIRG  506
                G  G  I GPPGQ    GQDG+ G+ G  G PG+ G  G PGQ        G    G
Sbjct  1263  GYPGAPGQDIYGPPGQA---GQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESG  1319

Query  507   PPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKG-----NDCGFC----PPGRPGVKGEAG  557
              PG PG  G PGL+G  G  GLPG PG+ G +G      DCG       PG PG  G  G
Sbjct  1320  LPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPG  1379

Query  558   EAAINGIPGD---------PGAPGRMGEKGSRGPDG  584
             E  + G+PG          PGAPG+ G KG RG DG
Sbjct  1380  ERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDG  1415


 Score = 164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 241/624 (39%), Positives = 290/624 (46%), Gaps = 100/624 (16%)

Query  42    DGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGP  101
             DG  G  GE G  G  G +G PG  G  G PG PG++G  G  G  GE G+ G  G +G 
Sbjct  906   DGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGE  965

Query  102   KGRAGL------------QGYPGPPGYPGPKGLDGCNG---TDGAPGI---AGIPGTSGK  143
              G  GL            +G  G PGYPG  G DG  G    DG PG    AG PGT G 
Sbjct  966   HGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGY  1025

Query  144   RGEFGADGQRGLRGDPGE-GGINSKGTKGESGVYGIPGLQGPRGPMGERGP--PGYQGPY  200
             RG+ G  G     G PG+ G     G  G  G  G+PGL G RG  G+  P  PG  G  
Sbjct  1026  RGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQP  1085

Query  201   GERGPRGQ------------IGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIED-  247
             G+ G  G              G PG +G+ G   +   G +G DG  G+PG  G   ED 
Sbjct  1086  GDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGL--PGRQGNDGIPGQPGLEGECGEDG  1143

Query  248   TEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGW  307
                 PG   Y      G  G  G++G  G+ GE G+PG  G DG PG+KG  G+ G+ G+
Sbjct  1144  FPGSPGQPGY-----PGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGY  1198

Query  308   RGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDP  367
              G  G+ G PGD G  G  G  G  G  G  G+PG +G+ G PG PGL G +G  G   P
Sbjct  1199  PGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGP  1258

Query  368   TLDKIEPGVTGPQGPIGPRGEPGEDGY---NGKPGPPGLQGRTGEPGP------------  412
               D   PG  G Q   GP G+ G+DGY   +G PG PGL G  G PG             
Sbjct  1259  PGDDGYPGAPG-QDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGE  1317

Query  413   ------------PGIVGPIGPKGI-------------SIPGEAGVDGTPGPPGQPGVYGP  447
                         PG+ G  G  G+              + G+ G DG PG PG PG  G 
Sbjct  1318  SGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGY  1377

Query  448   PGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ-------  500
             PG  GLPG  GQQG +  G  G  G PGQ G KG +GD G PG  G  G+PG+       
Sbjct  1378  PGERGLPGVPGQQGRS--GDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLP  1435

Query  501   ---GKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAG  557
                   +R PPG+PG  G+P   G+ G+PGLPG  GL GP G   G+  PG PG  G  G
Sbjct  1436  GPMAMAVRNPPGQPGENGYP---GEKGYPGLPGDNGLSGPPGK-AGY--PGAPGTDGYPG  1489

Query  558   EAAINGIPGDPGAPGRMGEKGSRG  581
                ++G+PG  G  G  G  G  G
Sbjct  1490  PPGLSGMPGHGGDQGFQGAAGRTG  1513


 Score = 164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 243/639 (38%), Positives = 296/639 (46%), Gaps = 118/639 (18%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGE--------TGEKGMRG  94
             G+ G PG+ G  G +G  G+PG       PG PG  G+ GE GE         G  G++G
Sbjct  573   GMPGAPGKPGSAGSDGLSGSPGL------PGIPGYPGMKGEAGEIVGPMENPAGIPGLKG  626

Query  95    DKGFQGPKGRAGLQG------------YPGPPGYPGPKGLDGCNGTDGAPGIAGI-----  137
             D G  G  GR G  G            +PG  G PG  G+DG  G  G+ GI G+     
Sbjct  627   DHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPG  686

Query  138   ------PGTSGKRGEFGADGQRGLRGDPGEGGINS-----KGTKGESGVYGIPGLQGPRG  186
                   PGT G +GE GADG  GL G  G  GI +         G+ GV G+PGL G RG
Sbjct  687   DSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRG  746

Query  187   PMGE------RGPPGYQGPYGERGPRGQIGFPGPRGDPGAE-NVGPTGVRGEDGDVGEPG  239
               G        GP GY G  GERG  G  GFPG  G+PG     G  G  G DGD GEPG
Sbjct  747   ADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPG  806

Query  240   PPG---------PIIEDTEQKPGNISY----------------SFKGPKGMPGARGDRGP  274
               G            E     PG + Y                 + G  G+PG  G  G 
Sbjct  807   LDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGE  866

Query  275   YGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAG-------------  321
              G+ G+ G PG+PG  G  G+ G+ G +GR+G  G  G+DG PG +G             
Sbjct  867   AGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGY  926

Query  322   --VKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGP  379
                 GD+G PG  G+DG PG  G  G++GL G PGL+G  GD G+     +  E G  G 
Sbjct  927   PGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGL  986

Query  380   QGPIGPRGEPGEDGYNGKPGP---PGLQGRTGEPGPPGIVGPIG-PKGISIPGEAGVDGT  435
              G  G  GE G DG  G PG    PG  G  GEPG PG  G  G P  ++ PG+ G  G 
Sbjct  987   DGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGY  1046

Query  436   PGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGD---------R  486
             PGP G PG+ G  G+PGL G +G  G +  G PG  G PG  G+ G+ G           
Sbjct  1047  PGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGIT  1106

Query  487   GDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCP  546
             G PG++G  G+PG    + G  G  G PG PGLEG+ G  G PG PG             
Sbjct  1107  GMPGLKGESGLPG----LPGRQGNDGIPGQPGLEGECGEDGFPGSPGQ------------  1150

Query  547   PGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGK  585
             PG PG +G  GE    GIPG+ G PG  G+ G  G  G+
Sbjct  1151  PGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGE  1189


 Score = 161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 248/660 (38%), Positives = 302/660 (46%), Gaps = 151/660 (23%)

Query  42   DGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGE------------------  83
             G+ GLPG  G  G++GA+G+PG  G  G PG  G +G MG                   
Sbjct  179  SGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPP  238

Query  84   -------W-----------GETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGC  125
                   W           G  G  G++G+KG  GP G  G+ G  GPPGYPG KG  G 
Sbjct  239  GQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGD  298

Query  126  NGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQG--  183
             G  G  G  G  G  G  GE G+ G++GL G PG  G  +KG  GE G  G PG +G  
Sbjct  299  LGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPG--TKGGAGEPGYPGRPGFEGDC  356

Query  184  -PRGPMGERGPPGYQGPYGERGPRGQIGFPGP---RGDPGAENV-GPTGVRGEDGDVGEP  238
             P GP+GE          GE GP G  GF G    +G PG + + GP G RG  G  G P
Sbjct  357  GPEGPLGEG--------TGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAP  408

Query  239  GPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGV  298
            G PG      +  PG   Y+ KG       RG+ G  G  GE G+PG PG  GYPG  G+
Sbjct  409  GQPG-----IDGMPG---YTEKG------DRGEDGYPGFAGEPGLPGEPGDCGYPGEDGL  454

Query  299  KG--VQGREGWRGKEGKDGRPG------DAGVKGDKGAPG----------LAGRDGSPGE  340
             G  +QG  G  G+ G+DG PG      D G  G+KG PG          + G  G PG 
Sbjct  455  PGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGM  514

Query  341  PGSKGDEGLPGLPGLQGPEGDRGIY----------DPTL-----------------DKIE  373
            PG  G +G PG PG  G  G+   Y          DP                   D   
Sbjct  515  PGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGM  574

Query  374  PGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPI-GPKGI-SIPGEAG  431
            PG  G  G  G  G  G  G  G PG PG++G  GE     IVGP+  P GI  + G+ G
Sbjct  575  PGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGE-----IVGPMENPAGIPGLKGDHG  629

Query  432  VDGTPGPPGQ---------------PGVYGPPGIPGLPGPKGQQGVT----IIGPPGQDG  472
            + G PG PG                PG+ G PG+ G+ G +G+QG      + GPPG D 
Sbjct  630  LPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPG-DS  688

Query  473  VPGQDGFKGVQGDRGD------PGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFP  526
             PGQ G  G +G+RG       PG QGP+GIP   + +    G+PG  G PGL GD G  
Sbjct  689  FPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGAD  748

Query  527  GLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKM  586
            GLP   GL GP G D G+  PG PG +G  G     G+ G+PG  G+ GE G  G DG  
Sbjct  749  GLP---GLPGPVGPD-GY--PGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDC  802


 Score = 139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 228/601 (38%), Positives = 274/601 (46%), Gaps = 135/601 (22%)

Query  42    DGIVGLPGEKG------------------VRGIEGAEGNPGDTGPDGPPGPPGKEGIMGE  83
             DG+VG PG +G                   RG++G  G PG+ G DG PG PG +G  G 
Sbjct  954   DGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGF  1013

Query  84    WGETGEKGMRGDKGFQGPKGRAGLQGYPGPPG------------YPGPKGLDGCNGTDGA  131
              GE GE G     G++G  G  G   YPG PG             PG  GL G NG  G 
Sbjct  1014  VGEAGEPGT---PGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGD  1070

Query  132   PGIA--GIPGTSGKRGEFGADGQRGLRGDPGEGGINSK-GTKGESGVYGIPGLQGPRGPM  188
              G +  G PG SG+ G+ G DG  G+ G PG  GI    G KGESG+ G+PG QG  G  
Sbjct  1071  NGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIP  1130

Query  189   GERG---------------PPGYQGPYGERGPRGQIGFPGPRGDPGAE-NVGPTGVRGED  232
             G+ G                PGY G  G  G +G  G PG  G PG     G  G++GE+
Sbjct  1131  GQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGEN  1190

Query  233   GDVGEPGPPGPIIEDTEQKPGNISY-SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDG  291
             G  G+PG PG   +     PG++ Y    G  G  G +G  G  GL+GE G PG+PG+ G
Sbjct  1191  GLDGQPGYPGSAGQ--LGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPG  1248

Query  292   ---------------YPGIKGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDG  336
                            YPG  G    Q   G  G+ G+DG PG   + G  GAPGL G  G
Sbjct  1249  RDGQPGPVGPPGDDGYPGAPG----QDIYGPPGQAGQDGYPG---LDGLPGAPGLNGEPG  1301

Query  337   SPGE---------------PGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQG  381
             SPG+               PG  G+ GLPGL G +G +G  G          PGV G +G
Sbjct  1302  SPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGA---------PGVPGVEG  1352

Query  382   PIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPGQ  441
               G  G+ GEDGY G PG PG  G  GE G PG+ G  G         +G +G PG PGQ
Sbjct  1353  VPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQG--------RSGDNGYPGAPGQ  1404

Query  442   PGVYGP------------------PGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQ  483
             PG+ GP                  PG  GLPGP         G PG++G PG+ G+ G+ 
Sbjct  1405  PGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLP  1464

Query  484   GDRGDPGVQGPKGIPG----QGKP----IRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLK  535
             GD G  G  G  G PG     G P    + G PG  G  GF G  G  G PGLPG PG  
Sbjct  1465  GDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYP  1524

Query  536   G  536
             G
Sbjct  1525  G  1525


 Score = 122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 178/483 (37%), Positives = 209/483 (43%), Gaps = 116/483 (24%)

Query  39    CNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGF  98
             C  DG  G PG+ G  G +G EG  G  G  G  G PG  G  G+ G  GE G+ G  G+
Sbjct  1139  CGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGY  1198

Query  99    QGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGD  158
              G  G+ G  G  G PG PG  G +G  G DG PG+         RGE G  GQ GL G 
Sbjct  1199  PGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGL---------RGESGQPGQPGLPGR  1249

Query  159   ---------------PGEGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGER  203
                            PG  G +  G  G++G  G PGL G  G  G  G PG  G YG  
Sbjct  1250  DGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMP  1309

Query  204   GPRGQI------GFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISY  257
             G  G        G+PG RG PG +     G RG DG  G PG P                
Sbjct  1310  GLPGGPGESGLPGYPGERGLPGLD-----GKRGHDGLPGAPGVP----------------  1348

Query  258   SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRP  317
                G +G+PG  GD    G  G  G PG PG +GYPG +G+ GV G++G  G  G  G P
Sbjct  1349  ---GVEGVPGLEGD---CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAP  1402

Query  318   GDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVT  377
             G  G+KG +G  G  GRDG  G PG  G EGLPG               P    +     
Sbjct  1403  GQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPG---------------PMAMAVR----  1443

Query  378   GPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPG  437
                    P G+PGE+GY G+ G PGL G  G  GPPG  G         PG  G DG P 
Sbjct  1444  ------NPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAG--------YPGAPGTDGYP-  1488

Query  438   PPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGI  497
                     GPPG+ G+PG  G Q                 GF+G  G  G+PG+ G  G 
Sbjct  1489  --------GPPGLSGMPGHGGDQ-----------------GFQGAAGRTGNPGLPGTPGY  1523

Query  498   PGQ  500
             PG 
Sbjct  1524  PGS  1526


 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 137/302 (45%), Gaps = 57/302 (19%)

Query  44    IVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGK------------EGIMGEWGETGEKG  91
             I G PG+ G  G  G +G PG  G +G PG PG+             G+ G  GE     
Sbjct  1272  IYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGE-----  1326

Query  92    MRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADG  151
              RG  G  G +G  GL G PG PG  G  GL+G  G DG PG  G PG++G  GE     
Sbjct  1327  -RGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGE-----  1380

Query  152   QRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIGF  211
                                      G+PG+ G +G  G+ G PG  G  G +GPRG  GF
Sbjct  1381  ------------------------RGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGF  1416

Query  212   PGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGD  271
             PG          G  G+ G  G  G PGP    + +   +PG   Y   G KG PG  GD
Sbjct  1417  PG--------RDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGY--PGEKGYPGLPGD  1466

Query  272   RGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGL  331
              G  G  G+ G PG PG DGYPG  G+ G+ G  G +G +G  GR G+ G+ G  G PG 
Sbjct  1467  NGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGS  1526

Query  332   AG  333
              G
Sbjct  1527  PG  1528


 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 114/311 (37%), Positives = 134/311 (43%), Gaps = 63/311 (20%)

Query  321  GVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQ  380
            G KG++G PG  G  G PG PG  G EG PG PG+ G EGD G                 
Sbjct  43   GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGD----------------  86

Query  381  GPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPG---  437
              +G +G  G+ G  G PG PGLQG  G PG  G  G        IPG  G DG PG   
Sbjct  87   --MGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEG--------IPGCNGTDGFPGMPG  136

Query  438  ---PPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGP  494
               PPGQ G  G PG PGL GP G+ GV   G  G  G  G+ G  G+ G+ G PG++G 
Sbjct  137  LAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGA  196

Query  495  KGIPGQGKPIRGPPGEPGSPGFPGLEGDVGF------------------PGLPGRPGLKG  536
            KG PG       P G PG PG  GL+G +G                         P    
Sbjct  197  KGDPG-------PYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASK  249

Query  537  PKGNDCGFCPPGRPGVKGEAGEAA------INGIPGDPGAPGRMGEKGSRGPDGKMDRLE  590
            P   +    P G  GVKGE G         + G+ G PG PG  G+KG  G  G+  +  
Sbjct  250  PIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRG  309

Query  591  TKDWMGNMEHK  601
                 GN   K
Sbjct  310  KDGVPGNYGEK  320


 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query  468  PGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPG  527
            PG  G  G  GF G  G  G PG  GP+G PG    + G  G+ G  G  G  GD G PG
Sbjct  42   PGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGA-PGMFGAEGDFGDMGSKGARGDRGLPG  100

Query  528  LPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMD  587
             PG PGL+G  G          PG+KGE G    NG  G PG PG  G  G  G +G   
Sbjct  101  SPGHPGLQGLDG---------LPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPG  151

Query  588  R  588
            R
Sbjct  152  R  152


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 253 bits (647),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 271/590 (46%), Positives = 332/590 (56%), Gaps = 18/590 (3%)

Query  4    TRHRY-VIFYVFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGN  62
             RH   ++  V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG 
Sbjct  6    LRHLSGLLGVVYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGP  61

Query  63   PGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGL  122
             GD GP G  GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+
Sbjct  62   AGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGI  121

Query  123  DGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQ  182
            DGC+G  G  G +G PG +G RG  G  GQ+G  G+ GEGGINSKGTKG  G  G PG  
Sbjct  122  DGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGV  181

Query  183  GPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPG  242
            GP G  G+RG  G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG   
Sbjct  182  GPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG---  238

Query  243  PIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQ  302
                D+         + KG KG  G +GD GP G  GE+G  GR G+       G +G  
Sbjct  239  ----DSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEI  288

Query  303  GREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDR  362
            G  G RGK GKDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  
Sbjct  289  GGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPP  348

Query  363  GIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPK  422
            GIYDP+L K  PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP 
Sbjct  349  GIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP  408

Query  423  GISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGV  482
            G S  GEAG  G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G 
Sbjct  409  GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGY  468

Query  483  QGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDC  542
            +GDRG+ G+ G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC
Sbjct  469  RGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDC  528

Query  543  GFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMDRLETK  592
              C  G  G +G+ G+    G  G+ GA G  G +G +G  G   R   K
Sbjct  529  PVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHK  578


 Score = 171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 232/594 (39%), Positives = 282/594 (47%), Gaps = 115/594 (19%)

Query  42    DGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGP  101
             +G+ GLPGEKG+RG         D  P    GP G  G  G+ G  G  G RG  G  GP
Sbjct  512   NGLRGLPGEKGLRG---------DDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGP  562

Query  102   KGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQ--------R  153
             +G  GLQG PG  G+   KGL         PG AGIPG  GK G  G DG+        +
Sbjct  563   RGVQGLQGNPGRAGH---KGL---------PGPAGIPGEPGKVGAAGPDGKAIEVGSLRK  610

Query  154   GLRGDPGEGGIN-SKGTKGESGVYGIPGLQGPRGPMGER---GPPGYQGPYGERGPRGQI  209
             G  GD G+ G     G  GE G  G  G +G RG  G+R   G  GYQG  GE G  G+ 
Sbjct  611   GEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRD  670

Query  210   GFPGPR---------GDPGAENVGPTGVRGEDGDVGEPGPPGP----IIEDTEQKPGNIS  256
             G PG           G+PG + +   G RG+DGD G  G  G      I D   +PG   
Sbjct  671   GAPGRNATTPKVYLIGEPGYDGI--KGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDG  728

Query  257   YSFKGPKGMPGARGDRGPYGLKGERG--------VPGRPGIDGYPGIKGVKGVQGREGWR  308
             Y+  GPKG+ GA+G++G  GL+GE G        +PG  G  GYPG  G  G QG  G  
Sbjct  729   YT--GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLP  786

Query  309   GKEGKDGRPGDAGVKGDKGAPG---LAGRDGSPGEPGSK---GDEGLPGLPGLQGPEGDR  362
             G++G+ G  G  G KG +G PG   + G  G PG  G K   GD G PG  GL G  G +
Sbjct  787   GRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPK  846

Query  363   GIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGY-----------------NGKPGPPGLQG  405
             G+          G  GP G +G  G PG  G                  NG+  P G +G
Sbjct  847   GV---------KGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKG  897

Query  406   RTGEPGPPGIVGPIGPKG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTI  464
             + GE G  G  G  G KG I   G  G+ G  G  G PG    PGIPGLPG        +
Sbjct  898   QKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGS---PGIPGLPG--------M  946

Query  465   IGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVG  524
             IG  G+ G  G +G +G  G RG  G  GPKG+ G      GP G PG+ G PG +G+ G
Sbjct  947   IGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGD----DGPDGYPGANGLPGRKGETG  1002

Query  525   FPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKG  578
              PG PGRPG KG              G+KG+ GE+ + G  G PGAPG  G++G
Sbjct  1003  NPGFPGRPGAKGVAAYS---------GIKGDDGESGLTGPIGYPGAPGAKGQRG  1047


 Score = 165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 244/651 (37%), Positives = 298/651 (46%), Gaps = 135/651 (21%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G  G PG  G  G +GA G PG    DG PG  G  G  G+ G  G++ ++G+    GP 
Sbjct  766   GAKGYPGPTGDYGQQGAPGLPGR---DGEPGLDGGIGYKGQRGVPGQEVIQGEI---GPP  819

Query  103   GRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEF------  147
             GR+G++G+PG           G PGPKG+ G  G DGA G  G+PG  G+RG+F      
Sbjct  820   GRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPG  879

Query  148   --------------GADGQRGLRGDPGEGGIN-SKGTKGESGVYGIPGLQGPRGPMGERG  192
                           GA GQ+G  G  G+ G N +KG+ G SG  G+ G  G +G  G  G
Sbjct  880   PKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPG  939

Query  193   PPGYQGPYGERGPRGQIGFPGPRGDPGAE----NVGPTGVRGEDGDVGEPGPPGPIIEDT  248
              PG  G  GE G RG+IG+ G +GD G        GP G+ G+DG  G PG  G  +   
Sbjct  940   IPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANG--LPGR  997

Query  249   EQKPGNISY----SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKG-----VK  299
             + + GN  +      KG     G +GD G  GL G  G PG PG  G  G  G     + 
Sbjct  998   KGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALD  1057

Query  300   GVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPE  359
             GV GR+G  G  G +G PG  G+KG +G  GL G+ G PGEPG+KG  G PG  G+ G +
Sbjct  1058  GVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLK  1117

Query  360   GDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGK----------------------  397
             G  G          PG  GP+GP G  G  G DG NG+                      
Sbjct  1118  GATGF---------PGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDE  1168

Query  398   ---------------------PGPPGLQGRTGEP---GPPGIVGPIGPKG----ISIPGE  429
                                   G  GLQG  GE    GP G +GP G KG    I   G+
Sbjct  1169  GEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ  1228

Query  430   AGVDGTPGPPGQPGVYGPPGIPG--LPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRG  487
              G DG  G  G  G  GP G PG  LP  KG +GV      G DG  G+ G  G +G  G
Sbjct  1229  LGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA-----GLDGRAGRPGHFGQKGAPG  1283

Query  488   DPGVQGPKGIPGQGKP-IRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCP  546
              PG  GP G  G   P I+GPPG  G  GFPG       PG  GR GL GPKG       
Sbjct  1284  PPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGA------PGHNGRHGLIGPKGE---LGD  1334

Query  547   PGRPGVKGEAGEAAIN--------GIPGDPGAPGRMGEKGSRGPDGKMDRL  589
              GR G +GE+G A +         G  G+PG  G  GE+G  G  GK  R+
Sbjct  1335  MGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRV  1385


 Score = 159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 248/681 (36%), Positives = 310/681 (46%), Gaps = 130/681 (19%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQG  100
               G +G PG  G++G  G  G PG  G  G PGP G +G  G  G  G+ G+ G+KG +G
Sbjct  812   IQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG  871

Query  101   --------PKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQ  152
                     PKG+ G  G   P G  G KG  G  G +G  G  G  G SG+RG  G  G 
Sbjct  872   DFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGL  931

Query  153   RGLRGDPGE----GGINSKGTKGESGVYGIPGLQGPRGPMGERGPPG---------YQGP  199
             +GL G PG     G I   G +GE G  G  G  GPRGP GE GP G         Y G 
Sbjct  932   QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGA  991

Query  200   YGERGPRGQIGFPGPRGDPGAENVGP-TGVRGEDGD------VGEPGPPG----------  242
              G  G +G+ G PG  G PGA+ V   +G++G+DG+      +G PG PG          
Sbjct  992   NGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGD  1051

Query  243   --PIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKG  300
               P ++    + G +     GP G+PG  G +G    +G+RG+PG+ G  G PG KG+ G
Sbjct  1052  SQPALDGVAGRKGEVGSP--GPNGLPGRHGLKG---QRGDRGLPGQQGRPGEPGAKGLGG  1106

Query  301   VQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGL-----------  349
               GR G  G +G  G PG  G KG +G  G+ G DG  G+ G +G  GL           
Sbjct  1107  YPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQG  1166

Query  350   ----PGLPGLQGPEGDRGIY-----DPTL--DKIEPGVTGPQGPIGPRGEPGEDGYNGKP  398
                  G+PG      DR  Y     D  L  ++ E G  GP G IGP G  GE G  G  
Sbjct  1167  DEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYA  1226

Query  399   GPPGLQGRTGEPGPPGIVGPIGPKGISIPGE------AGVDGTPGPPGQPGVYGPPGIPG  452
             G  G  G  G  G  G  GP GP GI++P E      AG+DG  G PG  G  G PG PG
Sbjct  1227  GQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPG  1286

Query  453   LPGPKG---QQGVTIIGPPGQDG------VPGQDGFKGV---QGDRGDPGVQGPKGIPGQ  500
               GP G    +G  I GPPG  G       PG +G  G+   +G+ GD G QG +G  G 
Sbjct  1287  ENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGY  1346

Query  501   GKPIR----GPPGEPGSPGFPGLEGDVGFPGLPGR------PGLKGPKGN---------D  541
                 R    G  G  G PG+ G +G+ G+PGLPG+      PG +GP G+         D
Sbjct  1347  AIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMD  1406

Query  542   CGFCPPGRPGV-----------KGEAGEAAINGIPGDPGAPGRMG---------------  575
                 P G+PGV           +GE G     G  GD GAPG +G               
Sbjct  1407  GLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQG  1466

Query  576   EKGSRGPDGKMDRLETKDWMG  596
             E G  G DG   +   K +MG
Sbjct  1467  EVGYTGADGPQGQRGDKGYMG  1487


 Score = 157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 237/636 (37%), Positives = 298/636 (47%), Gaps = 123/636 (19%)

Query  43    GIVGLPGEKGVRGIEG--------AEGNPG---DTGPDGPPGPPGKEGIMGEWGETGEKG  91
             G +GL GE G RG  G        A+G PG   D G  G PG PG++G  G  G  G KG
Sbjct  743   GAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKG  802

Query  92    MRG------DKGFQGPKGRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAG  136
              RG       +G  GP GR+G++G+PG           G PGPKG+ G  G DGA G  G
Sbjct  803   QRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG  862

Query  137   IPGTSGKRGEF--------------------GADGQRGLRGDPGEGGIN-SKGTKGESGV  175
             +PG  G+RG+F                    GA GQ+G  G  G+ G N +KG+ G SG 
Sbjct  863   LPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGR  922

Query  176   YGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAE----NVGPTGVRGE  231
              G+ G  G +G  G  G PG  G  GE G RG+IG+ G +GD G        GP G+ G+
Sbjct  923   RGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGD  982

Query  232   DGDVGEPGPPGPIIEDTEQKPGNISY----SFKGPKGMPGARGDRGPYGLKGERGVPGRP  287
             DG  G PG  G  +   + + GN  +      KG     G +GD G  GL G  G PG P
Sbjct  983   DGPDGYPGANG--LPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAP  1040

Query  288   GIDGYPGIKG-----VKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPG  342
             G  G  G  G     + GV GR+G  G  G +G PG  G+KG +G  GL G+ G PGEPG
Sbjct  1041  GAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPG  1100

Query  343   SKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPG  402
             +KG  G PG  G+ G +G              G  GPQGP GP+GE G  G +G+     
Sbjct  1101  AKGLGGYPGRNGINGLKG------------ATGFPGPQGPKGPQGESGVVGLDGR-----  1143

Query  403   LQGRTGEPGPPGIVGPIGPKG-------ISIPGE-------------AGVDGTPGPPGQP  442
               G+ G+ GP G++G  G +G       + IPG               G  G  G  G+ 
Sbjct  1144  -NGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQ  1202

Query  443   GVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGK  502
             G  GP G  G PG KG++G   IG  GQ G  G +G KG QGD      QGP+G PG   
Sbjct  1203  GDMGPIGFIGPPGAKGERG--DIGYAGQLGFDGAEGLKGFQGD------QGPRGPPGITL  1254

Query  503   PIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAIN  562
             P      E G  G  GL+G  G PG  G+ G  GP         PG  G  G  G     
Sbjct  1255  PA-----EKGDEGVAGLDGRAGRPGHFGQKGAPGP---------PGENGPNGAIGHRGPQ  1300

Query  563   GIPGDPGAPGRMGEKGSRGPDGKMDRLETKDWMGNM  598
              I G PG  G +G  G+ G +G+   +  K  +G+M
Sbjct  1301  -IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDM  1335


 Score = 151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 219/588 (37%), Positives = 270/588 (46%), Gaps = 80/588 (14%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G+ G+ GE G RG  G  G  GD GP GP G  G +G+ G+ G  G  G  G  G +G  
Sbjct  942   GLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGET  1001

Query  103   GRAGLQGYPGPPG---YPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFG--------ADG  151
             G  G  G PG  G   Y G KG DG +G  G  G  G PG  G+RG  G          G
Sbjct  1002  GNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAG  1061

Query  152   QRGLRGDPGEGGI-NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIG  210
             ++G  G PG  G+    G KG+ G  G+PG QG  G  G +G  GY G  G  G +G  G
Sbjct  1062  RKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATG  1121

Query  211   FPGPRGDPGAE-NVGPTGVRGEDGDVGEPGPPGPI--------------------IEDTE  249
             FPGP+G  G +   G  G+ G +G +G+ GP G I                    +E+  
Sbjct  1122  FPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLR  1181

Query  250   QKPGNISYSFKGPKGMPGARG---DRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREG  306
              +  +    F G +G+ G RG   D GP G  G  G  G  G  GY G  G  G +G +G
Sbjct  1182  DR--SFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKG  1239

Query  307   WRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYD  366
             ++G +G  G PG   +  +KG  G+AG DG  G PG  G +G PG PG  GP G  G   
Sbjct  1240  FQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRG  1298

Query  367   PTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGL---QGRTGEPGPPG--IVGPIGP  421
             P +     G  GPQG +G  G PG +G +G  GP G     GR GE G  G  IVG  G 
Sbjct  1299  PQIQ----GPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGD  1354

Query  422   KG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFK  480
              G I   GE G DG  G  G PG+ G  G  G PGP+G        P G  G  G DG  
Sbjct  1355  IGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRG--------PTGDAGWGGIDGMD  1406

Query  481   GVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGL------EGDVGFPGLPGRPGL  534
             G+ G +G PGV     +             PG  G PGL      EGD G PGL G  G 
Sbjct  1407  GLVGPKGQPGVTYSYSMA-----------RPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQ  1455

Query  535   KGPKGN-----DCGFC-PPGRPGVKGEAGEAAINGIPGDPGAPGRMGE  576
             +G  G      + G+    G  G +G+ G   + G PG  G PG  GE
Sbjct  1456  RGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1503


 Score = 151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 213/579 (37%), Positives = 251/579 (43%), Gaps = 107/579 (18%)

Query  55   GIEGAEGNPGDTGPDGPPGPPGKEGIMGEW---------------GETGEKGMRGD--KG  97
            G+ G  G+PG  G  GPPG   + G  G++               G  G  G+ G+  + 
Sbjct  391  GLAGQSGDPGLNGSRGPPGRS-ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN  449

Query  98   FQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPG----------------IAGIPGTS  141
              GPKG  GL G PG  GY G +G  G  G  G PG                  G+PG  
Sbjct  450  VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDD  509

Query  142  GKRGEFGADGQRGLRGDPG-EGGINSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGPY  200
            G  G  G  G++GLRGD         +G +G+ G  G PG  G RG +G  GP G QG  
Sbjct  510  GYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQ  569

Query  201  GERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISYSFK  260
            G  G  G  G PGP G PG           E G VG  GP G  IE    + G I     
Sbjct  570  GNPGRAGHKGLPGPAGIPG-----------EPGKVGAAGPDGKAIEVGSLRKGEI-----  613

Query  261  GPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDA  320
                     GD G  G +G+ G  G  G DG  G KG          RG+ G+ G  GDA
Sbjct  614  ---------GDTGDSGHRGDTGDDGEKGRDGSDGSKGE---------RGETGQRGDYGDA  655

Query  321  GVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQ  380
            G +G  G PG  GRDG+PG   +     L G PG  G +G+RG    T  K   G   P 
Sbjct  656  GYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPG  715

Query  381  GPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPG  440
                  GEPGEDGY G  G  G +G  G  G  G +G  GP G  IPG  G  G PGP G
Sbjct  716  QIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTG  775

Query  441  QPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQ  500
                YG  G PGL              PG+DG PG DG  G +G RG PG +  +G    
Sbjct  776  D---YGQQGAPGL--------------PGRDGEPGLDGGIGYKGQRGVPGQEVIQGEI--  816

Query  501  GKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGN---DCGFCPPGRPGVKGEAG  557
                 GPPG  G  GFPG  G  G  GL GRPG KG KG    D      G PG KG+ G
Sbjct  817  -----GPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG  871

Query  558  EAAI-----------NGIPGDPGAPGRMGEKGSRGPDGK  585
            +  +           NG     GA G+ GE GS G +G+
Sbjct  872  DFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQ  910


 Score = 147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 220/609 (36%), Positives = 264/609 (43%), Gaps = 133/609 (22%)

Query  50    EKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQG  109
              KG  G  G  G+ GDTG DG  G  G +G  GE GETG++G  GD G+QG  G  G  G
Sbjct  609   RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDG  668

Query  110   YPGPPGY------------PGPKGLDGCNGTDGAPGIAGIPG---------TSGKRGEFG  148
               G PG             PG  G+ G  G DG  G  G+ G          +G+ GE G
Sbjct  669   RDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDG  728

Query  149   ADGQRGLRGDPGEGG-------INSKGTKGES--GVYGIPGLQGPRGPMGERGPPGYQGP  199
               G +G++G  GE G       I  +G  GE   G  G  G  GP G  G++G PG  G 
Sbjct  729   YTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGR  788

Query  200   YGERGPRGQIGFPGPRGDPGAENV-------GPTGVRGEDGDVGEPGP------PGPIIE  246
              GE G  G IG+ G RG PG E +       G +G++G  GDVG PG       PGP   
Sbjct  789   DGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGV  848

Query  247   DTEQKPGNISYSFKGPKGMPGARGDRG--------------------PYGLKGERGVPGR  286
               EQ P        G  G+PG +G RG                    P+G KG++G  G 
Sbjct  849   KGEQGPDGAV----GQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGS  904

Query  287   PGIDGYPGIKGVKGVQGREGWRGKEGKDGRPGDAGV---------KGDKGAPGLAGRDGS  337
              G +G  G KG  G  GR G  G  G  G PG  G+          G++G  G  GR G 
Sbjct  905   LGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD  964

Query  338   PGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGK  397
              G  G  G+ G  GL G  GP                                 DGY   
Sbjct  965   IGPRGPNGEFGPKGLSGDDGP---------------------------------DGY---  988

Query  398   PGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPK  457
             PG  GL GR GE G PG  G  G KG+     A   G  G  G+ G+ GP G PG PG K
Sbjct  989   PGANGLPGRKGETGNPGFPGRPGAKGV-----AAYSGIKGDDGESGLTGPIGYPGAPGAK  1043

Query  458   GQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFP  517
             GQ+G      P  DGV G+ G  G  G  G PG  G KG  G     RG PG+ G PG P
Sbjct  1044  GQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGD----RGLPGQQGRPGEP  1099

Query  518   GLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEK  577
             G +G  G+PG  G  GLKG  G       PG  G KG  GE+ + G+       GR G+ 
Sbjct  1100  GAKGLGGYPGRNGINGLKGATGF------PGPQGPKGPQGESGVVGL------DGRNGQI  1147

Query  578   GSRGPDGKM  586
             G +GP G +
Sbjct  1148  GDQGPRGLI  1156


 Score = 137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 238/665 (36%), Positives = 291/665 (44%), Gaps = 147/665 (22%)

Query  60   EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
             G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190  RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97   GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
              +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250  TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154  GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
            G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310  GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206  -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                             RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370  GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235  ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                       G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430  PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285  GR-------------------PGIDGYPGIKGV---KGVQGRE---------GWRGKEGK  313
            G                    PG DGY G++G+   KG++G +         G RG+EG 
Sbjct  485  GEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314  DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
             G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545  TGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374  PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
             G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605  VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429  EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
            E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663  EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467  PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
             PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723  EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526  PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRMGEKGS  579
            PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+ G  G 
Sbjct  783  PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  580  RGPDG  584
             GP G
Sbjct  843  PGPKG  847


>O18407_DROME unnamed protein product
Length=1761

 Score = 250 bits (638),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 268/580 (46%), Positives = 327/580 (56%), Gaps = 17/580 (3%)

Query  13   VFILIFSVCFQISHQSGCHGCANRLTCNCDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPP  72
            V++L   V   ++    C    N   C+C GI G  G  G  G+ G EG  GD GP G  
Sbjct  16   VYLLGSLVSVTLADGKIC----NTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRA  71

Query  73   GPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAP  132
            GP G++G +GE+GE GEKG RGD G +G  G  G+ G  G PG PGP+G+DGC+G  G  
Sbjct  72   GPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQ  131

Query  133  GIAGIPGTSGKRGEFGADGQRGLRGDPGEGGINSKGTKGESGVYGIPGLQGPRGPMGERG  192
            G +G PG +G RG  G   Q+G  G+ GEGGINSKGTKG  G  G PG  GP G  G+RG
Sbjct  132  GPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRG  191

Query  193  PPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRGEDGDVGEPGPPGPIIEDTEQKP  252
              G  G  G  G +G  G PGP+GD GA +  P  + G  G  GEPG       D+    
Sbjct  192  SKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPG-------DSLSGV  244

Query  253  GNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEG  312
                 + KG KG  G +GD GP G  GE+G  GR G+       G +G  G  G RGK G
Sbjct  245  LKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEIGGPGERGKPG  298

Query  313  KDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKI  372
            KDG PG  G KG KGAPG  G DG  G PG +G++G  G+PG+QG  G  GIYDP+L K 
Sbjct  299  KDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKS  358

Query  373  EPGVTGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGV  432
             PG  G QG IGP GE G  G  GKPG  G  G  G+ G PG+ G  GP G S  GEAG 
Sbjct  359  LPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGD  418

Query  433  DGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPGQDGVPGQDGFKGVQGDRGDPGVQ  492
             G  GPPG  G  G  G+PG  G  G+ G  ++GP G+ G+ GQ G +G +GDRG+ G+ 
Sbjct  419  YGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLP  478

Query  493  GPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPGV  552
            G KG+PG+G  I GPPG  G PGF GL GD G+ GL G PG KG +G+DC  C  G  G 
Sbjct  479  GDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGP  538

Query  553  KGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMDRLETK  592
            +G+ G+    G  G+ GA G  G +G +G  G   R   K
Sbjct  539  RGQEGDTGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHK  578


 Score = 166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 228/593 (38%), Positives = 278/593 (47%), Gaps = 117/593 (20%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G+ GLPGEKG+RG         D  P    GP G  G  G+ G  G  G RG  G  GP+
Sbjct  513   GLRGLPGEKGLRG---------DDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAGPR  563

Query  103   GRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQ--------RG  154
             G  GLQG PG  G+             G PG AGIPG  GK G  G DG+        +G
Sbjct  564   GVQGLQGNPGRAGH------------KGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKG  611

Query  155   LRGDPGEGGIN-SKGTKGESGVYGIPGLQGPRGPMGER---GPPGYQGPYGERGPRGQIG  210
               GD G+ G     G  GE G  G  G +G RG  G+R   G  GYQG  GE G  G+ G
Sbjct  612   EIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDG  671

Query  211   FPGPR---------GDPGAENVGPTGVRGEDGDVGEPGPPGP----IIEDTEQKPGNISY  257
              PG           G+PG + +   G RG+DGD G  G  G      I D   +PG   Y
Sbjct  672   APGRNATTPKVYLIGEPGYDGI--KGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGY  729

Query  258   SFKGPKGMPGARGDRGPYGLKGERG--------VPGRPGIDGYPGIKGVKGVQGREGWRG  309
             +  GPKG+ GA+G++G  GL+GE G        +PG  G  GYPG  G  G QG  G  G
Sbjct  730   T--GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPG  787

Query  310   KEGKDGRPGDAGVKGDKGAPG---LAGRDGSPGEPGSK---GDEGLPGLPGLQGPEGDRG  363
             ++G+ G  G  G KG +G PG   + G  G PG  G K   GD G PG  GL G  G +G
Sbjct  788   RDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKG  847

Query  364   IYDPTLDKIEPGVTGPQGPIGPRGEPGEDGY-----------------NGKPGPPGLQGR  406
             +          G  GP G +G  G PG  G                  NG+  P G +G+
Sbjct  848   V---------KGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQ  898

Query  407   TGEPGPPGIVGPIGPKG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTII  465
              GE G  G  G  G KG I   G  G+ G        G+ G PGIPGLPG        +I
Sbjct  899   KGEVGSLGQNGQNGAKGSIGFSGRRGLLGN-----LQGLPGSPGIPGLPG--------MI  945

Query  466   GPPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGF  525
             G  G+ G  G +G +G  G RG  G  GPKG+ G      GP G PG+ G PG +G+ G 
Sbjct  946   GEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGD----DGPDGYPGANGLPGRKGETGN  1001

Query  526   PGLPGRPGLKGPKGNDCGFCPPGRPGVKGEAGEAAINGIPGDPGAPGRMGEKG  578
             PG PGRPG KG              G+KG+ GE+ + G  G PGAPG  G++G
Sbjct  1002  PGFPGRPGAKGVAAYS---------GIKGDDGESGLTGPIGYPGAPGVKGQRG  1045


 Score = 163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 248/663 (37%), Positives = 296/663 (45%), Gaps = 161/663 (24%)

Query  43    GIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPK  102
             G  G PG  G  G +GA G PG    DG PG  G  G  G+ G  G++ ++G+    GP 
Sbjct  766   GAKGYPGPTGDYGQQGAPGLPGR---DGEPGLDGGIGYKGQRGVPGQEVIQGEI---GPP  819

Query  103   GRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEF------  147
             GR+G++G+PG           G PGPKG+ G  G DGA G  G+PG  G+RG+F      
Sbjct  820   GRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPG  879

Query  148   --------------GADGQRGLRGDPGEGGIN-SKGTKGESGVY-------------GIP  179
                           GA GQ+G  G  G+ G N +KG+ G SG               GIP
Sbjct  880   PKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNLQGLPGSPGIP  939

Query  180   GLQGPRGPMGERGPPGY---QGPYGERGPRGQIGFPGPRGDPGAENV-GPTGVRGEDGDV  235
             GL G  G +GERG  GY   QG  G RGP G+ G  G  GD G +   G  G+ G  G+ 
Sbjct  940   GLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGET  999

Query  236   GEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGI  295
             G PG PG        +PG      KG     G +GD G  GL G  G PG PG+ G  G 
Sbjct  1000  GNPGFPG--------RPGA-----KGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGP  1046

Query  296   KG-----VKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLP  350
              G     + GV GR+G  G  G +G PG  G+KG +G  GL G+ G PGEPG+KG  G P
Sbjct  1047  VGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYP  1106

Query  351   GLPGLQGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDG-----------------  393
             G  G+ G             K   G  GPQGP GP+GE G  G                 
Sbjct  1107  GRNGINGL------------KAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLI  1154

Query  394   -----------------------------YNGKPGPPGLQGRTGEP---GPPGIVGPIGP  421
                                          Y G  G  GLQG  GE    GP G +GP G 
Sbjct  1155  GEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGA  1214

Query  422   KG----ISIPGEAGVDGTPGPPGQPGVYGPPGIPG--LPGPKGQQGVTIIGPPGQDGVPG  475
             KG    I   G+ G DG  G  G  G  GP G PG  LP  KG +GV      G DG  G
Sbjct  1215  KGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVA-----GLDGRAG  1269

Query  476   QDGFKGVQGDRGDPGVQGPKGIPGQGKP-IRGPPGEPGSPGFPGLEGDVGFPGLPGRPGL  534
             + G  G +G  G PG  GP G  G   P I+GPPG  G  GFPG       PG  GR GL
Sbjct  1270  RPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGA------PGHNGRHGL  1323

Query  535   KGPKGNDCGFCPPGRPGVKGEAGEAAIN--------GIPGDPGAPGRMGEKGSRGPDGKM  586
              GPKG        GR G +GE+G A +         G  G+PG  G  GE+G  G  GK 
Sbjct  1324  IGPKGE---LGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKN  1380

Query  587   DRL  589
              R+
Sbjct  1381  GRV  1383


 Score = 157 bits (396),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 261/743 (35%), Positives = 325/743 (44%), Gaps = 189/743 (25%)

Query  43    GIVGLPGEKGVRGIEG--------AEGNPG---DTGPDGPPGPPGKEGIMGEWGETGEKG  91
             G +GL GE G RG  G        A+G PG   D G  G PG PG++G  G  G  G KG
Sbjct  743   GAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKG  802

Query  92    MRG------DKGFQGPKGRAGLQGYPGP---------PGYPGPKGLDGCNGTDGAPGIAG  136
              RG       +G  GP GR+G++G+PG           G PGPKG+ G  G DGA G  G
Sbjct  803   QRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG  862

Query  137   IPGTSGKRGEF--------------------GADGQRGLRGDPGEGGIN-SKGTKGESGV  175
             +PG  G+RG+F                    GA GQ+G  G  G+ G N +KG+ G SG 
Sbjct  863   LPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGR  922

Query  176   YG-------------IPGLQGPRGPMGERGPPGY---------QGPYGERGPRGQIGFPG  213
              G             IPGL G  G +GERG  GY         +GP GE GP+G  G  G
Sbjct  923   RGLLGNLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDG  982

Query  214   PRGDPGAENV----------------------GPTGVRGEDGDVGEPGPPG----PIIED  247
             P G PGA  +                        +G++G+DG+ G  GP G    P ++ 
Sbjct  983   PDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKG  1042

Query  248   TEQKPGNISYSFKGPKGMPGARGDRGPYGL---------KGERGVPGRPGIDGYPGIKGV  298
                  G+   +  G  G  G  G  GP GL         +G+RG+PG+ G  G PG KG+
Sbjct  1043  QRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGL  1102

Query  299   KGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGL---------  349
              G  GR G  G +   G PG  G KG +G  G+ G DG  G+ G +G  GL         
Sbjct  1103  GGYPGRNGINGLKAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGE  1162

Query  350   ------PGLPGLQGPEGDRGIY-----DPTL--DKIEPGVTGPQGPIGPRGEPGEDGYNG  396
                    G+PG      DR  Y     D  L  ++ E G  GP G IGP G  GE G  G
Sbjct  1163  QGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIG  1222

Query  397   KPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGE------AGVDGTPGPPGQPGVYGPPGI  450
               G  G  G  G  G  G  GP GP GI++P E      AG+DG  G PG  G  G PG 
Sbjct  1223  YAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGP  1282

Query  451   PGLPGPKG---QQGVTIIGPPGQDG------VPGQDGFKGV---QGDRGDPGVQGPKGIP  498
             PG  GP G    +G  I GPPG  G       PG +G  G+   +G+ GD G QG +G  
Sbjct  1283  PGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGES  1342

Query  499   GQGKPIR----GPPGEPGSPGFPGLEGDVGFPGLPGR------PGLKGPKGN--------  540
             G     R    G  G  G PG+ G +G+ G+PGLPG+      PG +GP G+        
Sbjct  1343  GYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDG  1402

Query  541   -DCGFCPPGRPGV-----------KGEAGEAAINGIPGDPGAPGRMG-------------  575
              D    P G+PGV           +GE G     G  GD GAPG +G             
Sbjct  1403  MDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGD  1462

Query  576   --EKGSRGPDGKMDRLETKDWMG  596
               E G  G DG   +   K +MG
Sbjct  1463  QGEVGYTGADGPQGQRGDKGYMG  1485


 Score = 154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 222/593 (37%), Positives = 274/593 (46%), Gaps = 80/593 (13%)

Query  44    IVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGD--------  95
             + GLPG  G+ G+ G  G  G+ G  G  G  G  G  G  GE G KG+ GD        
Sbjct  929   LQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPG  988

Query  96    -KGFQGPKGRAGLQGYPGPPG------YPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEF-  147
               G  G KG  G  G+PG PG      Y G KG DG +G  G  G  G PG  G+RG   
Sbjct  989   ANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVG  1048

Query  148   -------GADGQRGLRGDPGEGGI-NSKGTKGESGVYGIPGLQGPRGPMGERGPPGYQGP  199
                    G  G++G  G PG  G+    G KG+ G  G+PG QG  G  G +G  GY G 
Sbjct  1049  DSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGR  1108

Query  200   YGERGPRGQIGFPGPRGDPGAE-NVGPTGVRGEDGDVGEPGPPGPI--------------  244
              G  G +   GFPGP+G  G +   G  G+ G +G +G+ GP G I              
Sbjct  1109  NGINGLKAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGE  1168

Query  245   ------IEDTEQKPGNISYSFKGPKGMPGAR---GDRGPYGLKGERGVPGRPGIDGYPGI  295
                   +E+   +  +    F G +G+ G R   GD GP G  G  G  G  G  GY G 
Sbjct  1169  VGIPGRLENLRDR--SFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ  1226

Query  296   KGVKGVQGREGWRGKEGKDGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGL  355
              G  G +G +G++G +G  G PG   +  +KG  G+AG DG  G PG  G +G PG PG 
Sbjct  1227  LGFDGAEGLKGFQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGE  1285

Query  356   QGPEGDRGIYDPTLDKIEPGVTGPQGPIGPRGEPGEDGYNGKPGPPGL---QGRTGEPGP  412
              GP G  G   P +     G  GPQG +G  G PG +G +G  GP G     GR GE G 
Sbjct  1286  NGPNGAIGHRGPQIQ----GPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGE  1341

Query  413   PG--IVGPIGPKG-ISIPGEAGVDGTPGPPGQPGVYGPPGIPGLPGPKGQQGVTIIGPPG  469
              G  IVG  G  G I   GE G DG  G  G PG+ G  G  G PGP+        GP G
Sbjct  1342  SGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPR--------GPTG  1393

Query  470   QDGVPGQDGFKGVQGDRGDPGVQGPKGIPGQGKPIRGPPGEPGSPGFPGLEGDVGFPGLP  529
               G  G DG  G+ G +G PGV     +    +P  G  GEPG  GF G EGD G PGL 
Sbjct  1394  DAGWGGIDGMDGLVGPKGQPGVTYSYSMA---RP--GDRGEPGLDGFQGEEGDGGAPGLI  1448

Query  530   GRPGLKGPKGN-----DCGFC-PPGRPGVKGEAGEAAINGIPGDPGAPGRMGE  576
             G  G +G  G      + G+    G  G +G+ G   + G PG  G PG  GE
Sbjct  1449  GFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1501


 Score = 152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 226/588 (38%), Positives = 267/588 (45%), Gaps = 86/588 (15%)

Query  54   RGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQGPKGRAGLQGYPGP  113
            RG  G  G  GD G +G  GPPG+     E GE G+ G  G  G QGP G AGL G  G 
Sbjct  387  RGPIGLAGQSGDPGLNGSRGPPGRS----ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGL  442

Query  114  PGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPGEG-----------  162
             G PG        G  G PG+ G PG  G RG+ G  G  G +G PGEG           
Sbjct  443  HGEPGQN----VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQG  498

Query  163  GINSKGTKGESGVYGIPGL---------------QGPRGPMGERGPPGYQGPYGERGPRG  207
                +G  G+ G YG+ GL                GPRGP G+ G  GY G +G RG   
Sbjct  499  PPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRG---  555

Query  208  QIGFPGPRGDPGAENV----------GPTGVRGEDGDVGEPGPPGPIIEDTEQKPGNISY  257
             IG  GPRG  G +            GP G+ GE G VG  GP G  IE    + G I  
Sbjct  556  AIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEI--  613

Query  258  SFKGPKGMPGARGDRGPYGLKGERGVPGRPGIDGYPGIKGVKGVQGREGWRGKEGKDGRP  317
                        GD G  G +G+ G  G  G DG  G KG          RG+ G+ G  
Sbjct  614  ------------GDTGDSGHRGDTGDDGEKGRDGSDGSKGE---------RGETGQRGDY  652

Query  318  GDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIEPGVT  377
            GDAG +G  G PG  GRDG+PG   +     L G PG  G +G+RG    T  K   G  
Sbjct  653  GDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEP  712

Query  378  GPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPGEAGVDGTPG  437
             P       GEPGEDGY G  G  G +G  G  G  G +G  GP G  IPG  G  G PG
Sbjct  713  NPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPG  772

Query  438  PPGQPGVYGPPGIPGLPGPKGQQGVT-IIGPPGQDGVPGQDGFKGVQGDRGDPGVQGPKG  496
            P G    YG  G PGLPG  G+ G+   IG  GQ GVPGQ+    +QG+ G PG  G KG
Sbjct  773  PTGD---YGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQE---VIQGEIGPPGRSGIKG  826

Query  497  IPGQ-GKP----IRGPPGEPGSPGFPGLEGDVGFPGLPGRPGLKGPKGNDCGFCPPGRPG  551
             PG  G P    + G PG  G  G  G +G VG  GLPG  G +G    D    PPG  G
Sbjct  827  FPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG----DFLVGPPGPKG  882

Query  552  VKGEAGEAAINGIPGDPGAPGRMGEKGSRGPDGKMDRLETKDWMGNME  599
              G  G  A +G  G  G  G +G+ G  G  G +     +  +GN++
Sbjct  883  QPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNLQ  930


 Score = 137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 237/665 (36%), Positives = 288/665 (43%), Gaps = 147/665 (22%)

Query  60   EGNPGDTGPD---------GPPGPPGKEGIMGEW--------GETGEKG------MRGDK  96
             G+ GDTG           G PGP G  G + E         G  GE G      ++ D 
Sbjct  190  RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDD  249

Query  97   GFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTS---GKRGEFGADGQR  153
              +G KG  GLQG  GP G  G +G  G NG  GA G  G PG     GK GE G  G +
Sbjct  250  TLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK  309

Query  154  GLRGDPGEGGIN----SKGTKGESGVYGIPGLQGPRGPMGERGPPGYQ---GPYGERGP-  205
            G++G PG  G +    S G +GE G  G+PG+QG  GP G   P   +   GP G +G  
Sbjct  310  GMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDI  369

Query  206  -----------------RGQIGFPGPRGDPGAE-NVGPTGV--RGEDGD-----------  234
                             RG IG  G  GDPG   + GP G   RGE GD           
Sbjct  370  GPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQG  429

Query  235  ----------VGEPGPPGPIIEDTEQKPGNISYSFKGPKGMPGARGDRGPYGLKGERGVP  284
                       G  G PG  +   + +PG       G  G+ G RGDRG  GL G++G+P
Sbjct  430  PPGEAGLPGRYGLHGEPGQNVVGPKGEPG-----LNGQPGLEGYRGDRGEVGLPGDKGLP  484

Query  285  GR-------------------PGIDGYPGIKGVKGVQGREGW------------RGKEGK  313
            G                    PG DGY G++G+ G +G  G             RG+EG 
Sbjct  485  GEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGD  544

Query  314  DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEGLPGLPGLQGPEGDRGIYDPTLDKIE  373
             G PG  G +G  G  G  G  G  G PG  G +GLPG  G+ G  G  G   P    IE
Sbjct  545  TGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIE  604

Query  374  PGV-----TGPQGPIGPRGEPGEDGYNGKPGPPGLQGRTGEPGPPGIVGPIGPKGISIPG  428
             G       G  G  G RG+ G+DG  G+ G  G +G  GE G  G  G  G +G    G
Sbjct  605  VGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRD--G  662

Query  429  EAGVDGTPGPPGQ----PGVY--GPPGIPGLPGPKGQQGVT----------------IIG  466
            E G DG  G PG+    P VY  G PG  G+ G +G  G T                  G
Sbjct  663  EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTG  722

Query  467  PPGQDGVPGQDGFKGVQGDRGDPGVQGPKGIPG-QGKPIRGPPGEPGSPGFPGLEGDVGF  525
             PG+DG  G  G KG +G++G  G++G  G  G  G+ I GP G  G PG  G  G  G 
Sbjct  723  EPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA  782

Query  526  PGLPGR---PGLKGPKGNDCGFCPPGRPGVKGEA---GEAAINGIPGDPGAPGRMGEKGS  579
            PGLPGR   PGL G  G       PG+  ++GE    G + I G PGD GAPG+ G  G 
Sbjct  783  PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGR  842

Query  580  RGPDG  584
             GP G
Sbjct  843  PGPKG  847


 Score = 115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 216/501 (43%), Gaps = 127/501 (25%)

Query  43    GIVGLPGEKGV---RGIEGAEGNPGDTGPDGPPGPPG--------------KEGIMGEWG  85
             G  G PG KGV    GI+G +G  G TGP G PG PG               +G+ G  G
Sbjct  1003  GFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKG  1062

Query  86    ETGE------------KGMRGDKGFQGPKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPG  133
             E G             KG RGD+G  G +GR G  G  G  GYPG  G++G     G PG
Sbjct  1063  EVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPG  1122

Query  134   IAGIPGTSGKRGEFGADGQRGLRGDPGEGGI-----------------------NSKGTK  170
               G  G  G+ G  G DG+ G  GD G  G+                       N +   
Sbjct  1123  PQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRS  1182

Query  171   GESGVYGIPGLQGPRGPMGERGPPGYQGPYGERGPRGQIGFPGPRGDPGAENVGPTGVRG  230
                G  G  GLQG RG  G+ GP G+ GP G +G RG IG+ G  G  GAE     G++G
Sbjct  1183  FYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAE-----GLKG  1237

Query  231   EDGDVGEPGPPGPIIEDTEQKPGNISYSFK-------GPKGMPGARGDRGPYGLKGERG-  282
               GD G  GPPG  +   +   G      +       G KG PG  G+ GP G  G RG 
Sbjct  1238  FQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGP  1297

Query  283   -------------VPGRPGIDGYPGI---KGVKGVQGREGWRGKEGK-------------  313
                           PG PG +G  G+   KG  G  GR+G RG+ G              
Sbjct  1298  QIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIG  1357

Query  314   -DGRPGDAGVKGDKGAPGLAGRDGSPGEPGSKGDEG------LPGLPGLQGPEGDRGIY-  365
               G PG  G KG++G PGL G++G  G PG +G  G      + G+ GL GP+G  G+  
Sbjct  1358  FQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTY  1417

Query  366   -----------DPTLDKIE--------PGVTGPQ---GPIGPRGEPGEDGYNGKPGPPGL  403
                        +P LD  +        PG+ G Q   G +G RG+ GE GY G  GP   
Sbjct  1418  SYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGP---  1474

Query  404   QGRTGEPGPPGIVGPIGPKGI  424
             QG+ G+ G  G+ G  G +G+
Sbjct  1475  QGQRGDKGYMGLTGAPGLRGL  1495


 Score = 46.2 bits (108),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 72/154 (47%), Gaps = 20/154 (13%)

Query  41    CDGIVGLPGEKGVRGIEGAEGNPGDTGPDGPPGPPGKEGIMGEWGETGEKGMRGDKGFQG  100
              DG  G  G  G+ G  G  G PG  GP G  G          WG     G+ G  G  G
Sbjct  1364  WDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAG----------WG-----GIDGMDGLVG  1408

Query  101   PKGRAGLQGYPGPPGYPGPKGLDGCNGTDGAPGIAGIPGTSGKRGEFGADGQRGLRGDPG  160
             PKG+ G+  Y      PG +G  G +G  G  G  G PG  G +G+ GA G RG +G+ G
Sbjct  1409  PKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVG  1467

Query  161   EGGIN----SKGTKGESGVYGIPGLQGPRGPMGE  190
               G +     +G KG  G+ G PGL+G  GP GE
Sbjct  1468  YTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1501



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


Query= Dcitr00g01590.1.1 Collagen

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CO4A1_CAEEL  unnamed protein product                                  275     2e-83
CO4A2_CAEEL  unnamed protein product                                  270     2e-81
F1KQQ4_ASCSU  unnamed protein product                                 265     8e-80


>CO4A1_CAEEL unnamed protein product
Length=1759

 Score = 275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 154/212 (73%), Gaps = 0/212 (0%)

Query  3     PECPRYTSKLWSGYSLLHISGDNKAHTQDLGSPGSCLPRFSTMPFLFCSLTQTCDYASRG  62
             P+CP   S+LW GYSLL++ G+ +A  QDLG PGSCL +F+TMPF+FC++   C  +SR 
Sbjct  1548  PQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRN  1607

Query  63    DNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEEL  122
             D S+WLS+ EPM   M P+    ++ Y+SRC+VCE  T+ IA+HSQ  ++P CP GW  +
Sbjct  1608  DYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVPQCPQGWSGM  1667

Query  123   WVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGVGSCNYYSTASSFWLATLD  182
             W G+SF+MHT AG+ G GQSL SPGSCL++FR  PFI+CHG G+CNYY+T   FWL+ +D
Sbjct  1668  WTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGTCNYYATNHGFWLSIVD  1727

Query  183   DRDQWRKPRPQTLKANDLKTRISRCAVCLRRK  214
                Q+RKP  QTLKA  LK R+SRC VCL+ +
Sbjct  1728  QDKQFRKPMSQTLKAGGLKDRVSRCQVCLKNR  1759


 Score = 66.6 bits (161),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 54/109 (50%), Gaps = 6/109 (6%)

Query  103   IAIHSQSVTIPSCPGGWEELWVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCH  162
              A HSQ+  +P CP G  +LW G+S L     G    GQ L  PGSCL  F   PF+ C+
Sbjct  1538  FAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGR-ASGQDLGQPGSCLSKFNTMPFMFCN  1596

Query  163   GVGSCNYYSTAS-SFWLATLDDRDQWRKPRPQTLKANDLKTRISRCAVC  210
                 C+  S    SFWL+T    D+   P    +    ++  ISRCAVC
Sbjct  1597  MNSVCHVSSRNDYSFWLST----DEPMTPMMNPVTGTAIRPYISRCAVC  1641


>CO4A2_CAEEL unnamed protein product
Length=1758

 Score = 270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 157/211 (74%), Gaps = 3/211 (1%)

Query  3     PECPRYTSKLWSGYSLLHISGDNKAHTQDLGSPGSCLPRFSTMPFLFCSLTQTCDYASRG  62
             P CP   +KLW GYSLL+I G+ K+H QDLG  GSCL RFSTMPFLFC     C+YASR 
Sbjct  1544  PRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRN  1603

Query  63    DNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEEL  122
             + SYWLS++E +   M P+   +++ Y+SRC+VCE+    IA+HSQ++ IP+CP GW  L
Sbjct  1604  EKSYWLSTSEAI--PMMPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPNCPAGWSSL  1661

Query  123   WVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGV-GSCNYYSTASSFWLATL  181
             W+G+SF MHT AG+ GGGQS  SPGSCL+DFR TPFI+C+G  GSC+Y++   SFWL T+
Sbjct  1662  WIGYSFAMHTGAGAEGGGQSPSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTI  1721

Query  182   DDRDQWRKPRPQTLKANDLKTRISRCAVCLR  212
             D+  +++ P  QTLK+ +L+TR+SRC VC++
Sbjct  1722  DNDSEFKVPESQTLKSGNLRTRVSRCQVCVK  1752


 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 52/116 (45%), Gaps = 22/116 (19%)

Query  103   IAIHSQSVTIPSCPGGWEELWVGFSFL-------MHTDAGSGGGGQSLISPGSCLQDFRP  155
             +  HSQ+  +P CP G  +LW G+S L        H         Q L   GSCLQ F  
Sbjct  1534  LVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHN--------QDLGHAGSCLQRFST  1585

Query  156   TPFIQCHGVGSCNYYS-TASSFWLATLDDRDQWRKPRPQTLKANDLKTRISRCAVC  210
              PF+ C     CNY S    S+WL+T +            +   +++  ISRCAVC
Sbjct  1586  MPFLFCDFNNVCNYASRNEKSYWLSTSEAIPMM------PVNEREIEPYISRCAVC  1635


>F1KQQ4_ASCSU unnamed protein product
Length=1759

 Score = 265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 151/212 (71%), Gaps = 0/212 (0%)

Query  3     PECPRYTSKLWSGYSLLHISGDNKAHTQDLGSPGSCLPRFSTMPFLFCSLTQTCDYASRG  62
             P CP  +  LW+GYSLL++ G+ +   QDLG  GSCL +FSTMPF+FC+L   C  +SR 
Sbjct  1548  PRCPPGSQMLWTGYSLLYVQGNGRTSGQDLGQAGSCLSKFSTMPFMFCNLNSVCHVSSRN  1607

Query  63    DNSYWLSSTEPMLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEEL  122
             D S+WLS+ EPM + M P+    ++ Y+SRC+VCE  T+ +A+HSQ   IP CP GW  L
Sbjct  1608  DYSFWLSTAEPMTQMMNPVSGTAIRPYISRCAVCEIPTQIMAVHSQDSYIPECPRGWSPL  1667

Query  123   WVGFSFLMHTDAGSGGGGQSLISPGSCLQDFRPTPFIQCHGVGSCNYYSTASSFWLATLD  182
             + G+SF+MHT AG+ G GQ+L SPGSCL++FR  PFI+CHG G+CN+Y+T   FWLA +D
Sbjct  1668  YSGYSFVMHTAAGAEGTGQNLQSPGSCLEEFRAVPFIECHGRGTCNHYATNHGFWLAIVD  1727

Query  183   DRDQWRKPRPQTLKANDLKTRISRCAVCLRRK  214
                QWRKP  QTLKA  LK R+SRC VCL+ +
Sbjct  1728  RNKQWRKPMSQTLKAGGLKDRVSRCQVCLKNR  1759


 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 54/111 (49%), Gaps = 10/111 (9%)

Query  103   IAIHSQSVTIPSCPGGWEELWVGFSFLMHTDAG--SGGGGQSLISPGSCLQDFRPTPFIQ  160
              A HSQ+  IP CP G + LW G+S L     G  S   GQ L   GSCL  F   PF+ 
Sbjct  1538  FARHSQTTDIPRCPPGSQMLWTGYSLLYVQGNGRTS---GQDLGQAGSCLSKFSTMPFMF  1594

Query  161   CHGVGSCNYYSTAS-SFWLATLDDRDQWRKPRPQTLKANDLKTRISRCAVC  210
             C+    C+  S    SFWL+T +   Q   P    +    ++  ISRCAVC
Sbjct  1595  CNLNSVCHVSSRNDYSFWLSTAEPMTQMMNP----VSGTAIRPYISRCAVC  1641



Lambda      K        H
   0.320    0.134    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2997851530


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Apr 30, 2020  2:49 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g01600.1.1 Collagen

Length=87
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O18407_DROME  unnamed protein product                                 94.7    3e-24
Q9VMV5_DROME  unnamed protein product                                 94.7    3e-24
CO4A1_DROME  unnamed protein product                                  80.5    3e-19


>O18407_DROME unnamed protein product
Length=1761

 Score = 94.7 bits (234),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)

Query  1     MLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEELWVGFSFLMQQM  60
             M  TM PI   DL KY+SRC VCE+TTR IA+HSQS++IP CPGGWEE+W G+S+ M  +
Sbjct  1597  MPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTL  1656


 Score = 33.5 bits (75),  Expect = 0.013, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  31    AIHSQSVTIPSCPGGWEELWVGFSF  55
             A HSQSV +P CP     LW G+S 
Sbjct  1517  ARHSQSVHVPQCPANTNLLWEGYSL  1541


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 94.7 bits (234),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)

Query  1     MLKTMEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEELWVGFSFLMQQM  60
             M  TM PI   DL KY+SRC VCE+TTR IA+HSQS++IP CPGGWEE+W G+S+ M  +
Sbjct  1599  MPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTL  1658


 Score = 33.5 bits (75),  Expect = 0.013, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  31    AIHSQSVTIPSCPGGWEELWVGFSF  55
             A HSQSV +P CP     LW G+S 
Sbjct  1519  ARHSQSVHVPQCPANTNLLWEGYSL  1543


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 80.5 bits (197),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)

Query  5     MEPIPSADLKKYVSRCSVCESTTRAIAIHSQSVTIPSCPGGWEELWVGFSFLMQQMLLN  63
             M P+ + ++++Y+SRC VCE+    IA+HSQ++ +P CP GWE LW+G+SFLM   + N
Sbjct  1641  MMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGN  1699


 Score = 38.5 bits (88),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  30    IAIHSQSVTIPSCPGGWEELWVGFSFL  56
             I  HSQS T+P+C  G  ELW G+S L
Sbjct  1558  ITRHSQSETVPACSAGHTELWTGYSLL  1584



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01610.1.1 SelT-like

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SELT_DROME  unnamed protein product                                   199     7e-65
PKS37_DICDI  unnamed protein product                                  32.3    0.27 
Q38C92_TRYB2  unnamed protein product                                 29.3    3.3  


>SELT_DROME unnamed protein product
Length=198

 Score = 199 bits (505),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 120/167 (72%), Gaps = 2/167 (1%)

Query  29   SSSEKQIPLTKVGLASNIGPTLKFFYCYSCGYRKAFEEYQMVLTQKYPIITVLGDNFDPP  88
            +  EK+IP+TK G   NI PT+ F YCYSCGYRKAFE+Y  +L +KYP I V G N+DPP
Sbjct  25   AEGEKEIPVTKFG--QNIAPTMTFLYCYSCGYRKAFEDYVGLLGEKYPQIQVNGGNYDPP  82

Query  89   FLHLVFAKFLSVAKILLIATIIGGLNPFQFIGCNLPRWFEWCQANKFYACMMIFFCCNAI  148
             L+   +K +   KI++I +++  ++PF F+G N P W+   QANK YACMMIFF  N +
Sbjct  83   GLNYYLSKMIFALKIIIIVSVVSAVSPFTFLGLNTPSWWSHMQANKIYACMMIFFLGNML  142

Query  149  ESTLISTGAFEILFNDMPIWSKLETGRIPQPNELFQIIDSHLGFGKK  195
            E+ LIS+GAFEI  ND+P+WSKL+TGR P P  LFQIID+HL F +K
Sbjct  143  EAQLISSGAFEITLNDVPVWSKLQTGRFPSPEVLFQIIDNHLQFTEK  189


>PKS37_DICDI unnamed protein product
Length=2968

 Score = 32.3 bits (72),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 26/115 (23%), Positives = 50/115 (43%), Gaps = 17/115 (15%)

Query  34    QIPLTKVGLASNIGPTLKFFYCYSCGYRKAFEEYQMVLTQKYPIITVLGDNFDPPFLHLV  93
             ++ L+  G+ S++   +K F    CG  +     +M       I+  LG ++DP  L+ +
Sbjct  1711  RVELSDNGIISDL--KIKQFRQMKCGVGQVLVRVEMCTLNFRDILKSLGRDYDPIHLNSM  1768

Query  94    FAKFLSVAKILLIATIIGGLNPFQFI-GCNLPRWFEWCQANKFYACMMIFFCCNA  147
               +F    K++ I   +  L+  Q++ G N+ +             M  F CCN+
Sbjct  1769  GDEF--SGKVIEIGEGVNNLSVGQYVFGINMSK------------SMGSFVCCNS  1809


>Q38C92_TRYB2 unnamed protein product
Length=1220

 Score = 29.3 bits (64),  Expect = 3.3, Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  167  IWSKLETGRIPQPNELFQIIDSHLG  191
            +WSKLE G IP   E+ +  D  LG
Sbjct  487  VWSKLEDGEIPDEVEIQEAFDQPLG  511



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01620.1.1 Transmembrane

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NDN5_DROME  unnamed protein product                                 101     1e-21
A0A0U1QT59_DROME  unnamed protein product                             100     2e-21
TMC1_CAEEL  unnamed protein product                                   77.4    2e-14


>M9NDN5_DROME unnamed protein product
Length=1932

 Score = 101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  32   SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  76
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  129  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  183

Query  77   --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  118
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  184  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  240

Query  119  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  178
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  241  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  279

Query  179  YENSSRWASPEIDLDTALGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  235
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  280  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  335

Query  236  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  295
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  336  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  395

Query  296  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  353
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  396  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  451

Query  354  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  409
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  452  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  508

Query  410  VFMFSLYSRLNCPRK  424
              MFS   ++N   K
Sbjct  509  SLMFSFIYKINSKEK  523


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  435   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  485
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1130  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1189

Query  486   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  545
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1190  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1249

Query  546   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  604
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1250  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1309

Query  605   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  655
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1310  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1360


>A0A0U1QT59_DROME unnamed protein product
Length=2036

 Score = 100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 202/435 (46%), Gaps = 82/435 (19%)

Query  32   SENLANEESTWEEI-------------MKIKATPIHMSQKKELKLKLQSAETF--RLQGL  76
            SE   N+EST E+I             +K++  PI    +K+LKL ++ A+T+  R +G 
Sbjct  233  SEEGTNQESTQEQIFENIRLHKEVIQSVKLQPWPI----RKKLKL-VRQAKTYVARHEGA  287

Query  77   --KQFKWQR--RKLWQKCKAHFRENQSKWRLWEGSLSS--------------LEAYTGTG  118
              ++F   R  R LW + K       ++WR W+   +S              +E++ G+G
Sbjct  288  LQERFAMSRSTRDLWARFKILM---AARWRHWKRETASFLTVLIPWELRIKEIESHFGSG  344

Query  119  VSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLCDDHNDTTSIECCAAT  178
            V+S F F +WL+ VN+   + +   +++G   +Y             H +T         
Sbjct  345  VASYFTFLRWLMWVNIMIAIPLV-AFVIG--PEY---------FATKHGET---------  383

Query  179  YENSSRWASPEIDLDTALGLLTG---AGWLEWTAFFYGTYARGNMKAILGDYNVSIGYLV  235
             +   R + PE  +  A  L T     G+L+++  FYG Y+  +  +  G Y + + Y +
Sbjct  384  -DPRKRMSDPEARV--AGNLFTFWEFEGYLKYSPMFYGYYSSTSGISTSG-YKLPLAYFL  439

Query  236  SNFLFFLITFILICKNVTKTVRHKIMERENGNYLYSNLIFGGWDYCLQNEINAKMRQKAI  295
            +  L ++ +F+   + + +  R+  +  ++   ++S  +F GWD+ + +   A  R  ++
Sbjct  440  TAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASV  499

Query  296  FTQLKHLLDLELSQSRGHRDKDNNLRVMPIRFFINVIVLALLVTSGYIVTLMLHVTYP--  353
                K  L  E  + + +R    N RV+  R  +N++V+ LL  SG  V L+++ +    
Sbjct  500  VVGFKEALLEEAEKKKDNR----NWRVILQRILVNILVMGLLGLSGATVVLLVNHSEDLA  555

Query  354  ----WHILLSEYSVPLTIALLNRIVGFIFEKITLIENYNYFNVLRVTALRCLILRLTNLT  409
                W   LS  +V +T+ LL+  +  IFE + L EN++    LR+   R +IL + NL 
Sbjct  556  KHDNW---LSRNAVNVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLY  612

Query  410  VFMFSLYSRLNCPRK  424
              MFS   ++N   K
Sbjct  613  SLMFSFIYKINSKEK  627


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query  435   TPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLH---CSSLRQ------EF  485
             T +CWE+ +GQ++ K+I+ D L+ +     + F R+   ++++   C  + +      +F
Sbjct  1234  TTMCWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDF  1293

Query  486   LLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHYGFR  545
              + ++ L L+  Q   ++GIF++P L L+  + L I+ Y + +  +   VP   V    +
Sbjct  1294  KIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASK  1353

Query  546   CSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPFKGLLSVAHLIKD-TYTQLPVWITS  604
              +  ++S+L     L +LP+ Y+I+++ PS  CGPF     +A  I + T   LP  +  
Sbjct  1354  SNNFYLSLLLTMLFLCVLPVGYAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHE  1413

Query  605   SITHMFNTPYFLLISIILLLVLYYYHNVSVTN--REMVQILKKQLILEGQDKQ  655
              + ++  T    +I ++LLL+L  Y+ VS+T   RE  Q L+ QL  E ++++
Sbjct  1414  PLDYL--TSSSTVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEER  1464


>TMC1_CAEEL unnamed protein product
Length=1285

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/334 (22%), Positives = 135/334 (40%), Gaps = 48/334 (14%)

Query  104  WEGSLSSLEAYTGTGVSSLFRFTKWLLCVNMFTVLLMYPNYLLGTKKQYNSSQQVMWDLC  163
            WE  +  +E++ G+ VSS F F +W++ VN+   L+     +L                 
Sbjct  152  WESKIKRIESHFGSVVSSYFTFLRWIVFVNIMITLIALVFVVLP----------------  195

Query  164  DDHNDTTSIECCAATYENSSRW----------ASPEIDLDTALGLLTGAGWLEWTAFFYG  213
                     E  A +  N  R+          A+  +  D    +    G+L ++  FYG
Sbjct  196  ---------ETLADSVANEGRFNRTKTRKQIPANERVHADELAVVWHYDGYLRYSPLFYG  246

Query  214  TYARGNMKAILGDYNVSIGYLVSNFLFFLITFILICKNVTKTVR-HKIMERENGNYLYSN  272
             Y+          Y + + Y +     F  +F  I + +    R  K+   +   Y+++ 
Sbjct  247  YYSDDPFLGNKIKYALPLAYFMVTLTIFAYSFFAILRKMAANARMSKLSGSKAEQYIFNW  306

Query  273  LIFGGWDYCLQNEINAKMRQKAIFTQLKH-LLDLELSQSRGHRDKDNNLRVM--PIRFFI  329
             +F GWDY + N   A     A+  +L+  + D++       +D     R++   +R F 
Sbjct  307  KLFTGWDYTIGNSETASNTVMAVVIKLRESIADIK-------KDAHGKFRLLQFSLRVFA  359

Query  330  NVIVLALLVTSGYIVTLMLHVTYPWHI--LLSEYSVPLTIALLNRIVGFIFEKITLIENY  387
            N+I+ A+L  S Y +   +  +       L ++  VP  ++ +  +   IF+ I  +ENY
Sbjct  360  NIIICAMLGFSIYCIIFAVQKSQVQDDGNLFTKNQVPSVVSTITHVFPMIFDLIGKMENY  419

Query  388  NYFNVLRVTALRCLILRLTNLTVFMFSLYSRLNC  421
            +    LR    R LIL   N    +F+L+ ++  
Sbjct  420  HPRTALRAHLGRVLILYTVNYITLIFALFEKMTA  453


 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 82/159 (52%), Gaps = 13/159 (8%)

Query  434  NTPLCWESYVGQQIYKLIISDVLLQVFLTFFLHFPRSFLYKHLHCSS-----------LR  482
            N  +CWE+ +GQ+I KL+  D++  +     +   R    K+  CSS             
Sbjct  663  NNDICWETIIGQEIVKLVTMDLIFTILSILVIDLFRGLWIKY--CSSWWCWDIETTFPEY  720

Query  483  QEFLLFQHYLDLVYLQLLGFLGIFYAPFLPLLLCLLLFILFYVKKFACIYNCVPPLRVHY  542
             EF + ++ L ++  Q + +LG+F+AP LP +  + L IL Y++ +A +   VP   +  
Sbjct  721  GEFKVAENVLHIINNQGMIWLGLFFAPLLPAINNIKLIILMYIRGWAVMTCNVPAREIFR  780

Query  543  GFRCSAHFMSILFLCYVLSLLPITYSILYIMPSRSCGPF  581
              R S  ++ IL +  +L  LP+ + I  + PSRSCGPF
Sbjct  781  ASRSSNFYLGILLIWLLLCTLPVGFVIASMSPSRSCGPF  819



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01630.1.1 ATP

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTEF5_DROME  unnamed protein product                                  174     7e-48
Q57VA7_TRYB2  unnamed protein product                                 31.6    2.2  
SMG1_DROME  unnamed protein product                                   31.2    2.5  


>MTEF5_DROME unnamed protein product
Length=560

 Score = 174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 243/501 (49%), Gaps = 14/501 (3%)

Query  29   NSELIKKMLGYDDTNWNN--EENSFLNKYDRNNILDSYKLLKKFGYSDADIKSELRTLCL  86
            N+  + K LG    +W    E++  L    R ++L SY  LK   YS  DI ++   +  
Sbjct  55   NASYLSKTLGSSYRSWAAALEKHPELKTLKRKDLLSSYDTLKSLDYSVDDIIAKPMIIYY  114

Query  87   KPQTITSRYRMFIDYCFQKDLISPTLLRHFVKTMSLNIYQIKHKGYID---KYKDVLGHV  143
               T+ +R+ +  +  F    ++   L  +V  ++  I  +K   YI    K  + L   
Sbjct  115  GATTLANRHSVLQECGFHN--VTVQTLAKYVTVVNKPIEVLKAHNYIPFDVKVAERLAGY  172

Query  144  NK--KLNISVQSL-SEKMPLKRVHCEFSVHHLMSVLNISHEEAKYKFKRYPNLKSRSFKC  200
             K  KL + ++ L SE + LK +       +L   L +   + +  ++ Y  ++ +SF+ 
Sbjct  173  FKDIKLPVDLRELESETLTLKSLRQSLINAYLRERLQMDDNDLQKLWRVYTRIRHKSFRA  232

Query  201  IQENVHVLTKKVGFTHERIKKNAFLLHADKENLLSLLKKYPKLGSVDMKQIIQAYPILVL  260
            +Q+ + +LTK+  F+ ER++KN+FLL+++ +N+  +L++ P + S D+++I    P +++
Sbjct  233  VQDTIELLTKEFNFSAERLRKNSFLLYSEADNVRRILREVPTIDSQDIREIGFRRPKILM  292

Query  261  SPIRNIESVIKCVQKFGYTLEHLSKAPMILILKPSTVEQRLTQIHTEEWLQPYSGLPRTL  320
            S   +++  ++ V  FG + + + +   +L L P TV +RL  +   E  Q     PR L
Sbjct  293  STCDSLKQTLQHVHAFGISEDAVLRCLEVLTLGPDTVLERLRDLQEIEEFQVLGTNPRIL  352

Query  321  MLVLTLPSLEKRRAVLQDLNMKCISINVLACTKILFNAYVKHGRDKLNSEDAYLYLSNKL  380
             LV        R   L  L ++C S+++L+C    F  + + G D+    D  +YLSN L
Sbjct  353  RLVHYQNKARLRLDYLNQLRVRCASLHILSCGSEAFAKFARDGSDRTKGRDIVVYLSNVL  412

Query  381  NVPFEKITQKLQSHPYKRYVSIQQIHNSLTFLLG-KFSEDNIYNNLQLVLYPVTVIEAAL  439
                + +   L  HP   ++ +  +   L +L   KF  + I+ N+ L+LYP+  IE  +
Sbjct  413  GKDVQVLRNLLSRHPNWCHIPLLHVKQCLEYLRSKKFKLNEIFANIHLLLYPIKRIEEKM  472

Query  440  EKLTSGSDTSLDTTPCHDANGNIKEELILPLTLYVIEKQTNFTGYGIWEEEEDGEVEHNA  499
              L S         P  + +     E IL L LY+IE + +FTG GIW E+    VE+  
Sbjct  473  LLLQSPDAQEDLQLPVANFDSLSNNE-ILTLILYLIESEFHFTGDGIWTEQHTHHVENFN  531

Query  500  NL--DSPVSMLPIRKKKRKPS  518
            NL  D P S+  + K   KP+
Sbjct  532  NLLPDFPESLNKVYKYGVKPA  552


>Q57VA7_TRYB2 unnamed protein product
Length=753

 Score = 31.6 bits (70),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 4/56 (7%)

Query  3    STRVLSRIYWCRSLSTSNSLHSSA----ETNSELIKKMLGYDDTNWNNEENSFLNK  54
            S  V  R  WC S +        A    ET +E+       +  NW+ EEN FL K
Sbjct  610  SAAVRPRRVWCLSHTEQKKREEEARRVYETEAEVTVNQFQQELANWDREENKFLKK  665


>SMG1_DROME unnamed protein product
Length=3218

 Score = 31.2 bits (69),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 33/69 (48%), Gaps = 7/69 (10%)

Query  272  CVQK-FGYTLEHLSKAPMILILKPSTVEQRLTQIHT---EEWLQPYSGLPRTLMLV---L  324
            C+Q    Y LE L K P +LIL   T  Q+L  + T     + Q Y+ LP  L L     
Sbjct  713  CIQTVLDYGLERLEKYPKLLILYRDTALQQLQMLSTNYHAPYFQIYAQLPLHLTLTGGES  772

Query  325  TLPSLEKRR  333
            ++P +  RR
Sbjct  773  SMPGMASRR  781



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01640.1.1 Protein

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q381S4_TRYB2  unnamed protein product                                 36.6    0.041
Q385W7_TRYB2  unnamed protein product                                 31.2    2.1  
Q38EM1_TRYB2  unnamed protein product                                 30.0    2.6  


>Q381S4_TRYB2 unnamed protein product
Length=595

 Score = 36.6 bits (83),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 56/316 (18%), Positives = 130/316 (41%), Gaps = 41/316 (13%)

Query  2    SATHSSNVKHTLHCNES---YGTSNLKNSWKIVTDETNKVSFIANLNDDKSGNTSKVVEK  58
            S  HS+  K  +    S   +   N+  SW+ V     +V   +  N+        ++++
Sbjct  108  SYNHSNKQKREVSLTPSELGFSQCNVNYSWETVVAHPLEVRLASRRNES-------LLQR  160

Query  59   IKIFFYQAFLPQGFPDTVSNDYIEYQLWDTAQAFCSTLTAVLTTHAIMQGVGVGNESATT  118
            + +F     +P G+PD+    +  Y L     +F S+  + +   +I+ G  +       
Sbjct  161  LHLFG----MPAGYPDSCGEGFRRYFLLSLCSSFVSSFASSIGYQSILNGFLLA------  210

Query  119  LAAATAWIIKDGTGMI------GRILFAWWEGTILDADCKRWRILADLINDVAMCVELML  172
             ++   W++KD    +       R++         +   K W + +  ++++++  E+++
Sbjct  211  -SSPQLWMLKDLAPALAAAYLANRVI-------SYENRPKFWFVFSVALHNLSVIAEMII  262

Query  173  PLFPQSCVIYALALSSLGKSLVGVAGGATRASIIQHQAAHSGNIGDIAAKDGSQETCVNL  232
            P    + ++ A  L+S  +    +    TRAS +QH A  S N+ ++  K  S    +  
Sbjct  263  PTTVPNHLLAAAILTSCVRQSASLMFLVTRASALQHFAI-SNNLAELTKKFNSFGMVIYT  321

Query  233  TASLLGLVVLKLCTEKTFLTWLLFIIFTGLHIYSNYRAVRCLEFNTFNRQRFIILFQHYL  292
             ++ LG+    L    T       ++  G ++  ++ ++  + F   N     ++ + Y+
Sbjct  322  VSTALGIAYTSLVPSVT-AQLATVLMCCGANLAISHLSMCNIAFRILNETTLSVILRFYM  380

Query  293  HSK-----HILSPSQV  303
              +      +LSP +V
Sbjct  381  REEGHQRGRVLSPREV  396


>Q385W7_TRYB2 unnamed protein product
Length=921

 Score = 31.2 bits (69),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 56/135 (41%), Gaps = 25/135 (19%)

Query  26   NSWKIVTDETNKVSFIANLNDDKSGNTSKVVEKIKIFFYQAFLPQGFP--------DTVS  77
            +S K+ +D   +    A L +D +G  + V+     F   A L +  P        DTV+
Sbjct  643  SSIKVASDGCRR----ATLQEDAAGARAAVILLTSCFELSALLNRSVPQLGFDEDRDTVT  698

Query  78   N------DYIEYQLWDTAQ---AFCSTLTAVLTTHAIMQGVGVGNESATTLAAATAWIIK  128
                     ++  + +  Q   A+C+    V  +  +++ VG G     T   A AW  +
Sbjct  699  TAAHPRVQILQLAVLEAVQMLLAYCARNDGV--SPYVVRAVGCGLTVFLTTPKAAAWEHE  756

Query  129  DGTGMIGRI--LFAW  141
            D TG  GR+  +F W
Sbjct  757  DDTGDEGRLPCVFPW  771


>Q38EM1_TRYB2 unnamed protein product
Length=193

 Score = 30.0 bits (66),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 28/47 (60%), Gaps = 1/47 (2%)

Query  1    MSATH-SSNVKHTLHCNESYGTSNLKNSWKIVTDETNKVSFIANLND  46
            +S +H S+N K  + C +  G   L++SW++  D+T+ V F+ +  D
Sbjct  56   LSISHGSNNNKIEVSCWDLGGQEQLRDSWRLYYDQTDAVIFVVDAAD  102



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01650.1.1 peroxisome

Length=321
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUC7_DROME  unnamed protein product                                 52.8    2e-07
Q9Y090_DROME  unnamed protein product                                 52.8    2e-07
Q9U3I6_CAEEL  unnamed protein product                                 33.5    0.23 


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


>Q9U3I6_CAEEL unnamed protein product
Length=336

 Score = 33.5 bits (75),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 6/70 (9%)

Query  123  LNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVPPE-----PESH  177
            L +  C+ KN ++P     Q + F+ +D L+P+    +++ D  L F PPE     P   
Sbjct  144  LRKYACLTKNDRIPTSYAGQTLEFLVVD-LKPANSVCIIECDVNLDFDPPEGYVEQPRQV  202

Query  178  KPSINQPQPT  187
             P++    P 
Sbjct  203  TPAVTAKPPA  212



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01660.1.1 Root

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SYFA_DROME  unnamed protein product                                   31.6    0.25 
Q38EM1_TRYB2  unnamed protein product                                 30.0    0.59 
Q385W7_TRYB2  unnamed protein product                                 29.3    1.5  


>SYFA_DROME unnamed protein product
Length=498

 Score = 31.6 bits (70),  Expect = 0.25, Method: Composition-based stats.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  58   KIKIFFYQAFLPQGFPDTVSNDYIEYQLWD  87
            K++  F Q FL  GF +  +N+Y+E   W+
Sbjct  228  KVRTEFRQIFLEMGFSEMPTNNYVESSFWN  257


>Q38EM1_TRYB2 unnamed protein product
Length=193

 Score = 30.0 bits (66),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  1    MSATH-SSNVKHTLHCNESYGTSNLKNSWKIVTDETNKVSFIANLNDDKSGNTSK-VVEK  58
            +S +H S+N K  + C +  G   L++SW++  D+T+ V F+ +  D      ++ V+ K
Sbjct  56   LSISHGSNNNKIEVSCWDLGGQEQLRDSWRLYYDQTDAVIFVVDAADPSRFPAARSVLHK  115

Query  59   I  59
            I
Sbjct  116  I  116


>Q385W7_TRYB2 unnamed protein product
Length=921

 Score = 29.3 bits (64),  Expect = 1.5, Method: Composition-based stats.
 Identities = 33/137 (24%), Positives = 57/137 (42%), Gaps = 25/137 (18%)

Query  24   LKNSWKIVTDETNKVSFIANLNDDKSGNTSKVVEKIKIFFYQAFLPQGFP--------DT  75
            + +S K+ +D   +    A L +D +G  + V+     F   A L +  P        DT
Sbjct  641  VTSSIKVASDGCRR----ATLQEDAAGARAAVILLTSCFELSALLNRSVPQLGFDEDRDT  696

Query  76   VSN------DYIEYQLWDTAQ---AFCSTLTAVLTTHAIMQGVGVGNESATTLAAATAWI  126
            V+         ++  + +  Q   A+C+    V  +  +++ VG G     T   A AW 
Sbjct  697  VTTAAHPRVQILQLAVLEAVQMLLAYCARNDGV--SPYVVRAVGCGLTVFLTTPKAAAWE  754

Query  127  IKDGTGMIGRI--LFAW  141
             +D TG  GR+  +F W
Sbjct  755  HEDDTGDEGRLPCVFPW  771



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01670.1.1 ATPase

Length=973
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y090_DROME  unnamed protein product                                 330     1e-97
Q9VUC7_DROME  unnamed protein product                                 330     1e-97
Q386Y8_TRYB2  unnamed protein product                                 262     2e-75


>Q9Y090_DROME unnamed protein product
Length=1006

 Score = 330 bits (846),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 196/569 (34%), Positives = 308/569 (54%), Gaps = 42/569 (7%)

Query  376  IRVELIPSSVKYCLYDNKIQREVQISYEEYVPVKQKVVQSEGGVLTSNLGAISTEKPF-L  434
            + V ++P   +YC+ D +  +E +I   + V    ++++ E    T     +S +    L
Sbjct  393  VTVGILPEHFRYCVVDAQFLKESKIYAADLVRPVGEIIKEE----TPPTSPLSVQDLIQL  448

Query  435  NHLNQTLNTLVSQIR----ISVRSSYLYRDNILVTGAEGSGKTTFCKTLQEALQNAGPDS  490
               ++ ++ +V ++R    +S  +S + + N+L+ GA G+GKT   + + + L    PD 
Sbjct  449  PEYDKIVDQVVQELRMNLCLSADNSVMRQCNVLLAGASGTGKTVLVERILDQLSRK-PDY  507

Query  491  IHCQVVDCKQMKSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATT  550
             H +     + K +    ++K LR++ +      P+ V+L+++++L     E        
Sbjct  508  CHFEFFHGSRSKGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGE  566

Query  551  LCNKLCSLFVSLVHEFQLNSSIVMVGVTSSRDII----KNTKAGLVFSHCYSLPPLELDN  606
              N++      L+ ++  N++I ++   +    +     + +   VF     LP LE  +
Sbjct  567  YYNRMADTVYQLIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERAD  626

Query  607  RNLLLETLIQYKLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLE  665
            R ++L  L        H N+  D+D+ K S   EGY   D+   V++A+F+         
Sbjct  627  REIILRELCS------HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-----  675

Query  666  DNDASTPDTLKTNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKS  718
                + P      L + + L E+ +      L+GI SN          ++    + GL+S
Sbjct  676  --SKTQP------LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLES  727

Query  719  AKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKG  778
               +L E L+WPS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KG
Sbjct  728  VVGVLEEVLMWPSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKG  787

Query  779  PELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTE  838
            PEL +K+IG+SEE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTE
Sbjct  788  PELLAKYIGQSEENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTE  847

Query  839  LDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLN  898
            LDGVEGL+GV V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+
Sbjct  848  LDGVEGLQGVTVIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLD  907

Query  899  SDVNLTEIAQCTERFTGADLLGLLCSAQM  927
              V+    A  T  +TGAD+  +L SA M
Sbjct  908  ECVDFDWFAGKTANYTGADIQSILTSANM  936


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 11/211 (5%)

Query  745  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  799
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  800  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  856
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  857  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTEIAQCTERF  913
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L + +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  914  TGADLLGLLCSAQMLRQEYDEEKLKMNNDTL  944
               DL+  +  A        + +  + ND L
Sbjct  657  RKCDLVQFVERAIFYAYRISKTQPLLTNDQL  687


>Q9VUC7_DROME unnamed protein product
Length=1006

 Score = 330 bits (846),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 196/569 (34%), Positives = 308/569 (54%), Gaps = 42/569 (7%)

Query  376  IRVELIPSSVKYCLYDNKIQREVQISYEEYVPVKQKVVQSEGGVLTSNLGAISTEKPF-L  434
            + V ++P   +YC+ D +  +E +I   + V    ++++ E    T     +S +    L
Sbjct  393  VTVGILPEHFRYCVVDAQFLKESKIYAADLVRPVGEIIKEE----TPPTSPLSVQDLIQL  448

Query  435  NHLNQTLNTLVSQIR----ISVRSSYLYRDNILVTGAEGSGKTTFCKTLQEALQNAGPDS  490
               ++ ++ +V ++R    +S  +S + + N+L+ GA G+GKT   + + + L    PD 
Sbjct  449  PEYDKIVDQVVQELRMNLCLSADNSVMRQCNVLLAGASGTGKTVLVERILDQLSRK-PDY  507

Query  491  IHCQVVDCKQMKSKIPNVVEKYLRDVLSCACYMEPSCVILDDINILCSCNKESLDVAATT  550
             H +     + K +    ++K LR++ +      P+ V+L+++++L     E        
Sbjct  508  CHFEFFHGSRSKGRKTESIQKDLRNIFTSCLQHAPAIVVLENLDVLAHAAGEQ-SSQDGE  566

Query  551  LCNKLCSLFVSLVHEFQLNSSIVMVGVTSSRDII----KNTKAGLVFSHCYSLPPLELDN  606
              N++      L+ ++  N++I ++   +    +     + +   VF     LP LE  +
Sbjct  567  YYNRMADTVYQLIVQYTTNNAIAVIATVNELQTLNKRLSSPRGRHVFQTVARLPNLERAD  626

Query  607  RNLLLETLIQYKLKREHYNM-NDIDINKVSKQCEGYTVQDMCDVVDKALFHYLHTKVDLE  665
            R ++L  L        H N+  D+D+ K S   EGY   D+   V++A+F+         
Sbjct  627  REIILRELCS------HINVAKDLDLVKFSNLTEGYRKCDLVQFVERAIFYAYRI-----  675

Query  666  DNDASTPDTLKTNLFSTEDLEEAFKSHVPLALKGISSNA-------VEKINFSNVGGLKS  718
                + P      L + + L E+ +      L+GI SN          ++    + GL+S
Sbjct  676  --SKTQP------LLTNDQLIESLEHTNSYCLQGIQSNQRTGNDADANEMRVEELPGLES  727

Query  719  AKQLLIETLVWPSMYPDLFSQCPLKPQSGILLYGAPGTGKTLLASAISGECGLKFISIKG  778
               +L E L+WPS YP +F+  PL+ Q+G+LLYG PGTGKT L S ++    L+ IS+KG
Sbjct  728  VVGVLEEVLMWPSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKG  787

Query  779  PELFSKFIGESEEGVRNIFNRARSIQPCILFFDEFDSLAAKRGNDSTGVKDRVVNQLLTE  838
            PEL +K+IG+SEE VRN+FNRARS +PC+LFFDEFDSLA KRG+DSTGV DRVVNQLLTE
Sbjct  788  PELLAKYIGQSEENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTE  847

Query  839  LDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLN  898
            LDGVEGL+GV V+ ATSRP+++DPALLR GR+   V C +PD   R  I   L+  L L+
Sbjct  848  LDGVEGLQGVTVIAATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLD  907

Query  899  SDVNLTEIAQCTERFTGADLLGLLCSAQM  927
              V+    A  T  +TGAD+  +L SA M
Sbjct  908  ECVDFDWFAGKTANYTGADIQSILTSANM  936


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (1%)

Query  62   DDNIYFNKKFANSVDLQEKDIVHFDVVDANTLNTLSKVFFKTTPEDYVKMDTCSVKLEDT  121
            D  I  N + A  + L E D+V   ++ A+ LN  S      + +D+  ++  + K+  +
Sbjct  60   DTEIGINARAAKEIGLHENDLVKCALI-ADVLNLRSVHVTPVSSKDWEIIELSTEKISGS  118

Query  122  ILNQVRCVCKNSKLPIWINNQIVIFIFIDSLEPSCDFGLLQQDTELHFVP  171
            +L Q R V     L +WIN  + + + +D L+P  ++G +  +TEL   P
Sbjct  119  VLEQTRIVNSTQILIVWINKSMQVALTVDRLKPHMNYGRIDHNTELVVAP  168


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 11/211 (5%)

Query  745  QSGILLYGAPGTGKTLLASAISGECGLK-----FISIKGPELFSKFIGESEEGVRNIFNR  799
            Q  +LL GA GTGKT+L   I  +   K     F    G     +     ++ +RNIF  
Sbjct  477  QCNVLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLRNIFTS  536

Query  800  ARSIQPCILFFDEFDSLAAKRGNDSTG---VKDRVVNQLLTELDGVEGLEGVYVVGATSR  856
                 P I+  +  D LA   G  S+      +R+ + +   +        + V+   + 
Sbjct  537  CLQHAPAIVVLENLDVLAHAAGEQSSQDGEYYNRMADTVYQLIVQYTTNNAIAVIATVNE  596

Query  857  PDIIDPALLRP-GRLGSSVHCTMPDLK--EREDILSVLTQKLKLNSDVNLTEIAQCTERF  913
               ++  L  P GR        +P+L+  +RE IL  L   + +  D++L + +  TE +
Sbjct  597  LQTLNKRLSSPRGRHVFQTVARLPNLERADREIILRELCSHINVAKDLDLVKFSNLTEGY  656

Query  914  TGADLLGLLCSAQMLRQEYDEEKLKMNNDTL  944
               DL+  +  A        + +  + ND L
Sbjct  657  RKCDLVQFVERAIFYAYRISKTQPLLTNDQL  687


>Q386Y8_TRYB2 unnamed protein product
Length=706

 Score = 262 bits (670),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 181/580 (31%), Positives = 300/580 (52%), Gaps = 55/580 (9%)

Query  403  EEYVPVKQKVVQSEGGVLTSNLGAISTEKPFLNHLNQTLNTLVSQIRISVRSSYLYRD--  460
            EE  P +  V+    G+   ++G ++ E P +  L          I + +RS +L+    
Sbjct  117  EEDTPERLGVIP---GITLDDMGGLAREIPIIKEL----------IELPIRSPHLFSRLG  163

Query  461  -----NILVTGAEGSGKTTFCKTLQEALQNAGPDSIHCQVVDCKQMKSKIPNVVEKYLRD  515
                  +L+ G  G GKT     +  +LQ      +    V   ++ S I    E  LR+
Sbjct  164  ADPPCGVLLHGPPGCGKTKLVHAISGSLQ------VPLFFVSAPEIVSGISGDSEAKLRN  217

Query  516  VLSCACYMEPSCVILDDINILCSCNKESLDVAATTLCNKLCSLFVSLVHEF-QLNSSIVM  574
            +   A    PS V +D+++ +     ++     + +  +L +    +   + Q N  + +
Sbjct  218  LFLDAISAAPSIVFIDEVDTIAGRRDQAQRGMESRIVGQLLTCMDQVAQAWRQHNKVVCV  277

Query  575  VGVTSSRDIIKNT--KAGLVFSHCYSLPPLELDNRNLLLETLIQYKLKREHYNMNDIDIN  632
            +G T+  + +     +AG  F    SL    +D R+ +L+ + Q KL    +   D+D  
Sbjct  278  MGATNRPEALDTALRRAGR-FDREISLGIPTIDERHSILKIICQ-KL----HLAEDVDFF  331

Query  633  KVSKQCEGYT-------VQDMCDVVDKALFHYLHTKVDLEDNDASTPDTLKTNLFSTEDL  685
            +++    GY        V++ C +  +   + L  K  L+D +A   + L + + + +++
Sbjct  332  ELANMTPGYVGADLHLLVKEACILAIRQKHNELEEKNKLDDPNA---EELVSFVVTRDNM  388

Query  686  EEAFKSHVPLALK-GISSNAVEKINFSNVGGLKSAKQLLIETLVWPSMYPDLFSQCPLKP  744
            +EA K   P A++ G ++  +  + + ++G L+  ++ LI +++ P   P L  +  L  
Sbjct  389  KEAVKRVQPSAMREGFTT--IPNVTWDDIGALEDVREELITSILQPIRSPKLHRRFGLDH  446

Query  745  QSGILLYGAPGTGKTLLASAISGECGLKFISIKGPELFSKFIGESEEGVRNIFNRARSIQ  804
              G+LLYG PG GKTL+A AI+ + G  FISIKGPEL +KF+GESE  VR +F R R+  
Sbjct  447  PVGVLLYGPPGCGKTLVAKAIANQSGANFISIKGPELLNKFVGESERSVRMVFARGRASA  506

Query  805  PCILFFDEFDSLAAKRGNDSTG-VKDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPA  863
            PC+LFFDE D+LA +RG+D      +RVVNQLLTE+DGVEG E VYV+GAT+RPD+IDPA
Sbjct  507  PCVLFFDELDALAPRRGSDRANPSSERVVNQLLTEMDGVEGRESVYVIGATNRPDMIDPA  566

Query  864  LLRPGRLGSSVHCTMPDLKEREDILSVLTQKLKLNSDVNLTEIAQCTER---FTGADLLG  920
            +LRPGRL   ++  +P +++R  IL    ++  +++ V+L  IA+  ER   F+GADL  
Sbjct  567  MLRPGRLDKMLYVPLPSVEQRASILETHARRYPIDASVDLPSIAR-DERLQGFSGADLAA  625

Query  921  LLCSAQM--LRQEYDEEKLKMNNDTLSYTSSSAIGNKILP  958
            L+  A +  L+  Y     +M        S  A+ N  LP
Sbjct  626  LMREASLHALKNIYRGATEEMLEQMERDASGEAVANAQLP  665



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01680.1.1 General

Length=1975
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O16224_CAEEL  unnamed protein product                                 31.2    9.5  


>O16224_CAEEL unnamed protein product
Length=278

 Score = 31.2 bits (69),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query  510  QHLRLKQYSNSACEEFQQGNSISNSICGTPFKKLKLENKEVTDLNKTISQNSVNPDISIG  569
            +HL   Q  N  C+        +NSI G PFK L+ EN+  T +     ++S N  ++  
Sbjct  136  RHLHQLQDHNYQCQS-------TNSIRGQPFKSLQPENRTPTQVTGHQQESSANVSVAYH  188

Query  570  IL  571
            I+
Sbjct  189  II  190



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01690.1.1 Propionyl-CoA

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T131_DICDI  unnamed protein product                                 262     2e-85
MCCB_CAEEL  unnamed protein product                                   82.4    2e-18
MCCB_DROME  unnamed protein product                                   82.0    3e-18


>Q8T131_DICDI unnamed protein product
Length=553

 Score = 262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 145/179 (81%), Gaps = 0/179 (0%)

Query  10   RFSGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYA  69
              +GC+DI+A+VK+ARF+RFCD FNIPIVT IDVPGFLPG  QEH GIIRHG+KLLYAYA
Sbjct  375  ELAGCLDIDASVKAARFVRFCDCFNIPIVTLIDVPGFLPGTNQEHNGIIRHGAKLLYAYA  434

Query  70   ESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKS  129
            E+TVPKI++ITRKAYGGAY VMS K+LR D NY+WPT +IAVMGSKGAV I++R + D  
Sbjct  435  EATVPKISIITRKAYGGAYDVMSSKHLRGDTNYSWPTGQIAVMGSKGAVEIIFRGKGDIK  494

Query  130  NYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL  188
              E  YNDKF +P+ AA++G+IDDII PR +R  I +DL+ L NKK  NP KKHGNI L
Sbjct  495  EQEQIYNDKFANPLPAARRGFIDDIIPPRMSRQYICEDLEILKNKKLSNPTKKHGNIVL  553


>MCCB_CAEEL unnamed protein product
Length=608

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 87/179 (49%), Gaps = 16/179 (9%)

Query  12   SGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAES  71
            +G +   +A+K + FI  C    IP++   ++ GF+ G   E  GI +HG+KL+ A A +
Sbjct  418  NGVLFAESAMKGSHFIELCCQRKIPLLFLQNITGFMVGRDAEAGGIAKHGAKLVTAVACA  477

Query  72   TVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNY  131
             VPKITV+   +YG     M  +       + WP + I+VMG + A  +L   +K+K   
Sbjct  478  KVPKITVLVGGSYGAGNYGMCGRGYSPRYVFMWPNSRISVMGGEQAANVLSTVQKEKKKR  537

Query  132  E-VEYNDK----FRSPVA-----------AAKKGYIDDIIEPRTTRMRIAQDLKFLLNK  174
            E  ++ D+     R PV            A+ + + D +I+P+ TR  +    +  L K
Sbjct  538  EGADWTDQQDLELRKPVEEKFEKEGHPYFASARLWDDGVIDPKDTRKVLGLAFQSTLQK  596


>MCCB_DROME unnamed protein product
Length=578

 Score = 82.0 bits (201),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 87/186 (47%), Gaps = 16/186 (9%)

Query  4    HSSCLCRFSGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSK  63
            H+  +   +G +   +A+K A FI+ C    IP+V   ++ GF+ G   E  GI ++G+K
Sbjct  380  HTVGIVGNNGVLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAK  439

Query  64   LLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYR  123
            ++ A A + VPK TVI   +YG     M  +       Y WP + I+VMG   A  ++ +
Sbjct  440  MVTAVACANVPKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAANVMAQ  499

Query  124  KEKDK-----SNYEVEYNDKFRSPVA-----------AAKKGYIDDIIEPRTTRMRIAQD  167
              +D+       +  E   K ++P+            +  + + D II+P  TR  +   
Sbjct  500  ITEDQRKRAGKEFSEEEAQKLKAPIVEMFEAEGSPYYSTARLWDDGIIDPANTRQILGLS  559

Query  168  LKFLLN  173
            LK  LN
Sbjct  560  LKAALN  565



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01700.1.1 THAP

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJ27_DROME  unnamed protein product                                 38.9    0.008
Q8MRA9_DROME  unnamed protein product                                 33.5    0.42 
Q57YG9_TRYB2  unnamed protein product                                 31.2    2.0  


>Q9VJ27_DROME unnamed protein product
Length=762

 Score = 38.9 bits (89),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 39/81 (48%), Gaps = 16/81 (20%)

Query  1   MPT-CYAYNCNHD-SRKETCRFFRFP-QDQVLWKKWNEACRREKP--PSKWSVLCSCHFV  55
           MP  C   NC+H      +  F RFP + + L +KW E  +R     PSKWS LCS HF 
Sbjct  1   MPAHCAVINCSHKYVHAGSISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFG  60

Query  56  D------GNSKT-----VPSI  65
           D       N KT     VPSI
Sbjct  61  DEDFNCSNNRKTLKKNAVPSI  81


>Q8MRA9_DROME unnamed protein product
Length=518

 Score = 33.5 bits (75),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 37/177 (21%), Positives = 78/177 (44%), Gaps = 26/177 (15%)

Query  180  PSKAHFDILLGLISRYKVNYYDGWNVEKVSLEDQLFC------------TLVKLRLNLPL  227
            P ++  ++ LGL+ +  + +  G   + +SL  +  C            TL KL+ N   
Sbjct  203  PQRSMRNMTLGLVEQAPLLHL-GVAPQHLSLLKRHICRNANVTHLDCCLTLRKLKQNEHF  261

Query  228  FVLSMLFGVADATVHNIFLTFLNVMHKFLFTYMM--NKVPSKEKNKALSPACFATFPNAR  285
             +L+  F ++++ V + F   L  + ++L   +   +     E+ K       A   + R
Sbjct  262  ALLAEHFELSESDVEDTFKRTLIKLARYLRPLIRWPDARHHNERFKHTPLNYRANLLHVR  321

Query  286  IVLDCTEINIAVPSLLKSQKEVYSSYKHRHTFKALIGISPNAVITFVSDLYPGSMSD  342
             +++C E ++ +   L S            ++K ++ I+ N +I++VS  +PGS  D
Sbjct  322  SLIECVETDVPIDLGLGS-----------GSYKFILCINTNGIISYVSSAFPGSCDD  367


>Q57YG9_TRYB2 unnamed protein product
Length=881

 Score = 31.2 bits (69),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (47%), Gaps = 7/81 (9%)

Query  135  LEAEIYFLNKELAELRSKKKASESQVLFFNMIGDSDTKVAQYTGLPSKAHFDILLGLISR  194
            LE+E+  LNKELA+  ++   +E Q   FNM  +     A      SKA  D+   +  +
Sbjct  409  LESEVKRLNKELADANARADGAERQ---FNMTRNDLNNAATE---ASKARADVSEKIKEK  462

Query  195  YKV-NYYDGWNVEKVSLEDQL  214
              V       N EK+ LE QL
Sbjct  463  ADVEQQLAARNTEKLHLERQL  483



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01710.1.1 Major

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQH6_DROME  unnamed protein product                                 202     4e-59
Q9VU17_DROME  unnamed protein product                                 204     5e-59
TRET1_POLVA  unnamed protein product                                  202     9e-59


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 128/435 (29%), Positives = 218/435 (50%), Gaps = 30/435 (7%)

Query  73   ESPDLILSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLA  132
            E  D  +  +Q SW+GS + L      I  G+ +  IGRK  M+ +  PF LGW +L  A
Sbjct  48   EGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWA  107

Query  133  ETVSIIMLGTVCMGLSVG--CCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLI  190
              VS++      +G++ G  C  AP+  Y GEI++  +RG+L  F       G+  ++ +
Sbjct  108  VNVSMLYASRFILGIAGGAFCVTAPM--YTGEIAQKEIRGTLGSFFQLMITIGILFVYAV  165

Query  191  YALTDWRTTVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVR  250
             A        +I  I P++   +  F+PESPT+LVSK R E A +S++W+RG  K++   
Sbjct  166  GAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRG--KEYDYE  223

Query  251  VEFEQLVKDTNSATLYVADSEYTTDQRKSSQLSKLLNYLVRPEIVRPFIMIMILFFITII  310
             E  +L +               TD+   +    +   L RP   +   + M L F   +
Sbjct  224  PELAELRE---------------TDRETKANKVNVWAALNRPVTRKALAISMGLMFFQQV  268

Query  311  ASLQPMRPFLVEIFRTFGLPMKSEWVLVLTGILSITGSFVSTITVNKLGKR--------G  362
              +  +  +   IF      +++EW  +L GI+ +  +FVST+ V+KLG+R         
Sbjct  269  CGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGIS  328

Query  363  MTLWSTGINTFFTLMLSICAMNLQWPGWIPLTIFCTCFWVSGYGMLPLPWMLLSEVFPLQ  422
            M + +T I  +F L     A  +   GW+P+   C    +   G  P+PW+++ E+F   
Sbjct  329  MAISTTAIGVYFFLQKQDAAQVVSL-GWLPVASLCLFIIMFSIGYGPVPWLMMGELFATD  387

Query  423  VRGIASGITAASSSVVNFISTKTYINLTSWFGLHGTLFIYTLVSFLGFIYIYFYVPETED  482
            ++G A  +   S+ ++ F+ TKT++NL    G+ GT +++  ++ +G I++YF VPET+ 
Sbjct  388  IKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKG  447

Query  483  RTLQEILDFFAENKS  497
            ++L EI    A N+S
Sbjct  448  KSLNEIQQELAGNRS  462


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/435 (29%), Positives = 218/435 (50%), Gaps = 30/435 (7%)

Query  73   ESPDLILSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLA  132
            E  D  +  +Q SW+GS + L      I  G+ +  IGRK  M+ +  PF LGW +L  A
Sbjct  116  EGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWA  175

Query  133  ETVSIIMLGTVCMGLSVG--CCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLI  190
              VS++      +G++ G  C  AP+  Y GEI++  +RG+L  F       G+  ++ +
Sbjct  176  VNVSMLYASRFILGIAGGAFCVTAPM--YTGEIAQKEIRGTLGSFFQLMITIGILFVYAV  233

Query  191  YALTDWRTTVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVR  250
             A        +I  I P++   +  F+PESPT+LVSK R E A +S++W+RG  K++   
Sbjct  234  GAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRG--KEYDYE  291

Query  251  VEFEQLVKDTNSATLYVADSEYTTDQRKSSQLSKLLNYLVRPEIVRPFIMIMILFFITII  310
             E  +L +               TD+   +    +   L RP   +   + M L F   +
Sbjct  292  PELAELRE---------------TDRETKANKVNVWAALNRPVTRKALAISMGLMFFQQV  336

Query  311  ASLQPMRPFLVEIFRTFGLPMKSEWVLVLTGILSITGSFVSTITVNKLGKR--------G  362
              +  +  +   IF      +++EW  +L GI+ +  +FVST+ V+KLG+R         
Sbjct  337  CGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGIS  396

Query  363  MTLWSTGINTFFTLMLSICAMNLQWPGWIPLTIFCTCFWVSGYGMLPLPWMLLSEVFPLQ  422
            M + +T I  +F L     A  +   GW+P+   C    +   G  P+PW+++ E+F   
Sbjct  397  MAISTTAIGVYFFLQKQDAAQVVSL-GWLPVASLCLFIIMFSIGYGPVPWLMMGELFATD  455

Query  423  VRGIASGITAASSSVVNFISTKTYINLTSWFGLHGTLFIYTLVSFLGFIYIYFYVPETED  482
            ++G A  +   S+ ++ F+ TKT++NL    G+ GT +++  ++ +G I++YF VPET+ 
Sbjct  456  IKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKG  515

Query  483  RTLQEILDFFAENKS  497
            ++L EI    A N+S
Sbjct  516  KSLNEIQQELAGNRS  530


>TRET1_POLVA unnamed protein product
Length=504

 Score = 202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 123/454 (27%), Positives = 235/454 (52%), Gaps = 33/454 (7%)

Query  48   GMAFGMPTVVVGVLDHKVASNQTKLESPDLI---LSDEQSSWLGSILFLFHPFGSIISGY  104
             +A  M ++VVG      +     +++  +    ++++++SW+G I+ L    G I  G 
Sbjct  47   AIAVSMGSMVVGFASAYTSPALVSMQNTTITSFKVTEQEASWVGGIMPLAGLAGGIAGGP  106

Query  105  FLEYIGRKRLMILVGFPFFLGWILLYLAETVSIIMLGTVCMGLSVGCCEAPIISYIGEIS  164
            F+EY+GRK  ++    PF + W+L+  A ++ +++ G    G  VG     +  Y+GE  
Sbjct  107  FIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYLGETV  166

Query  165  EPRMRGSLSLFAGAACNFGVFIIFLIYALTDWRTTVLISAIFPILTMIMIAFIPESPTWL  224
            +P +RG+L L   A  N G+ I F+     +W     I +I PI  M++   IPE+P W 
Sbjct  167  QPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPETPRWF  226

Query  225  VSKGRLEEAERSLRWVRGWSKKHKVRVEFEQLVKDTNSATLYVADSEYTTDQRKSSQLSK  284
            V++GR E A ++L+W+RG  KK  V  E + +VK    A            +R +SQ + 
Sbjct  227  VTRGREERARKALQWLRG--KKADVEPELKGIVKSHCEA------------ERHASQ-NA  271

Query  285  LLNYLVRPEIVRPFIMIMILFFITIIASLQPMRPFLVEIFRTFGLPMKSEWVLVLTGILS  344
            + + + R  + +P ++ + L F   ++ +  +  + V IF+  G  +      ++ G+++
Sbjct  272  IFDLMKRSNL-KPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVN  330

Query  345  ITGSFVSTITVNKLGKR--------GMTLWSTGINTFFTLMLSICAMNLQWPGWIPLTIF  396
               +F +T+ +++LG++         M +    + TFF    S    ++   GW+PL  F
Sbjct  331  FGATFFATVLIDRLGRKILLYISEVAMVITLLTLGTFFYYKNS--GNDVSNIGWLPLASF  388

Query  397  CTCFWVSGY--GMLPLPWMLLSEVFPLQVRGIASGITAASSSVVNFISTKTYINLTSWFG  454
                +V G+  G+ P+PW++L E+ P ++RG A+ +    +    FI TKT+ ++ +  G
Sbjct  389  --VIYVIGFSSGVGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADIVAAIG  446

Query  455  LHGTLFIYTLVSFLGFIYIYFYVPETEDRTLQEI  488
             HG  + + ++  +G  ++ F+VPET+ ++L+EI
Sbjct  447  NHGAFWFFGVICLIGLFFVIFFVPETQGKSLEEI  480



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01720.1.1 Major

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_BOMMO  unnamed protein product                                  122     1e-31
TRET1_POLVA  unnamed protein product                                  116     1e-29
TRET1_APILI  unnamed protein product                                  112     3e-28


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 98/178 (55%), Gaps = 4/178 (2%)

Query  77   LILSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLAETVS  136
            L ++ E+ +W+G ++ L    G I+ G  +EY+GRK+ ++    PF +GW+L+  A  V 
Sbjct  83   LDITKEEITWVGGLMPLAALVGGIVGGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVV  142

Query  137  IIMLGTVCMGLSVGCCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLIYALTDW  196
            ++  G V  G+ VG        YIGE  +P +RG+L L   A  N G+ + FL+ +  DW
Sbjct  143  MVFAGRVICGVCVGIVSLAFPVYIGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDW  202

Query  197  RTTVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVRVEFE  254
                   A  P+   +++   PE+P W VSK R++EA +SLRW+RG      V +E E
Sbjct  203  SNLAFFGAAIPVPFFLLMILTPETPRWYVSKARVQEARKSLRWLRG----KNVNIEKE  256


>TRET1_POLVA unnamed protein product
Length=504

 Score = 116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 99/176 (56%), Gaps = 2/176 (1%)

Query  79   LSDEQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLAETVSII  138
            ++++++SW+G I+ L    G I  G F+EY+GRK  ++    PF + W+L+  A ++ ++
Sbjct  81   VTEQEASWVGGIMPLAGLAGGIAGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMV  140

Query  139  MLGTVCMGLSVGCCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLIYALTDWRT  198
            + G    G  VG     +  Y+GE  +P +RG+L L   A  N G+ I F+     +W  
Sbjct  141  LAGRALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSG  200

Query  199  TVLISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRGWSKKHKVRVEFE  254
               I +I PI  M++   IPE+P W V++GR E A ++L+W+RG  KK  V  E +
Sbjct  201  LAFIGSILPIPFMVLTLLIPETPRWFVTRGREERARKALQWLRG--KKADVEPELK  254


>TRET1_APILI unnamed protein product
Length=502

 Score = 112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 93/161 (58%), Gaps = 0/161 (0%)

Query  82   EQSSWLGSILFLFHPFGSIISGYFLEYIGRKRLMILVGFPFFLGWILLYLAETVSIIMLG  141
            + + W+GSI+ L    G II G  +EYIGR+  ++    PF  GW+ + LA  V++I++G
Sbjct  83   DMAMWIGSIMPLSALIGGIIGGPCIEYIGRRNTILSTALPFLAGWLFIALATNVAMILVG  142

Query  142  TVCMGLSVGCCEAPIISYIGEISEPRMRGSLSLFAGAACNFGVFIIFLIYALTDWRTTVL  201
                G  VG     +  Y+GE  +P +RGSL L      N G+ + F       WR   L
Sbjct  143  RSICGFCVGVASLSLPVYLGESIQPEVRGSLGLLPTVFGNSGILMCFTAGMYLAWRNLAL  202

Query  202  ISAIFPILTMIMIAFIPESPTWLVSKGRLEEAERSLRWVRG  242
            + A  PI+ +I++  IPE+P W +SKG+++EA +SL+W+RG
Sbjct  203  LGACIPIIFLILMFLIPETPRWYISKGKIKEARKSLQWLRG  243



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01730.1.1 Dipeptidase

Length=394
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389F8_TRYB2  unnamed protein product                                 31.6    1.2  
M9PCG1_DROME  unnamed protein product                                 31.2    1.7  
M9PCU4_DROME  unnamed protein product                                 31.2    1.7  


>Q389F8_TRYB2 unnamed protein product
Length=348

 Score = 31.6 bits (70),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (59%), Gaps = 2/51 (4%)

Query  334  NTEDLKKLAGLNFLRVLKEVEKVKDDMARSGAEPFEDNIATKYLKGRTNCT  384
            N +D+KKL+G    R L E+ + +D++ R   + F +++   Y +GR  CT
Sbjct  10   NVQDVKKLSGT--CRFLWELLRPRDNVWRVQLDYFREDMKNLYGEGRLLCT  58


>M9PCG1_DROME unnamed protein product
Length=496

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 28/40 (70%), Gaps = 4/40 (10%)

Query  216  VQTMQAALDTSKAPVVFSHSSARALCNSSRNVPDHILAKL  255
            +Q++++ L+TS++PV +S++ ARA      N+P+HI   L
Sbjct  50   LQSIRSKLNTSQSPVTWSYNFARAYA----NLPEHIRVPL  85


>M9PCU4_DROME unnamed protein product
Length=489

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 28/40 (70%), Gaps = 4/40 (10%)

Query  216  VQTMQAALDTSKAPVVFSHSSARALCNSSRNVPDHILAKL  255
            +Q++++ L+TS++PV +S++ ARA      N+P+HI   L
Sbjct  50   LQSIRSKLNTSQSPVTWSYNFARAYA----NLPEHIRVPL  85



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01740.1.1 Phosphoglycerate

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PGK_DROME  unnamed protein product                                    647     0.0  
PGK_SCHMA  unnamed protein product                                    601     0.0  
PGK_DICDI  unnamed protein product                                    546     0.0  


>PGK_DROME unnamed protein product
Length=415

 Score = 647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/414 (76%), Positives = 357/414 (86%), Gaps = 0/414 (0%)

Query  1    MALNKLSVDLLNLAGKRVLMRVDFNVPMKEGKITNNQRIVAALDTIKYALDKGAKSVVLM  60
            MA NKLS++ L+LAGKRVLMRVDFNVP+KEGKIT+NQRIVAALD+IK AL K AKSVVLM
Sbjct  1    MAFNKLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKSVVLM  60

Query  61   SHLGRPDGSKNLKYSLKPVAEELKTLLKKDITFLDDCVGPKVEEACADPPAGSIILLENL  120
            SHLGRPDG+KN+KY+L PVA ELKTLL +D+ FL DCVG +VE AC DP  GS+ILLEN+
Sbjct  61   SHLGRPDGNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGSEVEAACKDPAPGSVILLENV  120

Query  121  RFYVEEEGKGVNAAGEKVKASAEDVKKFRESLRKLGDIYVNDAFGTAHRAHSSMLGEGFE  180
            RFYVEEEGKG++A+G KVKA    VK+FR SL KLGD+YVNDAFGTAHRAHSSM+G+GFE
Sbjct  121  RFYVEEEGKGLDASGGKVKADPAKVKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFE  180

Query  181  QRASGFLLKKELDYFSKALDNPEKPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMSY  240
            QRA+G LL KEL YFS+ALD P  PFLAILGGAKVADKIQLIENLLDKVNEMIIGGGM++
Sbjct  181  QRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAF  240

Query  241  TFLKELKGMNIGGSLYDPEGAKIVKKLVEKAEKNNVKLHFPVDFITADKFAEDAKTGEAT  300
            TFLK L  M IGGSL+D EG+KIV+KLVEKA+KNNV+LH PVDF+  DKFAE+A   EAT
Sbjct  241  TFLKVLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAVSEAT  300

Query  301  VESGVPDGWMGLDIGPKSRELFKEPIARAKVIVWNGPSGVFEFENFAKGTKGIMDAVVDV  360
            VE+G+PDG MGLD+GPK+RELF  PIARAK+IVWNGP GVFEF NFA GTK IMD VV  
Sbjct  301  VEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVAA  360

Query  361  TTKGAITIIGGGDTATCAAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN  414
            T  G ++IIGGGDTA+C AKWNTE  VSHVSTGGGASLELLEGK LPGV AL++
Sbjct  361  TKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTS  414


>PGK_SCHMA unnamed protein product
Length=416

 Score = 601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/414 (70%), Positives = 342/414 (83%), Gaps = 0/414 (0%)

Query  1    MALNKLSVDLLNLAGKRVLMRVDFNVPMKEGKITNNQRIVAALDTIKYALDKGAKSVVLM  60
            M L+KLS+  ++L GKRVL+RVDFNVPMK+GK+TN QRI AA+ TIKYALDKGAKSVVLM
Sbjct  1    MGLSKLSISDVDLKGKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKSVVLM  60

Query  61   SHLGRPDGSKNLKYSLKPVAEELKTLLKKDITFLDDCVGPKVEEACADPPAGSIILLENL  120
            SHLGRPDG K  KYSLKPV  E+  LL K++TFL+DCVGP V  ACA+P  GS+ LLENL
Sbjct  61   SHLGRPDGHKVDKYSLKPVCPEVSKLLGKEVTFLNDCVGPDVVNACANPAPGSVFLLENL  120

Query  121  RFYVEEEGKGVNAAGEKVKASAEDVKKFRESLRKLGDIYVNDAFGTAHRAHSSMLGEGFE  180
            RF+VEEEGKGV+  GEK KA+A+ +K F ESL KLGD+YVNDAFGTAHRAH+SM+G    
Sbjct  121  RFHVEEEGKGVSPTGEKTKATADQIKAFSESLTKLGDVYVNDAFGTAHRAHASMVGCQLP  180

Query  181  QRASGFLLKKELDYFSKALDNPEKPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMSY  240
            Q+A GFL+ KEL YF+KAL+NPE+PFLAILGGAKV+DKIQLI N+LDKVNE+IIGGGM+Y
Sbjct  181  QKACGFLMNKELTYFAKALENPERPFLAILGGAKVSDKIQLINNMLDKVNELIIGGGMAY  240

Query  241  TFLKELKGMNIGGSLYDPEGAKIVKKLVEKAEKNNVKLHFPVDFITADKFAEDAKTGEAT  300
            TFLK++  M+IG SL+D  GA+IV K++E A+  NV +H PVDF+TADKFA+DA T   T
Sbjct  241  TFLKQIHNMHIGNSLFDAPGAEIVHKVMETAKAKNVAIHLPVDFVTADKFADDANTEIRT  300

Query  301  VESGVPDGWMGLDIGPKSRELFKEPIARAKVIVWNGPSGVFEFENFAKGTKGIMDAVVDV  360
            ++SG+ DGWMGLDIGPK+ E F + I+RAK IVWNGP GVFE + FA GTK  MD VV  
Sbjct  301  IQSGIADGWMGLDIGPKTIEEFSKVISRAKTIVWNGPMGVFEMDKFATGTKAAMDEVVKA  360

Query  361  TTKGAITIIGGGDTATCAAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN  414
            T  GA TIIGGGDTATC AKW+TEDKVSHVSTGGGASLELLEGK LPGV AL++
Sbjct  361  TKNGATTIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKQLPGVVALTD  414


>PGK_DICDI unnamed protein product
Length=420

 Score = 546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/412 (65%), Positives = 331/412 (80%), Gaps = 1/412 (0%)

Query  4    NKLSVDLLNLAGKRVLMRVDFNVPM-KEGKITNNQRIVAALDTIKYALDKGAKSVVLMSH  62
            NKLS+D +++ GKRVL+RVD+NVP+ K   IT+ QRI A++ T++Y L  GAKS+VLMSH
Sbjct  8    NKLSLDKVDVKGKRVLIRVDYNVPLDKNNNITSTQRIDASIPTLEYCLKNGAKSIVLMSH  67

Query  63   LGRPDGSKNLKYSLKPVAEELKTLLKKDITFLDDCVGPKVEEACADPPAGSIILLENLRF  122
            LGRPDG    +YSLKPV + L+  LK+ I FL DCVG +VE+ CA+P  G++ILLENLRF
Sbjct  68   LGRPDGLVKPEYSLKPVVKVLEDQLKRPIKFLSDCVGEQVEKECANPEEGTVILLENLRF  127

Query  123  YVEEEGKGVNAAGEKVKASAEDVKKFRESLRKLGDIYVNDAFGTAHRAHSSMLGEGFEQR  182
            ++EEEG GV+A G+KVKA+ E VK+FRESL KLGD+YVNDAFGTAHRAHSSM+G    Q+
Sbjct  128  HIEEEGSGVDAEGKKVKANPEKVKEFRESLTKLGDVYVNDAFGTAHRAHSSMVGINLPQK  187

Query  183  ASGFLLKKELDYFSKALDNPEKPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMSYTF  242
            A+GFL+KKEL+YF+KAL++P KPFLAILGGAKV+DKI+LIENLL KV+EMIIGGGM++TF
Sbjct  188  AAGFLMKKELEYFAKALESPSKPFLAILGGAKVSDKIKLIENLLYKVDEMIIGGGMAFTF  247

Query  243  LKELKGMNIGGSLYDPEGAKIVKKLVEKAEKNNVKLHFPVDFITADKFAEDAKTGEATVE  302
             K +    IG SL++    +I K ++ KA KNNVKLHFPVD++ ADKF  DA     T +
Sbjct  248  KKFIDNKEIGSSLFEKTAEQITKDIIAKAAKNNVKLHFPVDYVIADKFDNDANIKTVTQD  307

Query  303  SGVPDGWMGLDIGPKSRELFKEPIARAKVIVWNGPSGVFEFENFAKGTKGIMDAVVDVTT  362
             G+P+GWMGLD GP++ +  ++ I+RAK IVWNGP GVFE  NF  GTK  MD VV+ TT
Sbjct  308  QGIPEGWMGLDCGPETIKENRDTISRAKTIVWNGPMGVFEKSNFEAGTKAAMDDVVNATT  367

Query  363  KGAITIIGGGDTATCAAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN  414
             GAITIIGGGDTATCAAK+NTEDKVSHVSTGGGASLELLEGK LPGV ALS+
Sbjct  368  NGAITIIGGGDTATCAAKYNTEDKVSHVSTGGGASLELLEGKELPGVTALSD  419



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01750.1.1 Aspartate--tRNA

Length=464
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SYK_CAEEL  unnamed protein product                                    72.0    3e-13
Q580G3_TRYB2  unnamed protein product                                 68.2    5e-12
Q7K0E6_DROME  unnamed protein product                                 67.4    8e-12


>SYK_CAEEL unnamed protein product
Length=572

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 77/138 (56%), Gaps = 3/138 (2%)

Query  10   EDLRLKHRYLDFRF-PEMQHNLRFRSKFLMRTREFLATHRDFVEVETPTLFKRTPGG-AR  67
            ++LR + RYLD    P ++ N   RSK +   R +L  +  F+EVETP + +   G  A+
Sbjct  202  KELRFRKRYLDLILNPRVKDNFVIRSKIITFLRRYL-DNLGFLEVETPIMNQIAGGATAK  260

Query  68   EFVVPTHEPNKFYSLVQSPQQLKQLLMVGSVDRYFQIARCYRDESTRPDRQPEFTQLDIE  127
             F+   ++ +    L  +P+   ++L+VG +DR +++ R +R+E       PEFT  +  
Sbjct  261  PFITHHNDLDMNLFLRVAPELYHKMLVVGGIDRVYEVGRLFRNEGIDLTHNPEFTTCEFY  320

Query  128  LSFTTRDDVMRLIEELLC  145
            +++   +DV++L E+LL 
Sbjct  321  MAYADYEDVIQLTEDLLS  338


 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)

Query  403  AFKYGCPPHGGIALGIDRLMSILCGTQSIRDVIAFP  438
            A +YG PP GG  +GIDRL  IL    +I++V+ FP
Sbjct  516  ALEYGLPPTGGWGMGIDRLSMILTDNNNIKEVLLFP  551


>Q580G3_TRYB2 unnamed protein product
Length=584

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 78/166 (47%), Gaps = 20/166 (12%)

Query  13   RLKHRYLDFRFP-EMQHNLRFRSKFLMRTREFLATHRDFVEVETPTLFKRTPGGA-REFV  70
            R + RYLD     E       RSK +   R F    +DF+EVETP L +   G A R F+
Sbjct  212  RFRQRYLDLIVNRENAKTFILRSKIISYIRSFF-DQKDFLEVETPMLNQIAGGAAARPFI  270

Query  71   VPTHEPNKFYSLVQSPQQLKQLLMVGSVDRYFQIARCYRDESTRPDRQPEFTQLDIELSF  130
               +E N+   L  +P+   + L+VG +DR ++I + +R+E       PEFT ++   ++
Sbjct  271  THHNELNQTMYLRIAPELYLKKLVVGGLDRVYEIGKQFRNEGIDLTHNPEFTSVESYWAY  330

Query  131  TTRDDVMRLIEELLCYCLNIPTRTFSRISYNDAISLYGSDKPDLRY  176
               +D M   EELL               Y   + LYGS  P ++Y
Sbjct  331  ADYNDWMETTEELL---------------YGMVMHLYGS--PIVKY  359


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)

Query  401  IQAFKYGCPPHGGIALGIDRLMSILCGTQSIRDVIAFP  438
            +QA +Y  PP GG  LGIDRL+  L    +I++V+ FP
Sbjct  521  VQALEYALPPTGGWGLGIDRLVMYLTSQNNIKEVLLFP  558


>Q7K0E6_DROME unnamed protein product
Length=531

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 66/128 (52%), Gaps = 24/128 (19%)

Query  315  FWVVD-FPLFLPSDSGTLESAHHPF-TQPHPEDEHLLSSNPLEVRGLHYDLVLNGNEIGG  372
            F+++D FPL           A  PF T P P       +NP  V    YD+ + G EI  
Sbjct  418  FYILDKFPL-----------AIRPFYTMPDP-------NNP--VYSNSYDMFMRGEEILS  457

Query  373  GSIRIHSSE-LQESILHFLNIETSSLQHMIQAFKYGCPPHGGIALGIDRLMSILCGTQSI  431
            G+ RIH  E L E   H   I+TS +   I++F+YGCPPH G  +G++R++ +  G  +I
Sbjct  458  GAQRIHDPEYLIERAKHH-GIDTSKIAAYIESFRYGCPPHAGGGIGMERVVMLYLGLDNI  516

Query  432  RDVIAFPK  439
            R    FP+
Sbjct  517  RKTSMFPR  524


 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 5/129 (4%)

Query  4    LLFQAKEDLRLKHRYLDFRFPEMQHNLRFRSKFLMRTREFLATHRDFVEVETPTLF-KRT  62
            L  +  +D RL +R LD R P  Q   R  +      R+ L T + F E+ TP +    +
Sbjct  200  LNIRVNQDTRLDNRVLDLRTPANQAIFRLEAGVCRLFRDIL-TEQGFTEIHTPKIISAAS  258

Query  63   PGGAREFVVPTHEPNKFYSLVQSPQQLKQLLMVGSVDRYFQIARCYRDESTRPDRQ-PEF  121
             GGA  F V   + + +  L QSPQ  KQ+ +    D+ + +   +R E +   R   EF
Sbjct  259  EGGANVFTVSYFKDSAY--LAQSPQLYKQMAIAADFDKVYTVGAVFRAEDSNTHRHLTEF  316

Query  122  TQLDIELSF  130
              LD+E++F
Sbjct  317  VGLDLEMAF  325



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01760.1.1 Unknown

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NAA80_DROME  unnamed protein product                                  30.0    3.1  
M9PG82_DROME  unnamed protein product                                 30.4    5.0  
Q9VPB0_DROME  unnamed protein product                                 30.0    5.4  


>NAA80_DROME unnamed protein product
Length=178

 Score = 30.0 bits (66),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 0/47 (0%)

Query  55   YLFGSDEDSFFYRRVHEYVVSMLMVHNVSCELFSQLDYRCTYIKYIL  101
            YL   D+D F+ R  +EY   + M     CEL S  + +  Y+K +L
Sbjct  132  YLSTIDQDGFYERIGYEYCAPITMYGPRHCELPSLQNAKKKYMKKVL  178


>M9PG82_DROME unnamed protein product
Length=924

 Score = 30.4 bits (67),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 8/66 (12%)

Query  421  VHSDIHNVISKLFIFNKRLRQENVLNSRSCYIKIRKCYNLNQYLLCKNFEQLN----QIY  476
            V S++H   S+LF+  +RL    +L S S   KI K  N+N+  L K  +Q++    ++Y
Sbjct  821  VSSEVH---SRLFLMGERLFATELLESNSFVDKICKARNVNEMALAK-AKQISTSSAEMY  876

Query  477  KCLKEV  482
            + LK++
Sbjct  877  RTLKKL  882


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 30.0 bits (66),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 8/66 (12%)

Query  421  VHSDIHNVISKLFIFNKRLRQENVLNSRSCYIKIRKCYNLNQYLLCKNFEQLN----QIY  476
            V S++H   S+LF+  +RL    +L S S   KI K  N+N+  L K  +Q++    ++Y
Sbjct  823  VSSEVH---SRLFLMGERLFATELLESNSFVDKICKARNVNEMALAK-AKQISTSSAEMY  878

Query  477  KCLKEV  482
            + LK++
Sbjct  879  RTLKKL  884



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01770.1.1 Pogo

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UP2_TRYB2  unnamed protein product                                 33.9    0.52 
CAS_DROME  unnamed protein product                                    30.4    6.3  


>Q57UP2_TRYB2 unnamed protein product
Length=507

 Score = 33.9 bits (76),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 49/113 (43%), Gaps = 22/113 (19%)

Query  398  AVFTNDDFMSSEV----TYRP--DHQSTSAARPLVPSTSSSILVPPVDVST---------  442
            A  T  D  SSE      YRP  D  S+ A +P V   SS    PP D S+         
Sbjct  299  AATTARDETSSEKPAAGAYRPPIDKPSSGAYKPPVDKPSSGAYKPPTDKSSLGAYEPPSE  358

Query  443  -SAARPLVPSTSSSILVSPVDVSTSAARPLVPSTSSSILVPPVD-VSTSAARP  493
              A+ P VP+ SS+     V  ST A RP      + +  PPVD  ST A RP
Sbjct  359  KPASVPAVPAESSA-----VKPSTGAYRPPTDKPPTGVYKPPVDKPSTGAYRP  406


>CAS_DROME unnamed protein product
Length=793

 Score = 30.4 bits (67),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  450  PSTSSSILVSPVDVSTSAARPLVPSTSSSILVPPVDVSTSAARPLVPSTSSSIL  503
            P+ SS  L++PVD   +   PL P+ + S+L PP   S+  ++ LV  +++S L
Sbjct  291  PADSSYGLITPVDSDLTPNTPLQPTQTISLLTPP---SSEQSKSLVSLSAASGL  341



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01780.1.1 SprT-like

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXU6_DROME  unnamed protein product                                 124     1e-32
SPRTN_CAEEL  unnamed protein product                                  100     4e-25
Q8IB78_PLAF7  unnamed protein product                                 30.0    1.4  


>Q9VXU6_DROME unnamed protein product
Length=724

 Score = 124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 112/202 (55%), Gaps = 27/202 (13%)

Query  8    DPDFFLALTLQKKFNEEYKKEKDAKGSSSNL-------FESLTTKSSQDTIPSPVRKKPN  60
            D D+  AL LQ + N E  +   A  +S++         ++L  +  +D          +
Sbjct  3    DADYLFALNLQNQLNAESDQSYTAADASNDRDYQLARRIQNLINEGDED---GASELDSS  59

Query  61   ISSIHKPNTEPSSSVMKPTSSSSLASRSSNNQRPS-----------SQTMSLNDSQWEVI  109
            I  ++  + +P S+ M+  S      R +  ++P            ++TM+L D +WE++
Sbjct  60   IQFVYPKSNQPKSTKME-NSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELV  118

Query  110  DPTPDIHGLFVAFAKRFFQDRLGSVEVKWSKRMTSCAGVCRFKGRRDRSGRGIGEVTISL  169
            DPTPDI+ +F+ F ++FFQ+RLG+V ++WSK+M SCAG+C  +G      R + +VTI L
Sbjct  119  DPTPDIYAMFIRFDEKFFQERLGAVSLEWSKKMYSCAGICYQRG-----NRFVKQVTIRL  173

Query  170  SEPLLKLRPRSDLVNTLLVSNI  191
            SEPLLKLRPR DLV TLL   I
Sbjct  174  SEPLLKLRPRKDLVETLLHEMI  195


>SPRTN_CAEEL unnamed protein product
Length=368

 Score = 100 bits (249),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 66/107 (62%), Gaps = 10/107 (9%)

Query  100  SLNDSQWEVIDPTPDIHGLFVAFAKRFFQDRLGSVEVKWSKRMTSCAGVCRFKGRRDRSG  159
            SL D  +E+ DP PDIH LF+ F  RFF   L   EVKWS RM +CAG+C ++    R G
Sbjct  5    SLVDPSFELSDPCPDIHALFIQFDARFFGGSLACCEVKWSPRMYACAGICSYE---IRGG  61

Query  160  RGIGEVTISLSEPLLKLRPRSDLVNTLLVSNIWSKSKQCVYVTVKVR  206
            RG G  +I LS+PLL LRPRSDLV TLL   I +      Y+ VK R
Sbjct  62   RG-GLCSIRLSKPLLTLRPRSDLVETLLHEMIHA------YLFVKER  101


>Q8IB78_PLAF7 unnamed protein product
Length=585

 Score = 30.0 bits (66),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 1/64 (2%)

Query  19   KKFNEEYKKEKDAKGSSSNLFESLTTKSSQDTIPSPVRKKPNISSIHKPNTEPSSSVMKP  78
            K + EE K  K+++  S   +ES+T K SQ+ I  P+     I      NTE   S+ K 
Sbjct  264  KIYTEERKNNKNSRDDSYKYYESITEKKSQN-ISYPININSIIYESKTENTESKYSLTKN  322

Query  79   TSSS  82
             S+S
Sbjct  323  DSNS  326



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


Query= Dcitr00g01790.1.1 Nose

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IR42_DROME  unnamed protein product                                 144     1e-35
Q9U6W3_DROME  unnamed protein product                                 75.1    3e-14
Q389C9_TRYB2  unnamed protein product                                 53.9    4e-07


>Q8IR42_DROME unnamed protein product
Length=827

 Score = 144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/434 (26%), Positives = 192/434 (44%), Gaps = 44/434 (10%)

Query  43   AANSTLNTECTRQSRIYLDHLDNNTHWAIRMLDASLVAPTGLIAGDTIQYGSPDQCIHTH  102
            A N   +T C RQ   +L+ LDN   WA++M D+S    +G++ G+  Q G  DQC+   
Sbjct  145  ARNPDASTLCRRQMHQFLNALDNFDLWALKMHDSSGKLNSGILNGNINQPGDFDQCLGIQ  204

Query  103  IPLPN-------------IRPKYCLPTAQYSPSRAIYPDYYANRTLYGPPYDMEKNVWDF  149
              +               IR +YCL  AQ        P    N       + + ++   F
Sbjct  205  QRMNQDQDAGQDQDGDSIIRGQYCLAYAQ--------PVLPHNSKRLKSFFKLIQSHGPF  256

Query  150  FTPMSD-FIRYPRHKF-SWGVCVPEVCTAQDIQHSLAQSLTTAFAKHQINFDVSLTELGC  207
             +  +D   R PR+   +WG+CVP  C+A+D+++S+A+ L    A   I F+V +    C
Sbjct  257  KSEFNDPGHRVPRYSLINWGLCVPSGCSARDVEYSVAEYLGNQTASTGITFNVRVEPQMC  316

Query  208  YSEAEME-SRRLPLAGYLWVCICVVLVLLCIAGTAVEYQDIHGTDTNLNKEEPAKPGHIK  266
                +    R    A   ++ +  V VL  I   + + Q          K+ P       
Sbjct  317  QVRDQRPWDRNTTWAVRFFLLVLSVAVLSTIYDRSTKSQP---------KQNP-------  360

Query  267  SFLSIFSLIRNTRKLCRMDKNPSSIVVIDGMKGFLMAIFIMFHRAMFSMGFA--KNLEVY  324
             + + FSL +N R L      P  I  + G++ FL AI ++F     +M F    N    
Sbjct  361  -WFTAFSLDKNLRWLFSTSSAPGDIEAVHGIR-FLNAIMLIFSHKSMAMFFNPYNNRTAM  418

Query  325  EQALHNIEYFWLSSGTHMLDTFFFISGFLLAWGIIQKLNKNRTLNYSTMILNRVVRMYPM  384
             ++L         + +   D F   SG L ++ +  +L K + +      ++R++R+ P 
Sbjct  419  SESLGQPWTVIGRAASLYTDPFLLFSGMLTSYSLFGRLMKQQPIRLKNEYISRLMRIVPP  478

Query  385  YILIIAFTIWVLPYVGEGPMWKPYAEAESQYCKQSWWQNLLFVSTLNDYGDLCIASSWYV  444
               +I F  +VLP  G GP W       +  CK++WW+NLLF+     + ++C+  + ++
Sbjct  479  LAALILFCTYVLPLWGSGPQWNLVVGHHADICKKNWWRNLLFIHNYFGFSEMCLTHTHHL  538

Query  445  STDFQLFLISLVLI  458
              D +LF ++ +LI
Sbjct  539  GIDTELFAVAPLLI  552


>Q9U6W3_DROME unnamed protein product
Length=377

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 62/115 (54%), Gaps = 0/115 (0%)

Query  344  DTFFFISGFLLAWGIIQKLNKNRTLNYSTMILNRVVRMYPMYILIIAFTIWVLPYVGEGP  403
            D F   SG L ++ +  +L K + +      ++R++R+ P    +I F  +VLP  G GP
Sbjct  12   DPFLLFSGMLTSYSLFGRLMKQQPIRLKNEYISRLMRIVPPLAALILFCTYVLPLWGSGP  71

Query  404  MWKPYAEAESQYCKQSWWQNLLFVSTLNDYGDLCIASSWYVSTDFQLFLISLVLI  458
             W       +  CK++WW+NLLF+     + ++C+  + ++  D +LF ++ +LI
Sbjct  72   QWNLVVGHHADICKKNWWRNLLFIHNYFGFSEMCLTHTHHLGIDTELFAVAPLLI  126


>Q389C9_TRYB2 unnamed protein product
Length=791

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 4/103 (4%)

Query  368  LNYSTMILNRVVRMYPMYILIIAFTIWVLPYVGEGPMWKPYAEAES--QYCKQSWWQNLL  425
            L+Y+  +++R VR+ P+ + +      +LP   +GP+W   + A +  + C+  WW NLL
Sbjct  430  LSYTRYVVSRFVRVIPVALTVTLLVPNILPATSKGPLWMALSNAPALHKNCEDYWWTNLL  489

Query  426  FVSTL--NDYGDLCIASSWYVSTDFQLFLISLVLIYVVSKLST  466
             ++ +   D    C   S+YV+ +FQL     ++  +   L T
Sbjct  490  LINNMVPTDGSKCCFPWSYYVALEFQLVATGPLIYRLARSLHT  532



Lambda      K        H
   0.329    0.138    0.440 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 423452070


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Apr 30, 2020  2:49 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g01800.1.1 Protein

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   213     1e-61
Q18712_CAEEL  unnamed protein product                                 32.3    1.2  
Q9N5S8_CAEEL  unnamed protein product                                 32.0    1.6  


>TTY2_DROME unnamed protein product
Length=655

 Score = 213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 166/467 (36%), Positives = 253/467 (54%), Gaps = 40/467 (9%)

Query  13   RPPVLTTIFHRFPHVNVSLQLVNSTFDPRSEVYIE----------------SLGILGSIP  56
            +P +L  I H  PHVN + + VN TF+P S+VY+E                SL IL SIP
Sbjct  3    QPSILVKILHSIPHVNYTFRRVNDTFNPDSDVYLEPTNNKLQCQQKGIELQSLVILASIP  62

Query  57   ALWLIFTLFILLIYLLTRCCDRKPRAKHSITVLKWSLFLFAVLCGATLGIALYGNDDVHN  116
            A  LI +L  LL+YLLTRCCDR+ R   +      SL +  ++  A +G+ LYGNDD HN
Sbjct  63   AGLLIGSLLGLLLYLLTRCCDRRQRKPSAQRCQSCSLVIITLMTCAAIGLGLYGNDDFHN  122

Query  117  GLDSAISSLRAIDENIVSARNQTLTIETTLQIKVKQLMTELNDVFSEPVRNQTIRKSLLT  176
            GL  A  S ++++  +++ + QT +I+  L+ ++     E   +  +P  NQT+   L+ 
Sbjct  123  GLLQAFGSGKSVEGLVLTLKRQTESIKHDLETRMAGHKVE--QLVEKPHYNQTVVMLLIE  180

Query  177  SLANMQGNTTSAVKACQEIQTPLHML-------NFTNLFNYLYLGE---SIRYPATMALY  226
            +   +  NT+ AV +   +   +H         N T+L   L LGE   SIR+PAT+A  
Sbjct  181  TSRLVTENTSRAVASLDSM---VHYFMKAKGSENDTSLMGLLQLGEFYESIRWPATLAFL  237

Query  227  ITLLVFCIMLIFGVYRHSRCCLITFSVFGLFAIIICWLLSSLYLVIAVATGDVCMSPDRF  286
              LL+ C +L+ GV R SRC LI FSV GLF IIICWLL+ +YL  +VA GD CM P  +
Sbjct  238  TVLLLLCTVLVIGVARRSRCTLIFFSVSGLFCIIICWLLAGVYLASSVAAGDFCMRPHDY  297

Query  287  LERQSPPPVRLQMDILAYYLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYK  346
            + RQ    V ++   +  +L C T R N F + +      V+    ++  + R++++ Y 
Sbjct  298  MCRQ----VGMRSPYVD-FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYP  351

Query  347  HELLHPSLDILTTEVKLASNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAM  406
            H  +  +L+ +  ++++    ++ L A L+ + I+  Y  AL+  C   L GL+LM++A 
Sbjct  352  HIDIQRTLNAMDNDLEITLRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAG  411

Query  407  AVAGFFFTVLVWLDSHTWIYIRKKREYLQVDEQD--PYMPPSAASQA  451
             +  F  T+LV+ DSH WIY+  KR  L  D+ +  P  P S A  A
Sbjct  412  LLTSFLLTILVYADSHAWIYL-TKRPTLDADKSETAPLFPASNAPSA  457


 Score = 39.3 bits (90),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 9/50 (18%)

Query  466  MMMGNNYSSHTLG-----HKKFQR--DGP--GQYSTLSKKCKTLESSDFY  506
            ++ G     HTLG     H++      GP  G+Y+TLSK+CKTLES+DFY
Sbjct  606  LVHGTRSGHHTLGRLPSHHQQSATYLPGPNNGKYATLSKQCKTLESNDFY  655


>Q18712_CAEEL unnamed protein product
Length=771

 Score = 32.3 bits (72),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (46%), Gaps = 5/79 (6%)

Query  372  PAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTWIYIRKKR  431
            P +LN   I   Y+ +  S     L   A+M   +AV GFF   + W    T   +RK +
Sbjct  215  PILLNLSMI---YLASFVSDIRIILIFFAVMYFVIAVIGFFIKDVEWESDKTDFKLRKFQ  271

Query  432  EYLQV--DEQDPYMPPSAA  448
            +Y+    DE++    P+ A
Sbjct  272  KYIAKMDDEKENNTNPTDA  290


>Q9N5S8_CAEEL unnamed protein product
Length=617

 Score = 32.0 bits (71),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 54/126 (43%), Gaps = 23/126 (18%)

Query  134  SARNQTLTIETTLQIKVKQLMTELNDVFSEPVRNQ---------TIRKSLLTSLANMQG-  183
            S RN+ ++  +TL I  ++    L+D FSE + ++          IR S+    A M+  
Sbjct  155  SLRNRKMSESSTLGIIKRETQIYLDDNFSEDIPDEVFVRSRGWAAIRDSVDFVKAGMEAI  214

Query  184  ---NTTSAVKACQEI------QTPLHMLNFTN--LFNYLYLGESIRYPATMALYITLLVF  232
                 TS  +A Q +      +T +    F N  L     LG   RY   + L  T  VF
Sbjct  215  IEDEVTSRFEAEQLVSWNMLTRTSIKFYQFVNWKLSALWILGFMFRYCVMLPLRFT--VF  272

Query  233  CIMLIF  238
            CI L+F
Sbjct  273  CIGLVF  278



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01810.1.1 Protein

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   217     3e-62
Q18712_CAEEL  unnamed protein product                                 33.9    0.40 
Q9N5S8_CAEEL  unnamed protein product                                 32.3    1.3  


>TTY2_DROME unnamed protein product
Length=655

 Score = 217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 173/497 (35%), Positives = 264/497 (53%), Gaps = 45/497 (9%)

Query  13   RPPVLTTIFHRFPHVNVSLQLVNSTFDPRSEVYIE----------------SLGILGSIP  56
            +P +L  I H  PHVN + + VN TF+P S+VY+E                SL IL SIP
Sbjct  3    QPSILVKILHSIPHVNYTFRRVNDTFNPDSDVYLEPTNNKLQCQQKGIELQSLVILASIP  62

Query  57   ALWLIFTLFILLIYLLTRCCDRKPRAKHSITVLKWSLFLFAVLCGATLGIALYGNDDVHN  116
            A  LI +L  LL+YLLTRCCDR+ R   +      SL +  ++  A +G+ LYGNDD HN
Sbjct  63   AGLLIGSLLGLLLYLLTRCCDRRQRKPSAQRCQSCSLVIITLMTCAAIGLGLYGNDDFHN  122

Query  117  GLDSAISSLRAIDENIVSARNQTLTIETTLQIKVKQLMTELNDVFSEPVRNQTIRKSLLT  176
            GL  A  S ++++  +++ + QT +I+  L+ ++     E   +  +P  NQT+   L+ 
Sbjct  123  GLLQAFGSGKSVEGLVLTLKRQTESIKHDLETRMAGHKVE--QLVEKPHYNQTVVMLLIE  180

Query  177  SLANMQGNTTSAVKACQEIQTPLHML-------NFTNLFNYLYLGE---SIRYPATMALY  226
            +   +  NT+ AV +   + + +H         N T+L   L LGE   SIR+PAT+A  
Sbjct  181  TSRLVTENTSRAVAS---LDSMVHYFMKAKGSENDTSLMGLLQLGEFYESIRWPATLAFL  237

Query  227  ITLLVFCIMLIFGVYRHSRCCLITFSVFGLFAIIICWLLSSLYLVIAVATGDVCMSPDRF  286
              LL+ C +L+ GV R SRC LI FSV GLF IIICWLL+ +YL  +VA GD CM P  +
Sbjct  238  TVLLLLCTVLVIGVARRSRCTLIFFSVSGLFCIIICWLLAGVYLASSVAAGDFCMRPHDY  297

Query  287  LERQSPPPVRLQMDILAYYLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYK  346
            + RQ    V ++   +  +L C T R N F + +      V+    ++  + R++++ Y 
Sbjct  298  MCRQ----VGMRSPYVD-FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYP  351

Query  347  HELLHPSLDILTTEVKLASNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAM  406
            H  +  +L+ +  ++++    ++ L A L+ + I+  Y  AL+  C   L GL+LM++A 
Sbjct  352  HIDIQRTLNAMDNDLEITLRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAG  411

Query  407  AVAGFFFTVLVWLDSHTWIYIRKKREYLQVDEQD--PYMPPSAASQAIAARTMRPPQGDI  464
             +  F  T+LV+ DSH WIY+  KR  L  D+ +  P  P S A  A  + T     G I
Sbjct  412  LLTSFLLTILVYADSHAWIYL-TKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTI  470

Query  465  -----YGRSPGVGGGVG  476
                 + +    GGG G
Sbjct  471  NRTLLHHQQASSGGGSG  487


 Score = 38.5 bits (88),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 9/50 (18%)

Query  528  MMMGNNYSSHTLGH--KKFQRD-----GP--GQYSTLSKKCKTLESSDFY  568
            ++ G     HTLG      Q+      GP  G+Y+TLSK+CKTLES+DFY
Sbjct  606  LVHGTRSGHHTLGRLPSHHQQSATYLPGPNNGKYATLSKQCKTLESNDFY  655


>Q18712_CAEEL unnamed protein product
Length=771

 Score = 33.9 bits (76),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 56/152 (37%), Gaps = 16/152 (11%)

Query  372  PAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTWIYIRKKR  431
            P +LN   I   Y+ +  S     L   A+M   +AV GFF   + W    T   +RK +
Sbjct  215  PILLNLSMI---YLASFVSDIRIILIFFAVMYFVIAVIGFFIKDVEWESDKTDFKLRKFQ  271

Query  432  EYLQV--DEQDPYMPPSAASQAIAARTMRPPQGDIYGRSPGVGGGVGPGNMGTLRAS---  486
            +Y+    DE++    P   + A     +  P  +I     G    +        ++    
Sbjct  272  KYIAKMDDEKENNTNP---TDAFMRHAISLPNLNILNNHSGSIQSICDAAKAERKSDKPT  328

Query  487  -SRGAPLPSAPQH----PQYATLNRKFRTLEH  513
             S+   L          P+Y+ LN     LEH
Sbjct  329  RSKSVALFDNKHQMSSIPEYSMLNTNLANLEH  360


>Q9N5S8_CAEEL unnamed protein product
Length=617

 Score = 32.3 bits (72),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 54/126 (43%), Gaps = 23/126 (18%)

Query  134  SARNQTLTIETTLQIKVKQLMTELNDVFSEPVRNQ---------TIRKSLLTSLANMQG-  183
            S RN+ ++  +TL I  ++    L+D FSE + ++          IR S+    A M+  
Sbjct  155  SLRNRKMSESSTLGIIKRETQIYLDDNFSEDIPDEVFVRSRGWAAIRDSVDFVKAGMEAI  214

Query  184  ---NTTSAVKACQEI------QTPLHMLNFTN--LFNYLYLGESIRYPATMALYITLLVF  232
                 TS  +A Q +      +T +    F N  L     LG   RY   + L  T  VF
Sbjct  215  IEDEVTSRFEAEQLVSWNMLTRTSIKFYQFVNWKLSALWILGFMFRYCVMLPLRFT--VF  272

Query  233  CIMLIF  238
            CI L+F
Sbjct  273  CIGLVF  278



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01820.1.1 Unknown

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZW8_TRYB2  unnamed protein product                                 26.9    7.7  


>Q57ZW8_TRYB2 unnamed protein product
Length=459

 Score = 26.9 bits (58),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 31/71 (44%), Gaps = 3/71 (4%)

Query  48   ILKMRSNLKKVSTAPQLAVSCYHEGVTQRC---AFVWWHFHFEKFSSPILWHNYLVALGI  104
            +L  R  L K  T+     SC  +   ++C    FV     F    +P++W   LVA  I
Sbjct  39   LLSKRDGLVKYRTSIGDPHSCSCDASREQCIHVVFVLCKVFFLPRENPLVWQRSLVAAEI  98

Query  105  QRLPRVKFRVQ  115
              + R + R++
Sbjct  99   DEILRSENRLR  109



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01830.1.1 Protein

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   58.2    1e-09
Q18712_CAEEL  unnamed protein product                                 33.1    0.17 
M9PBS1_DROME  unnamed protein product                                 30.4    1.3  


>TTY2_DROME unnamed protein product
Length=655

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  25   YLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYKHELLHPSLDILTTEVKLA  84
            +L C T R N F + +      V+    ++  + R++++ Y H  +  +L+ +  ++++ 
Sbjct  311  FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYPHIDIQRTLNAMDNDLEIT  369

Query  85   SNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTW  144
               ++ L A L+ + I+  Y  AL+  C   L GL+LM++A  +  F  T+LV+ DSH W
Sbjct  370  LRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAGLLTSFLLTILVYADSHAW  429

Query  145  IYIRKKREYLQVDEQD--PYMPPSAASQAIAARTMRPPQGDI-----YGRSPGVGGGWG  196
            IY+  KR  L  D+ +  P  P S A  A  + T     G I     + +    GGG G
Sbjct  430  IYL-TKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTINRTLLHHQQASSGGGSG  487


>Q18712_CAEEL unnamed protein product
Length=771

 Score = 33.1 bits (74),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (46%), Gaps = 5/79 (6%)

Query  92   PAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTWIYIRKKR  151
            P +LN   I   Y+ +  S     L   A+M   +AV GFF   + W    T   +RK +
Sbjct  215  PILLNLSMI---YLASFVSDIRIILIFFAVMYFVIAVIGFFIKDVEWESDKTDFKLRKFQ  271

Query  152  EYLQV--DEQDPYMPPSAA  168
            +Y+    DE++    P+ A
Sbjct  272  KYIAKMDDEKENNTNPTDA  290


>M9PBS1_DROME unnamed protein product
Length=603

 Score = 30.4 bits (67),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  147  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGWGQETW  200
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G   +T+
Sbjct  257  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTF  310



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01830.1.2 Protein

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTY2_DROME  unnamed protein product                                   58.2    1e-09
Q18712_CAEEL  unnamed protein product                                 33.1    0.17 
M9PBS1_DROME  unnamed protein product                                 30.4    1.3  


>TTY2_DROME unnamed protein product
Length=655

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  25   YLTCETSRTNPFHVVVKRGTQAVEAISWNLGVLSRLAKQEYKHELLHPSLDILTTEVKLA  84
            +L C T R N F + +      V+    ++  + R++++ Y H  +  +L+ +  ++++ 
Sbjct  311  FLNCGTPR-NRFILRLNESRDLVDRARESVEHMQRMSQETYPHIDIQRTLNAMDNDLEIT  369

Query  85   SNLMSGLPAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTW  144
               ++ L A L+ + I+  Y  AL+  C   L GL+LM++A  +  F  T+LV+ DSH W
Sbjct  370  LRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAGLLTSFLLTILVYADSHAW  429

Query  145  IYIRKKREYLQVDEQD--PYMPPSAASQAIAARTMRPPQGDI-----YGRSPGVGGGWG  196
            IY+  KR  L  D+ +  P  P S A  A  + T     G I     + +    GGG G
Sbjct  430  IYL-TKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTINRTLLHHQQASSGGGSG  487


>Q18712_CAEEL unnamed protein product
Length=771

 Score = 33.1 bits (74),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (46%), Gaps = 5/79 (6%)

Query  92   PAILNCQPINREYIHALQSTCDTALFGLALMLLAMAVAGFFFTVLVWLDSHTWIYIRKKR  151
            P +LN   I   Y+ +  S     L   A+M   +AV GFF   + W    T   +RK +
Sbjct  215  PILLNLSMI---YLASFVSDIRIILIFFAVMYFVIAVIGFFIKDVEWESDKTDFKLRKFQ  271

Query  152  EYLQV--DEQDPYMPPSAA  168
            +Y+    DE++    P+ A
Sbjct  272  KYIAKMDDEKENNTNPTDA  290


>M9PBS1_DROME unnamed protein product
Length=603

 Score = 30.4 bits (67),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  147  IRKKREYLQVDEQDPYMPPSAASQAIAARTMRP-PQGDIYGRSPGVGGGWGQETW  200
            +++KR      E  P  P S A+ A  AR+  P PQG I   SPG   G   +T+
Sbjct  257  LKRKRSPQDQGEVTP-PPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTF  310



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01840.1.1 jacalin-related

Length=245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTR6_DROME  unnamed protein product                                 30.8    1.4  
Q7YU48_DROME  unnamed protein product                                 30.4    1.5  


>Q9VTR6_DROME unnamed protein product
Length=1713

 Score = 30.8 bits (68),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-GSTNGTGTTGTGTTPG-GST  163
            G+ PG G+  G G  G G  PG G+  G G  G G+ PG G   G G  G GT PG G+ 
Sbjct  486  GSQPGVGAQTGAGQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQ  545

Query  164  NGTGITGTGTTPG  176
             GTG  G G  PG
Sbjct  546  TGTGQPGYGAQPG  558


 Score = 29.6 bits (65),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 39/79 (49%), Gaps = 10/79 (13%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-------GSTNGTGTTGTGTT  158
            GT PG G+  GTG  G G  PG G+  G G  G G+ PG       G+  GTG  G G  
Sbjct  588  GTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGYGSQPGYGTQPGVGAQTGTGQPGYGAQ  647

Query  159  PG-GSTNGTGITGTGTTPG  176
            PG G   G G  G GT PG
Sbjct  648  PGVGGQTGAGQPGYGTQPG  666


>Q7YU48_DROME unnamed protein product
Length=1071

 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-GSTNGTGTTGTGTTPG-GST  163
            G+ PG G+  G G  G G  PG G+  G G  G G+ PG G   G G  G GT PG G+ 
Sbjct  486  GSQPGVGAQTGAGQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQ  545

Query  164  NGTGITGTGTTPG  176
             GTG  G G  PG
Sbjct  546  TGTGQPGYGAQPG  558


 Score = 29.3 bits (64),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 39/79 (49%), Gaps = 10/79 (13%)

Query  108  GTTPG-GSTNGTGITGTGTTPG-GSTNGTGITGTGTTPG-------GSTNGTGTTGTGTT  158
            GT PG G+  GTG  G G  PG G+  G G  G G+ PG       G+  GTG  G G  
Sbjct  588  GTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGYGSQPGYGTQPGVGAQTGTGQPGYGAQ  647

Query  159  PG-GSTNGTGITGTGTTPG  176
            PG G   G G  G GT PG
Sbjct  648  PGVGGQTGAGQPGYGTQPG  666



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01850.1.1 leukocyte

Length=216


***** No hits found *****



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01860.1.1 Peptidyl-prolyl

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0Q2_DROME  unnamed protein product                                 264     6e-92
Q18445_CAEEL  unnamed protein product                                 226     8e-77
CYPE_DICDI  unnamed protein product                                   205     8e-69


>Q9W0Q2_DROME unnamed protein product
Length=176

 Score = 264 bits (675),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)

Query  1    MGEIIVELYWKHAPNTCRNFAELCRRNYYNGIKFHRIIRDFMIQGGDPTGTGRGGSSIYG  60
            MGEI VELYWKHAPNTCRNFAEL RR YYN + FHRIIRDFMIQGGDPTGTGRGG+SIYG
Sbjct  29   MGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYG  88

Query  61   KTFADEIHEELKHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHAIFGRIYSGMSVV  120
              FADE+H +L+HTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKH IFGR+Y+GM VV
Sbjct  89   SEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVV  148

Query  121  KRIGLVETDKNDRPVDDVKILKTHVR  146
            KRIG+VETDKNDRPVD ++I+K  V 
Sbjct  149  KRIGMVETDKNDRPVDPLRIIKAKVE  174


>Q18445_CAEEL unnamed protein product
Length=169

 Score = 226 bits (575),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 122/144 (85%), Gaps = 0/144 (0%)

Query  1    MGEIIVELYWKHAPNTCRNFAELCRRNYYNGIKFHRIIRDFMIQGGDPTGTGRGGSSIYG  60
            MG+I +ELYW HAP TC+NF++L +RNYYNG  FHRII DFMIQGGDPTGTGRGG+SIYG
Sbjct  18   MGKIALELYWNHAPRTCQNFSQLAKRNYYNGTIFHRIIADFMIQGGDPTGTGRGGASIYG  77

Query  61   KTFADEIHEELKHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHAIFGRIYSGMSVV  120
              F+DEI E LKHTGAGILSMAN+GP+TNGSQFFITLAPTQ LDGKH IFGR+ +GM V+
Sbjct  78   DKFSDEIDERLKHTGAGILSMANAGPNTNGSQFFITLAPTQHLDGKHTIFGRVAAGMKVI  137

Query  121  KRIGLVETDKNDRPVDDVKILKTH  144
              +G V+TD +DRP  +++ILK +
Sbjct  138  ANMGRVDTDNHDRPKIEIRILKAY  161


>CYPE_DICDI unnamed protein product
Length=156

 Score = 205 bits (521),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 1/142 (1%)

Query  1    MGEIIVELYWKHAPNTCRNFAELCRRNYYNGIKFHRIIRDFMIQGGDPTGTGRGGSSIYG  60
            +G+I +ELY+ HAP  C+NF EL +R YY+   FHR+I+DFMIQGGDP G GRGG SIYG
Sbjct  12   VGDITLELYYNHAPKACKNFYELSKRGYYDNTIFHRLIKDFMIQGGDPLGNGRGGESIYG  71

Query  61   KTFADEIHEELKHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHAIFGRIYSGMSVV  120
            K F DEI +ELKHTGAGILSMANSG ++NGSQFFIT  PT WLDGKH IFGR+ SGM VV
Sbjct  72   KKFEDEITKELKHTGAGILSMANSGVNSNGSQFFITFGPTPWLDGKHTIFGRVKSGMKVV  131

Query  121  KRIGLVETDKNDRPVDDVKILK  142
            +++  ++T+ ND+P+D+++I+K
Sbjct  132  QKMNAMQTN-NDKPIDEIRIIK  152



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01870.1.1 Leukocyte

Length=221


***** No hits found *****



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01880.1.1 Unknown

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ADAR_DROME  unnamed protein product                                   26.9    8.6  


>ADAR_DROME unnamed protein product
Length=676

 Score = 26.9 bits (58),  Expect = 8.6, Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 19/39 (49%), Gaps = 4/39 (10%)

Query  56   TDGFYEDYKRSGLDFHTFY----AGYRPTFRPHENCIGL  90
            TDG Y    +SG+ FH +      G    F PHEN  G+
Sbjct  407  TDGQYPYKLKSGVHFHLYINTAPCGDARIFSPHENDTGV  445



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01890.1.1 Elongation

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCY6_DROME  unnamed protein product                                 260     1e-83
Q9VHX7_DROME  unnamed protein product                                 211     4e-64
Q9VCY7_DROME  unnamed protein product                                 179     4e-52


>Q9VCY6_DROME unnamed protein product
Length=295

 Score = 260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 170/254 (67%), Gaps = 2/254 (1%)

Query  1    METIFGPAMRLYKYVNEDLADPRTKDFFLIGSPIPGLCLLAFYNYFVHNLGPRFMEDRKP  60
            M  +    +  + ++  DLADPRT D+FLI SP+P L +LAFY +FV + GP+FM+DRKP
Sbjct  1    MAAVNATQVDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKP  60

Query  61   FKLDRFMIYYNIVQIVASLYLFIEASKVWLFEYNWKCQPIDNSTDEKALNVIRLCYLYFW  120
            FKL+R ++ YN  Q+  S+++  E   +W + Y+W+CQP+D S   KA    R+ Y+Y+ 
Sbjct  61   FKLERTLLVYNFFQVALSVWMVYEGVVIWQY-YSWRCQPVDWSRTPKAYREARVVYVYYL  119

Query  121  LKLIDLTDTIIFVLRKKFSSVSFLHVYHHTGMVMLTWSGVKWFPGGHDTWIGWLNSIVHV  180
             K+ +L DTI FVLRK    V+FLHVYHHT M M++W   K++PGGH T+IGW+NS VH+
Sbjct  120  AKITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHI  179

Query  181  VMYGYYLLCVLQPQYKTSIWWKKHLTQMQMIQFLLNSIHSLQILFYPDCGYPKWLVLIIV  240
            +MY YY L    PQ +  +WWKK++T +QMIQF    IH  Q+L Y DCGYP+W V   +
Sbjct  180  IMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLL-YTDCGYPRWSVCFTL  238

Query  241  PQNFFMFYLFYRFY  254
            P   F ++LF  FY
Sbjct  239  PNAVFFYFLFNDFY  252


>Q9VHX7_DROME unnamed protein product
Length=329

 Score = 211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/260 (41%), Positives = 152/260 (58%), Gaps = 1/260 (0%)

Query  17   EDLADPRTKDFFLIGSPIPGLCLLAFYNYFVHNLGPRFMEDRKPFKLDRFMIYYNIVQIV  76
            ++ +DPRT+D+ L+ SP P + +   Y Y V  LGP+ ME+RKPF+L + +I YN  Q++
Sbjct  16   DNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVI  75

Query  77   ASLYLFIEAS-KVWLFEYNWKCQPIDNSTDEKALNVIRLCYLYFWLKLIDLTDTIIFVLR  135
             S +LF E+    WL  YN +C+P++ S   KA+     C+ Y++ K  +  DT  FV+R
Sbjct  76   FSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMR  135

Query  136  KKFSSVSFLHVYHHTGMVMLTWSGVKWFPGGHDTWIGWLNSIVHVVMYGYYLLCVLQPQY  195
            K++  VS LHV HH  M +  W GVK+ PGGH T+ G+LN+ VH+ MY YY+L  + P+ 
Sbjct  136  KRYDQVSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKV  195

Query  196  KTSIWWKKHLTQMQMIQFLLNSIHSLQILFYPDCGYPKWLVLIIVPQNFFMFYLFYRFYI  255
            +  +WWKK+LT MQMIQF+L  +HS Q+ F  DC YP      I       ++LF  FY 
Sbjct  196  QKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYK  255

Query  256  NAYCDNSKAKKLETSKMSHG  275
             AY       K       H 
Sbjct  256  RAYVKRDGKDKASVKANGHA  275


>Q9VCY7_DROME unnamed protein product
Length=322

 Score = 179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 151/265 (57%), Gaps = 9/265 (3%)

Query  20   ADPRTKDFFLIGSPIPGLCLLAFYNYFVHNLGPRFMEDRKPFKLDRFMIYYNIVQIVASL  79
             D     +FL+ SP+P + ++  Y  FV  +GP +M++RKP  L R M++YN  Q++ S+
Sbjct  19   VDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI  78

Query  80   YLF---IEASKVWLFEYNWKCQPIDNSTDEKALNVIRLCYLYFWLKLIDLTDTIIFVLRK  136
            ++    I+ S V    ++ KC+   N T E+ L +    + YF+ K+IDL DT  FVLRK
Sbjct  79   WMCRTSIQESNVMASIFSKKCEI--NRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRK  136

Query  137  KFSSVSFLHVYHHTGMVMLTWSGVKWFPGGHDTWIGWLNSIVHVVMYGYYLLCVLQPQYK  196
            K + VSFLHVYHHT  V+ +W  +K+ PG     IG LNS VH++MY YY++  + PQY+
Sbjct  137  KDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQ  196

Query  197  TSIWWKKHLTQMQMIQFLLNSIHSLQILFYPDCGYPKWLVLIIVPQNFFMFYLFYRFYIN  256
              +WWKK++T +Q+IQF+L   + L +     C  PK L    V       YLF  FY  
Sbjct  197  KYLWWKKYMTSIQLIQFVLILGYMLTV-GAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRK  255

Query  257  AYCDNSKAKKLETSKMSHGAEQSSS  281
             Y    KAK ++    + G+  + S
Sbjct  256  TY---KKAKSVDGGSRTTGSSLAQS  277



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01900.1.1 cytochrome

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP301_DROME  unnamed protein product                                  734     0.0  
CCD1P_DROME  unnamed protein product                                  283     9e-89
CCD1D_DROME  unnamed protein product                                  283     1e-88


>CP301_DROME unnamed protein product
Length=553

 Score = 734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/506 (69%), Positives = 417/506 (82%), Gaps = 4/506 (1%)

Query  48   LLDAESAALDNTGLSQGELDSARPYSQVPGPKPYPLLGNTWRLLPYIGQYQISNLADVSA  107
            L D+E A+      S  E  +A PY+Q+PGPKP P+LGNTWRL+P IGQY IS++A +S+
Sbjct  49   LADSEEASAPRIH-STSEWQNALPYNQIPGPKPIPILGNTWRLMPIIGQYTISDVAKISS  107

Query  108  QLYRDYGKIVRLGGLVGRPDLLFVYDADEIEKVYRQEGPTPFRPSMPCLVHYKSVVRKEF  167
             L+  YG+IVR GGL+GRPDLLF+YDADEIEK YR EGPTPFRPSMP LV YKSVVRK+F
Sbjct  108  LLHDRYGRIVRFGGLIGRPDLLFIYDADEIEKCYRSEGPTPFRPSMPSLVKYKSVVRKDF  167

Query  168  FGRLAGVVGVHGEPWREFRTKVQKPILQLRTVRKYIEPIENVTDYFIQRMNEMKDENSEM  227
            FG L GVVGVHGEPWREFR++VQKP+LQL T+R+Y++P+E +T+ F+ R   + DEN E+
Sbjct  168  FGDLGGVVGVHGEPWREFRSRVQKPVLQLSTIRRYLQPLEVITEDFLVRCENLLDENQEL  227

Query  228  PADFDNEIHKWSLECIGRVALDVRLGCLNPDLTGNDEPQKIIDAAKYALRNVAILELKLP  287
            P DFDNEIHKWSLECIGRVALD RLGCL  +L  + EPQ+IIDAAKYALRNVA LELK P
Sbjct  228  PEDFDNEIHKWSLECIGRVALDTRLGCLESNLKPDSEPQQIIDAAKYALRNVATLELKAP  287

Query  288  FWRYIPSNLWRKYVSNMNYFIEICMKYIDSAMERLKTKS-NLNENDMSLVERILLNEPDP  346
            +WRY P+ LW +YV NMN+F+ +CMKYI SA ERLKT+  +L   + SLVE+++L++ D 
Sbjct  288  YWRYFPTPLWTRYVKNMNFFVGVCMKYIQSATERLKTQDPSLRAGEPSLVEKVILSQKDE  347

Query  347  KTAYVLALDLILVGIDTISMAVCSMLYQLATRPEEQEKLHQELCRILPDPSQPLTPDKLD  406
            K A ++ALDLILVGIDTISMAVCSMLYQLATRP +Q+K+H+EL R+LPDP+ PLT   LD
Sbjct  348  KIATIMALDLILVGIDTISMAVCSMLYQLATRPVDQQKVHEELKRLLPDPNTPLTIPLLD  407

Query  407  QMIYLKAFIKEVFRMYSTVIGNGRTLQNDMVICGYRIPKGIQLVFPTIVTGNMPEYVSDP  466
            QM +LK FIKEVFRMYSTVIGNGRTL  D VICGY++PKG+Q VFPTIVTGNM EYV+D 
Sbjct  408  QMHHLKGFIKEVFRMYSTVIGNGRTLMEDSVICGYQVPKGVQAVFPTIVTGNMEEYVTDA  467

Query  467  ETFYPERWIKQSSTTGCPHSQIHPFASLPYGHGARMCLGRRFADLEMQILLAKLIRSYRL  526
             TF PERW+K     G    ++HPFASLPYG+GARMCLGRRFADLEMQILLAKL+R+Y+L
Sbjct  468  ATFRPERWLKPQH--GGTPGKLHPFASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKL  525

Query  527  EFHHKPLEYKVTFMYAPDGELKFKMT  552
            E++HKPL+Y VTFMYAPDG L+FKMT
Sbjct  526  EYNHKPLDYAVTFMYAPDGPLRFKMT  551


>CCD1P_DROME unnamed protein product
Length=521

 Score = 283 bits (724),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 159/530 (30%), Positives = 276/530 (52%), Gaps = 21/530 (4%)

Query  27   SSTTSTPTTAASVRNQSSVSGLLDAESAALDNTGLSQGELDSARPYSQVPGPKPYPLLGN  86
            SS  S       VR+  S S +L  E A    T       +  + Y ++P P  +  +  
Sbjct  5    SSARSVAIYVGPVRSSRSAS-VLAHEQAKSSIT-------EEHKTYDEIPRPNKFKFM--  54

Query  87   TWRLLPYIGQYQISNLADVSAQLYRDYGKIVRLGGLVGRPDLLFVYDADEIEKVYRQEGP  146
              R     G++Q +++ + ++ + + YG I  + G+ GR D +  ++  +IE V+R EG 
Sbjct  55   --RAFMPGGEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTFNTKDIEMVFRNEGI  112

Query  147  TPFRPSMPCLVHYKSVVRKEFFGRLAGVVGVHGEPWREFRTKVQKPILQLRTVRKYIEPI  206
             P R  +  +V+++  VR + +G + G+V    E W + R+ +    +Q R +R Y EP+
Sbjct  113  WPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPL  172

Query  207  ENVTDYFIQRMNEMKDENS-EMPADFDNEIHKWSLECIGRVALDVRLGCLNPDLTGNDEP  265
             N+ + FI+R+ E++D  + E+P DF +EI +   E +G VA D ++G +  +   N + 
Sbjct  173  SNINNEFIERIKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKN-RDNSDA  231

Query  266  QKIIDAAKYALRNVAILELKLPFWRYIPSNLWRKYVSNMNYFIEICMKYIDSAMERLKTK  325
              +   ++   R    L+++   W+ I +  +RK    +N  + +  K +    + L+ +
Sbjct  232  LTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKR  291

Query  326  SNLNE--NDMSLVERILLNEPDPKTAYVLALDLILVGIDTISMAVCSMLYQLATRPEEQE  383
                E  N  S++ER++  E DPK A +++LD++  G+D  +  + ++L  L+  P++Q 
Sbjct  292  RQAGEKINSNSMLERLM--EIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQA  349

Query  384  KLHQELCRILPDPSQPLTPDKLDQMIYLKAFIKEVFRMYSTVIGNGRTLQNDMVICGYRI  443
            KL +EL  I+P     L  + +  M YL+A IKE  R Y   +G  RT QND+++ GYR+
Sbjct  350  KLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRV  409

Query  444  PKGIQLVFPTIVTGNMPEYVSDPETFYPERWIKQSSTTGCPHSQIHPFASLPYGHGARMC  503
            PKG  ++  + V      Y   P+ F PERW++   T      Q+ PF  LP+G G RMC
Sbjct  410  PKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPET--GKKMQVSPFTFLPFGFGPRMC  467

Query  504  LGRRFADLEMQILLAKLIRSYRLEFHHKPLE-YKVTFMYAPDGELKFKMT  552
            +G+R  DLEM+  +AKLIR++ +EF+      +K  F+  P     FK T
Sbjct  468  IGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFVMEPAITFPFKFT  517


>CCD1D_DROME unnamed protein product
Length=521

 Score = 283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/530 (30%), Positives = 275/530 (52%), Gaps = 21/530 (4%)

Query  27   SSTTSTPTTAASVRNQSSVSGLLDAESAALDNTGLSQGELDSARPYSQVPGPKPYPLLGN  86
            SS  S       VR+  S S +L  E A    T       +  + Y ++P P  +  +  
Sbjct  5    SSARSVAIYVGPVRSSRSAS-VLAHEQAKSSIT-------EEHKTYDEIPRPNKFKFM--  54

Query  87   TWRLLPYIGQYQISNLADVSAQLYRDYGKIVRLGGLVGRPDLLFVYDADEIEKVYRQEGP  146
              R     G++Q +++ + ++ + + YG I  + G+ GR D +  ++  +IE V+R EG 
Sbjct  55   --RAFMPGGEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTFNTKDIEMVFRNEGI  112

Query  147  TPFRPSMPCLVHYKSVVRKEFFGRLAGVVGVHGEPWREFRTKVQKPILQLRTVRKYIEPI  206
             P R  +  +V+++  VR + +G + G+V    E W + R+ +    +Q R +R Y EP+
Sbjct  113  WPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPL  172

Query  207  ENVTDYFIQRMNEMKDENS-EMPADFDNEIHKWSLECIGRVALDVRLGCLNPDLTGNDEP  265
             N+ + FI+R+ E++D  + E+P DF +EI +   E +G VA D ++G +  +   N + 
Sbjct  173  SNINNEFIERIKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKN-RDNSDA  231

Query  266  QKIIDAAKYALRNVAILELKLPFWRYIPSNLWRKYVSNMNYFIEICMKYIDSAMERLKTK  325
              +   ++   R    L+++   W+ I +  +RK    +N  + +  K +    + L+ +
Sbjct  232  LTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVSQKMLKENQDALEKR  291

Query  326  SNLNE--NDMSLVERILLNEPDPKTAYVLALDLILVGIDTISMAVCSMLYQLATRPEEQE  383
                E  N  S++ER++  E DPK A +++LD++  G+D  +  + ++L  L+  P++Q 
Sbjct  292  RQAGEKINSNSMLERLM--EIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQA  349

Query  384  KLHQELCRILPDPSQPLTPDKLDQMIYLKAFIKEVFRMYSTVIGNGRTLQNDMVICGYRI  443
            KL +EL  I+P     L  + +  M YL+A IKE  R Y    G  RT QND+++ GYR+
Sbjct  350  KLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGFGTMRTCQNDVILSGYRV  409

Query  444  PKGIQLVFPTIVTGNMPEYVSDPETFYPERWIKQSSTTGCPHSQIHPFASLPYGHGARMC  503
            PKG  ++  + V      Y   P+ F PERW++   T      Q+ PF  LP+G G RMC
Sbjct  410  PKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPET--GKKMQVSPFTFLPFGFGPRMC  467

Query  504  LGRRFADLEMQILLAKLIRSYRLEFHHKPLE-YKVTFMYAPDGELKFKMT  552
            +G+R  DLEM+  +AKLIR++ +EF+      +K  F+  P     FK T
Sbjct  468  IGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFLMEPAITFPFKFT  517



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01910.1.1 Gag

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z6P0_DROME  unnamed protein product                                 39.3    0.002
Q6NR13_DROME  unnamed protein product                                 35.4    0.022
Q7K9B7_DROME  unnamed protein product                                 35.4    0.038


>A1Z6P0_DROME unnamed protein product
Length=310

 Score = 39.3 bits (90),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 36/67 (54%), Gaps = 0/67 (0%)

Query  179  KYIVLVTLFVLTFLSTILPLRVVSTLRDTLDPNKRNKYAKVVGLLSCFAGGVFMASALLD  238
            K + +V LF++T +   +P  +    + T  P    +  KVV  L  F GGV +A+  + 
Sbjct  10   KIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIH  69

Query  239  LLPEVIE  245
            +LPEV+E
Sbjct  70   MLPEVVE  76


>Q6NR13_DROME unnamed protein product
Length=187

 Score = 35.4 bits (80),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query  211  NKRNKYAKVVGLLSCFAGGVFMASALLDLLPEVIET----FSQIAPNSKF  256
              R ++     LL CF  G+ +A+AL+ +LPEV E     F+++A    F
Sbjct  52   RNRRRFPLTASLLLCFGAGILLATALVHILPEVREQMDSKFAEVAMCGGF  101


>Q7K9B7_DROME unnamed protein product
Length=346

 Score = 35.4 bits (80),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  179  KYIVLVTLFVLTFLSTILPLRVVSTLRDTLDPNKRNKYAKVVGLLSCFAGGVFMASALLD  238
            K + +V L V+T L   LP  +      T    +  + + VV  L  F GGV + +  L 
Sbjct  18   KIVSMVVLVVITVLCGSLPYVLNRCFHWTKASPEETRSSLVVRCLLFFGGGVLICTTFLH  77

Query  239  LLPEVIE  245
            +LPEVIE
Sbjct  78   MLPEVIE  84



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01920.1.1 Zinc

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GRW9_DROME  unnamed protein product                                 90.9    2e-21
Q9VEX1_DROME  unnamed protein product                                 90.1    2e-21
Q8SZF0_DROME  unnamed protein product                                 90.1    3e-21


>Q9GRW9_DROME unnamed protein product
Length=494

 Score = 90.9 bits (224),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)

Query  18   SSFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLS  77
            SS R + +  +LSLH LFEG+AIG++    +V  +  AV  HK+++ F VG++LI +   
Sbjct  265  SSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTR  324

Query  78   VKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLP  137
            +         F+++SPLGIGI + I+         LV + I+QG A GT IYV FFE+L 
Sbjct  325  MLLAVLYVLTFAVVSPLGIGIGILINHGQETSGPSLV-SAILQGFACGTLIYVVFFEILS  383

Query  138  KEIQSGRSRLLKLLAILIGFI  158
            K     RS L   LA+ +GF+
Sbjct  384  K----NRSGLRAYLALFVGFL  400


>Q9VEX1_DROME unnamed protein product
Length=495

 Score = 90.1 bits (222),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)

Query  18   SSFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLS  77
            SS R + +  +LSLH LFEG+AIG++    +V  +  AV  HK+++ F VG++LI +   
Sbjct  266  SSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTR  325

Query  78   VKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLP  137
            +         F+++SPLGIGI + I+         LV + I+QG A GT IYV FFE+L 
Sbjct  326  MLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLV-SAILQGFACGTLIYVVFFEILS  384

Query  138  KEIQSGRSRLLKLLAILIGFI  158
            K     RS L   LA+ +GF+
Sbjct  385  K----NRSGLRAYLALFVGFL  401


>Q8SZF0_DROME unnamed protein product
Length=495

 Score = 90.1 bits (222),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)

Query  18   SSFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLS  77
            SS R + +  +LSLH LFEG+AIG++    +V  +  AV  HK+++ F VG++LI +   
Sbjct  266  SSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTR  325

Query  78   VKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLP  137
            +         F+++SPLGIGI + I+         LV + I+QG A GT IYV FFE+L 
Sbjct  326  MLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLV-SAILQGFACGTLIYVVFFEILS  384

Query  138  KEIQSGRSRLLKLLAILIGFI  158
            K     RS L   LA+ +GF+
Sbjct  385  K----NRSGLRAYLALFVGFL  401



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01930.1.1 protein

Length=127
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYGO_DROME  unnamed protein product                                   41.6    6e-05
SOS_CAEEL  unnamed protein product                                    27.7    3.4  
FRL_DROME  unnamed protein product                                    27.3    4.3  


>PYGO_DROME unnamed protein product
Length=815

 Score = 41.6 bits (96),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 1/25 (4%)

Query  100  DLLPPP-LTGYGDTVVASNPFDDTP  123
            DLLPPP + G+GDT++ASNPFDD+P
Sbjct  79   DLLPPPPMGGFGDTIIASNPFDDSP  103


>SOS_CAEEL unnamed protein product
Length=1493

 Score = 27.7 bits (60),  Expect = 3.4, Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 0/33 (0%)

Query  63    SPMMSQPEPPPPKKKRRTSNAATITHHAPPPPP  95
             S +   P P PPK  R  SN+ T++   P   P
Sbjct  1437  SSVFRAPPPLPPKSNRHNSNSPTLSSEQPFEDP  1469


>FRL_DROME unnamed protein product
Length=1183

 Score = 27.3 bits (59),  Expect = 4.3, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 2/27 (7%)

Query  81   SNAATITHHAPPPP--PPVMQDLLPPP  105
            S + ++   AP PP  PP++    PPP
Sbjct  645  SPSGSLASTAPSPPHAPPMLSSFQPPP  671



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01940.1.1 Gag

Length=235
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZD1_TRYB2  unnamed protein product                                 34.7    0.076


>Q57ZD1_TRYB2 unnamed protein product
Length=1461

 Score = 34.7 bits (78),  Expect = 0.076, Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 46/103 (45%), Gaps = 11/103 (11%)

Query  21   KEVVDMFMLANRIEESRKVPILLSAIGEKTVQVLRQLYDP-ESPSCKSYVELCEILRLHF  79
            +EV  +F+L  +++E    P+LL+ I  +T    R+   P +S  C+    + +  R H 
Sbjct  400  QEVQRVFVLLEQLDEFTPWPVLLADIASRTFHAARERVQPTDSEECRDNANITKGFREHT  459

Query  80   APRVSI-YRKRIEFYDL---------KQLPGHIINACPEKLNG  112
            A R  + +  R     L         +  P  ++ AC + LNG
Sbjct  460  AMRAFLSWHSRAVATPLLSSSNAMVSRGTPLTLVEACSKALNG  502



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01950.1.1 Zinc

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z6P0_DROME  unnamed protein product                                 96.3    2e-23
Q7K9B7_DROME  unnamed protein product                                 94.7    2e-22
Q7JZR2_DROME  unnamed protein product                                 94.4    2e-22


>A1Z6P0_DROME unnamed protein product
Length=310

 Score = 96.3 bits (238),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 126/237 (53%), Gaps = 18/237 (8%)

Query  1    MASALLDLLPEVIETFS------QIAPNSKFPLGEFVISFGFFVILIVEQIALFYKEEIP  54
            +A+  + +LPEV+E  +       +AP + F L E ++  GF+++  +E+   F      
Sbjct  63   IATTFIHMLPEVVEVVNALQDCRMLAP-TPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQ  121

Query  55   VNFSDDLVVA--PRDDTRTMIPSSDPGDDPTARSPHSSFRSVLLFVSLSLHSLFEGLAIG  112
                 ++V      ++ RT I    P + P  + P +  R + + V+LSLH LF G+AIG
Sbjct  122  QRKLREVVTIKDAGEELRTEI-VVQPEESP--KEP-NWLRGLGIIVALSLHELFGGMAIG  177

Query  113  IQPDLDTVLQVAVAVIIHKVIIGFSVGLKLIQSDLSVKSVAQLDFWFSLMSPLGIGIAVG  172
            ++  + TV  +  A+ +HK+++ F +G++++ +             FS+++P+G+GI + 
Sbjct  178  LEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIA  237

Query  173  IDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFEVLPKEIQSGRNRLLKLLAILIGFI  229
            + +     Q   V +GI+QGLA GT IYV FFE++ K     R     LL+ ++GF+
Sbjct  238  VSESAAANQPSTV-SGILQGLACGTLIYVVFFEIVAKNHAGIR----ILLSSMVGFV  289


>Q7K9B7_DROME unnamed protein product
Length=346

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 130/263 (49%), Gaps = 44/263 (17%)

Query  1    MASALLDLLPEVIETFSQIAP-----NSKFPLGEFVISFGFFVILIVEQI----------  45
            + +  L +LPEVIE    +        + F L E ++  GFF++  ++++          
Sbjct  71   ICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRHHQG  130

Query  46   ALFYKEEIPV-------NFSDDLVVAPRDDTRTMIPSSDP---------GDDPTARSPHS  89
             L  KE +         +    +++ P+      +  ++P            P      S
Sbjct  131  KLSRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDGS  190

Query  90   SFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLI----QS  145
            S R + + ++LSLH LFEG+AIG++  + TV  +  AV  HK+++ F VG++L+    +S
Sbjct  191  SARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRS  250

Query  146  DLSVKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFE  205
             L++  +      FS+++P+GIG+ +GI Q +   Q  L  +G++QG+A GT +YV FFE
Sbjct  251  SLAILYLVT----FSIVTPIGIGVGLGISQQVAAGQPSLP-SGVLQGIACGTLLYVVFFE  305

Query  206  VLPKEIQSGRNRLLKLLAILIGF  228
            +L +     R     L+A + GF
Sbjct  306  ILIESHAGWR----ALVAAVAGF  324


>Q7JZR2_DROME unnamed protein product
Length=352

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 130/263 (49%), Gaps = 44/263 (17%)

Query  1    MASALLDLLPEVIETFSQIAP-----NSKFPLGEFVISFGFFVILIVEQI----------  45
            + +  L +LPEVIE    +        + F L E ++  GFF++  ++++          
Sbjct  77   ICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRHHQG  136

Query  46   ALFYKEEIPV-------NFSDDLVVAPRDDTRTMIPSSDP---------GDDPTARSPHS  89
             L  KE +         +    +++ P+      +  ++P            P      S
Sbjct  137  KLSRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDGS  196

Query  90   SFRSVLLFVSLSLHSLFEGLAIGIQPDLDTVLQVAVAVIIHKVIIGFSVGLKLI----QS  145
            S R + + ++LSLH LFEG+AIG++  + TV  +  AV  HK+++ F VG++L+    +S
Sbjct  197  SARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRS  256

Query  146  DLSVKSVAQLDFWFSLMSPLGIGIAVGIDQYMRNMQDLLVMTGIMQGLATGTFIYVTFFE  205
             L++  +      FS+++P+GIG+ +GI Q +   Q  L  +G++QG+A GT +YV FFE
Sbjct  257  SLAILYLVT----FSIVTPIGIGVGLGISQQVAAGQPSLP-SGVLQGIACGTLLYVVFFE  311

Query  206  VLPKEIQSGRNRLLKLLAILIGF  228
            +L +     R     L+A + GF
Sbjct  312  ILIESHAGWR----ALVAAVAGF  330



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01960.1.1 protein

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYGO_DROME  unnamed protein product                                   42.0    0.001


>PYGO_DROME unnamed protein product
Length=815

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 1/25 (4%)

Query  100  DLLPPP-LTGYGDTVVASNPFDDTP  123
            DLLPPP + G+GDT++ASNPFDD+P
Sbjct  79   DLLPPPPMGGFGDTIIASNPFDDSP  103



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01970.1.1 Protein

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYGO_DROME  unnamed protein product                                   155     3e-45
KDM5_CAEEL  unnamed protein product                                   40.0    1e-04
TRX_DROME  unnamed protein product                                    38.9    3e-04


>PYGO_DROME unnamed protein product
Length=815

 Score = 155 bits (392),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 0/96 (0%)

Query  12   KPMPVCAGKIYPENQAMVFNPQNPNAPPIYPCGICHKEVHDNDQAILCESGCNFWYHRMC  71
            KPM +  GK+YP  Q MVFNPQNPNAPPIYPCG+CHKEV+DND+A+ CESGCNF++HR C
Sbjct  719  KPMTMGGGKMYPPGQPMVFNPQNPNAPPIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTC  778

Query  72   TGLSDVAYTMLTAEVYAEWVCDKCLNNKNIPLVKFK  107
             GL++ A+ ML  EV+AEW CDKC+++K+IP+VKFK
Sbjct  779  VGLTEAAFQMLNKEVFAEWCCDKCVSSKHIPMVKFK  814


>KDM5_CAEEL unnamed protein product
Length=1477

 Score = 40.0 bits (92),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 29/57 (51%), Gaps = 5/57 (9%)

Query  46    CHKEVHDNDQAILCESGCNFWYHRMCTGLSDVAYTMLTAEVYAEWVCDKCLNNKNIP  102
             C K   D+   ++CE+GC  W+H +C G     +T+       E+ C  CL++ + P
Sbjct  1419  CLKPYGDSVNWVMCEAGCKNWFHVICLG-----FTLREINDMHEYRCSSCLDHADSP  1470


 Score = 27.3 bits (59),  Expect = 3.3, Method: Composition-based stats.
 Identities = 18/59 (31%), Positives = 26/59 (44%), Gaps = 8/59 (14%)

Query  43   CGICHKEVHDNDQAILCE-SGCNFWYHRMCTGLSDVAYTMLTAEVYAEWVCDKCLNNKN  100
            C  C+ E  D D  +LC+  GCN   H  C         +L      EW C KC+ +++
Sbjct  322  CVACN-EGKDEDLLLLCDIDGCNNGRHTYCCD------PVLDEVPEGEWRCPKCIESED  373


>TRX_DROME unnamed protein product
Length=3726

 Score = 38.9 bits (89),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 29/56 (52%), Gaps = 3/56 (5%)

Query  43    CGICHKEVHDNDQAI-LCESG-CNFWYHRMCTGLSDVAYTML-TAEVYAEWVCDKC  95
             C IC +   DND  + + E G C  W H  C GLSD  Y +L T     E++C KC
Sbjct  1424  CPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPESIEFICKKC  1479



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01980.1.1 Coiled-coil

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UZ3_TRYB2  unnamed protein product                                 29.6    5.6  


>Q57UZ3_TRYB2 unnamed protein product
Length=483

 Score = 29.6 bits (65),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 99/414 (24%), Positives = 213/414 (51%), Gaps = 14/414 (3%)

Query  20   RARESEARKQSLEQCARRCKTAGTGRDKIQMAEEFQRDNLLISRAIELQREREDEMKLCN  79
            R+ E+E  K+ ++Q     +  G     ++  EE Q+  L + RA  L  E+ DE+K  N
Sbjct  70   RSVEAEEHKRRMQQYDEEQRLCGGNDKPLEQIEEEQQRRLNLERAKTLLDEQYDEVKAMN  129

Query  80   SLLLMSKCQTIRDAQVAEKTLIAKELKAVELDLDRIMEEDRMKAIEEQDKLREQEEIKKK  139
             ++  ++C  +R+AQ+ E+ L  +E    E  ++ +M  +  KA +  ++  EQ+ + +K
Sbjct  130  QIVDEARCIAVRNAQIRERELRKEEEMEYERKMEEMMTAEAEKAAKLYNEREEQQVVARK  189

Query  140  LQFQSLTKQIQLN--KDLREMAVYALEKE--TRRLRQVEENRQKELENKKKLKLMEQEKR  195
                 +  Q++ +  + +R++ +   E+E  TR L  + E  Q E       KL +QEK 
Sbjct  190  KTLAVIKAQLEQHDVERVRKLELLQHEREAMTRHLELLREEAQAE-------KLQQQEKE  242

Query  196  KREIEET---NQALRKLKEEQKEQKMLMNLKIQNILKEKIEAEEQQEREKKQIQLLRDKE  252
            +R +E     N     LK+ Q+E     + +I   +K K E +     E+++I+  +++E
Sbjct  243  RRIMEAVALANAQQISLKKRQQELDEEEDRRIAEFIKRKQERDRLYAEEQQRIRDEKERE  302

Query  253  FARLERERKRNDVMAELQYDMKCRQVQEECDREWRRRELEEQRKRKQMMEELVLCRKQQE  312
             ARL  E++R      L  D++ ++ QEE  R+ RR+E E + +   ++++L   R++Q 
Sbjct  303  VARLRAEQQRAQNTQALLDDIRAQRAQEEYARDMRRKEKERKEREAAVLQDLAQMREKQI  362

Query  313  AYRRQYQAVEQEKCDAMNTLLERQREADVEKEREKQRQAKQRTLEYGQHLQKLMEEKQAQ  372
              R++ +A E+   +     +   ++  +E+ERE++  A+++  E    + K + + + +
Sbjct  363  EERKRMKAEERRLEEEEVERINAVQKVALEQERERKMWARKQHEENSLAVLKQIMDVEER  422

Query  373  KKKLHESRVQDGQRLRQEQQNRIDGLKSSIGRKIIQVRNQKVPEKYLKEVEKQL  426
            +++  +  V +G  +  + + R   +++   RK+ ++    VPE+Y + ++K++
Sbjct  423  RRRERQEYVAEGNSIMMQIREREAAIEAIRQRKLKELEELGVPEEYCQALQKKM  476



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g01990.1.1 Unknown

Length=97
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PUF_DROME  unnamed protein product                                    26.6    3.9  
Q8IMW2_DROME  unnamed protein product                                 26.6    3.9  
A0A0B4LIK5_DROME  unnamed protein product                             26.6    3.9  


>PUF_DROME unnamed protein product
Length=3912

 Score = 26.6 bits (57),  Expect = 3.9, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  49    GALDMFKDFYAGFAQQARQGNEDDNMSNSSEEIL  82
             G L    DFY G  Q        DN  NSSEE L
Sbjct  2745  GVLKSLVDFYLGHKQTDSIDISSDNEDNSSEEAL  2778


>Q8IMW2_DROME unnamed protein product
Length=3912

 Score = 26.6 bits (57),  Expect = 3.9, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  49    GALDMFKDFYAGFAQQARQGNEDDNMSNSSEEIL  82
             G L    DFY G  Q        DN  NSSEE L
Sbjct  2745  GVLKSLVDFYLGHKQTDSIDISSDNEDNSSEEAL  2778


>A0A0B4LIK5_DROME unnamed protein product
Length=3921

 Score = 26.6 bits (57),  Expect = 3.9, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  49    GALDMFKDFYAGFAQQARQGNEDDNMSNSSEEIL  82
             G L    DFY G  Q        DN  NSSEE L
Sbjct  2745  GVLKSLVDFYLGHKQTDSIDISSDNEDNSSEEAL  2778



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02000.1.1 Unknown

Length=140
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FRY_DROME  unnamed protein product                                    32.3    0.11 
GEFR_DICDI  unnamed protein product                                   28.9    1.8  
MICAL_DROME  unnamed protein product                                  28.5    2.6  


>FRY_DROME unnamed protein product
Length=3479

 Score = 32.3 bits (72),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 27/57 (47%), Gaps = 6/57 (11%)

Query  40    PKSKKKFRDESSFATYARAISDVCLNQPSLHKEDNVRNRTS-----NGHSYPVSRSE  91
             P+   K R  S  +   R   D+ +N P L +E+NV  R +     NGH +P+   E
Sbjct  1912  PRGADKIRAASGPSILPRP-EDILINDPELRQEENVELRGTSDAAPNGHPHPLPMPE  1967


>GEFR_DICDI unnamed protein product
Length=1721

 Score = 28.9 bits (63),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (61%), Gaps = 4/41 (10%)

Query  37   LTTPKSKKKFRDESSFATYARAISDVCLNQPSLHKEDNVRN  77
            + TPKSKK F+ ES+     + +S + +N PS  KE  ++N
Sbjct  873  VETPKSKKLFQHESA----KQILSIISMNFPSFEKEFQMQN  909


>MICAL_DROME unnamed protein product
Length=4723

 Score = 28.5 bits (62),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query  72    EDNVRNRTS--NGHSYPVSRSEPTNVYYTHQWKHINDLNRSSRYLFYSNLENFYRQLY  127
             ++N+ +R+S  +G+S+  +RS+P+    T     +  L R++   F S +E    +LY
Sbjct  1333  KENMADRSSLKSGNSFESARSQPSTPLSTPTRVEMEQLERNAPRKFSSEIEAISEKLY  1390



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02010.1.1 Adp-ribosylation

Length=187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARL8_DROME  unnamed protein product                                   345     4e-123
G5EDC6_CAEEL  unnamed protein product                                 324     5e-115
ARF6_DROME  unnamed protein product                                   123     8e-36 


>ARL8_DROME unnamed protein product
Length=186

 Score = 345 bits (884),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)

Query  1    MFVLLNRILDWFKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKI  60
            M  L+NRIL+WFKS+FWKEEMELTLVGLQ SGKTTFVNVIASGQF++DMIPTVGFNMRKI
Sbjct  1    MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKI  60

Query  61   TKGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADTDKLEASRNELHALIEKPQL  120
            T+GNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAAD DKLEASRNELH+L++KPQL
Sbjct  61   TRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQL  120

Query  121  IGIPILVLGNKRDLPNALDEKELIDRMNLCAIQDREICCYSISCKERDNIDITLQWLIAH  180
             GIP+LVLGNKRDLP ALDE  LI+RMNL +IQDREICCYSISCKE+DNIDITLQWLI H
Sbjct  121  AGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQH  180

Query  181  SKSHTR  186
            SKS +R
Sbjct  181  SKSQSR  186


>G5EDC6_CAEEL unnamed protein product
Length=185

 Score = 324 bits (831),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 171/184 (93%), Gaps = 0/184 (0%)

Query  1    MFVLLNRILDWFKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKI  60
            M  ++N++LDW +SLFWKEEMELTLVGLQ SGKTTFVNVIASGQF++DMIPTVGFNMRKI
Sbjct  1    MLAMVNKVLDWIRSLFWKEEMELTLVGLQNSGKTTFVNVIASGQFTEDMIPTVGFNMRKI  60

Query  61   TKGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADTDKLEASRNELHALIEKPQL  120
            TKGNVTIK+WDIGGQPRFRSMWERYCRGVNAIV+MVDAAD +KLEASRNEL  L++KPQL
Sbjct  61   TKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVFMVDAADEEKLEASRNELMQLLDKPQL  120

Query  121  IGIPILVLGNKRDLPNALDEKELIDRMNLCAIQDREICCYSISCKERDNIDITLQWLIAH  180
              IP+LVLGNK+DLP ALDE++LI+RMNL +IQ+REICCYSISCKE++NIDITLQWLI H
Sbjct  121  DAIPVLVLGNKKDLPGALDERQLIERMNLSSIQNREICCYSISCKEKENIDITLQWLIDH  180

Query  181  SKSH  184
            SK+ 
Sbjct  181  SKAQ  184


>ARF6_DROME unnamed protein product
Length=175

 Score = 123 bits (309),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 96/171 (56%), Gaps = 1/171 (1%)

Query  12   FKSLFWKEEMELTLVGLQCSGKTTFVNVIASGQFSQDMIPTVGFNMRKITKGNVTIKVWD  71
               +F  +EM + ++GL  +GKTT +  +  GQ S   IPTVGFN+  +T  NV   VWD
Sbjct  5    LSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQ-SVTTIPTVGFNVETVTYKNVKFNVWD  63

Query  72   IGGQPRFRSMWERYCRGVNAIVYMVDAADTDKLEASRNELHALIEKPQLIGIPILVLGNK  131
            +GGQ + R +W  Y  G   ++++VD AD D+++ +R ELH +I   ++    IL+  NK
Sbjct  64   VGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANK  123

Query  132  RDLPNALDEKELIDRMNLCAIQDREICCYSISCKERDNIDITLQWLIAHSK  182
            +DLP+A+   E+ +++ L  I+DR            D +   L WL ++ K
Sbjct  124  QDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK  174



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02020.1.1 Unknown

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O02360_CAEEL  unnamed protein product                                 30.4    1.1  
Q9VMV9_DROME  unnamed protein product                                 30.0    1.4  
E1JHT6_DROME  unnamed protein product                                 30.0    1.5  


>O02360_CAEEL unnamed protein product
Length=739

 Score = 30.4 bits (67),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 4/68 (6%)

Query  6    TLKLLQDWEMPEDIIKNFTDAGIDCVVLENMLESDWSVLMPDLKNMGYRVKFQMCWQSWV  65
            TL LL  + MP D +      G D   +ENM +    V+  D +  GY   +++   SW 
Sbjct  218  TLTLLDLYGMPSDSLL----LGNDASTVENMGQYSVFVIDSDKELDGYMGNYELEPDSWY  273

Query  66   QSLKNRCS  73
              + N CS
Sbjct  274  TFICNDCS  281


>Q9VMV9_DROME unnamed protein product
Length=595

 Score = 30.0 bits (66),  Expect = 1.4, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (4%)

Query  128  GSFTSQPQ-PLCSTQPPKPTTHNYFQSD  154
            GSFT QP  PL + QP  P+T N++  +
Sbjct  177  GSFTDQPSAPLQAFQPTAPSTANFYDDE  204


>E1JHT6_DROME unnamed protein product
Length=607

 Score = 30.0 bits (66),  Expect = 1.5, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (4%)

Query  128  GSFTSQPQ-PLCSTQPPKPTTHNYFQSD  154
            GSFT QP  PL + QP  P+T N++  +
Sbjct  177  GSFTDQPSAPLQAFQPTAPSTANFYDDE  204



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02030.1.1 Unknown

Length=115
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEU2_DROME  unnamed protein product                                 27.3    2.9  
A1Z9M5_DROME  unnamed protein product                                 26.9    4.4  
SOS_DROME  unnamed protein product                                    26.6    6.2  


>Q9VEU2_DROME unnamed protein product
Length=261

 Score = 27.3 bits (59),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 25/52 (48%), Gaps = 1/52 (2%)

Query  36   VLLCCEYALGNTLWKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDFFKN  87
            VLLCC   LGNT+W ++ + +    + + L+     +S G +      F K 
Sbjct  155  VLLCCSMILGNTVW-VDVIGMGVGHIYYVLEDVYPTLSNGYRLIKTPYFLKR  205


>A1Z9M5_DROME unnamed protein product
Length=4012

 Score = 26.9 bits (58),  Expect = 4.4, Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query  49   WKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDFFKNSKLSLPNEGVMFTLWKEELLH  108
            W++ D  V+ D+++  ++     I V E  E++    KN+ +S  NE +   L KE   H
Sbjct  520  WRVLDEKVHTDVIEKIVEAPKKTIYVDEFVEIE----KNTSISENNENITLNL-KETSKH  574


>SOS_DROME unnamed protein product
Length=1596

 Score = 26.6 bits (57),  Expect = 6.2, Method: Composition-based stats.
 Identities = 24/90 (27%), Positives = 42/90 (47%), Gaps = 9/90 (10%)

Query  25   MFVVKLCVALCVLLCCEYALGNTLWKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDF  84
            ++V KLC+ L  +LC +  L +++  +E+       V  +    I Q ++ E  E+    
Sbjct  96   LYVEKLCLRLLAMLCAK-PLPHSVQDVEEK------VNKSFPAPIDQWALNEAKEVINS-  147

Query  85   FKNSKLSLPNEGVMFTLWKEELLHCTSSNL  114
             K  K  LP E V   L K+ L +   S++
Sbjct  148  -KKRKSVLPTEKVHTLLQKDVLQYKIDSSV  176



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02040.1.1 Unknown

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEU2_DROME  unnamed protein product                                 31.2    0.26 
A0A0B4KF84_DROME  unnamed protein product                             29.6    0.85 
A0A0B4KG35_DROME  unnamed protein product                             29.6    0.85 


>Q9VEU2_DROME unnamed protein product
Length=261

 Score = 31.2 bits (69),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (51%), Gaps = 1/53 (2%)

Query  12   VLLCCEYALGNTLWKIEDVDVNDDIVQHALKTAITQISVGEKAEMKKDFFKKL  64
            VLLCC   LGNT+W ++ + +    + + L+     +S G +      F K+L
Sbjct  155  VLLCCSMILGNTVW-VDVIGMGVGHIYYVLEDVYPTLSNGYRLIKTPYFLKRL  206


>A0A0B4KF84_DROME unnamed protein product
Length=8216

 Score = 29.6 bits (65),  Expect = 0.85, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 3/43 (7%)

Query  34    DDIVQHALKTAITQISVGEKAEMKKDFF--KKLKAVSAKRRGN  74
             +D+V H+++  I +    EK ++ K+F   K+LKA SAK++G+
Sbjct  2586  EDVVDHSIEKKIEEPKRSEKKDLDKEFLEEKELKA-SAKKQGD  2627


>A0A0B4KG35_DROME unnamed protein product
Length=8255

 Score = 29.6 bits (65),  Expect = 0.85, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 3/43 (7%)

Query  34    DDIVQHALKTAITQISVGEKAEMKKDFF--KKLKAVSAKRRGN  74
             +D+V H+++  I +    EK ++ K+F   K+LKA SAK++G+
Sbjct  2625  EDVVDHSIEKKIEEPKRSEKKDLDKEFLEEKELKA-SAKKQGD  2666



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02050.1.1 Irregular

Length=233
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MSN7_DROME  unnamed protein product                                 80.9    2e-17
Q9W4T9_DROME  unnamed protein product                                 80.5    3e-17
O97174_DROME  unnamed protein product                                 80.5    3e-17


>Q8MSN7_DROME unnamed protein product
Length=551

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 20/218 (9%)

Query  16   QTFDREPVSTEVNPDSDTKLDCKVLNKKGTCSWQKDNKPVGIY-----FKKYEWVNPDES  70
            Q F  EP        S   L C+V+ K G   W KD+  +G +     F++Y  V  DE 
Sbjct  82   QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEE  141

Query  71   SGDCSLWIRSATLDFDDGEWECQITASDFTTQDALTSRPVRLIVRVEPQAPRIEYKASAV  130
             GD SL I    LD DD +++CQ+       Q  + SR  +L V V P+AP+I       
Sbjct  142  -GDFSLDIYPLMLD-DDAKYQCQVGPGPQGEQ-GIRSRFAKLTVLVPPEAPKITQ-----  193

Query  131  LPGHNVTVKAGEKATVKCVSRYGNPPAKLKWFLGDEELIAKSNQ-TNSPEADNRRTWSAL  189
              G  +      +  ++CVS+ G P A++ W  G   ++ K  +    P AD+RR  +A 
Sbjct  194  --GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRI-TAR  250

Query  190  SVIEISAEKSQNGRMLRCVALH---ESYPSKSLSVDVR  224
            S+++++ +K  +     C A +    +Y S  L ++V+
Sbjct  251  SILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVK  288


>Q9W4T9_DROME unnamed protein product
Length=956

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 20/218 (9%)

Query  16   QTFDREPVSTEVNPDSDTKLDCKVLNKKGTCSWQKDNKPVGIY-----FKKYEWVNPDES  70
            Q F  EP        S   L C+V+ K G   W KD+  +G +     F++Y  V  DE 
Sbjct  82   QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEE  141

Query  71   SGDCSLWIRSATLDFDDGEWECQITASDFTTQDALTSRPVRLIVRVEPQAPRIEYKASAV  130
             GD SL I    LD DD +++CQ+       Q  + SR  +L V V P+AP+I       
Sbjct  142  -GDFSLDIYPLMLD-DDAKYQCQVGPGPQGEQ-GIRSRFAKLTVLVPPEAPKITQ-----  193

Query  131  LPGHNVTVKAGEKATVKCVSRYGNPPAKLKWFLGDEELIAKSNQ-TNSPEADNRRTWSAL  189
              G  +      +  ++CVS+ G P A++ W  G   ++ K  +    P AD+RR  +A 
Sbjct  194  --GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRI-TAR  250

Query  190  SVIEISAEKSQNGRMLRCVALH---ESYPSKSLSVDVR  224
            S+++++ +K  +     C A +    +Y S  L ++V+
Sbjct  251  SILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVK  288


>O97174_DROME unnamed protein product
Length=975

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 20/218 (9%)

Query  16   QTFDREPVSTEVNPDSDTKLDCKVLNKKGTCSWQKDNKPVGIY-----FKKYEWVNPDES  70
            Q F  EP        S   L C+V+ K G   W KD+  +G +     F++Y  V  DE 
Sbjct  82   QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEE  141

Query  71   SGDCSLWIRSATLDFDDGEWECQITASDFTTQDALTSRPVRLIVRVEPQAPRIEYKASAV  130
             GD SL I    LD DD +++CQ+       Q  + SR  +L V V P+AP+I       
Sbjct  142  -GDFSLDIYPLMLD-DDAKYQCQVGPGPQGEQ-GIRSRFAKLTVLVPPEAPKITQ-----  193

Query  131  LPGHNVTVKAGEKATVKCVSRYGNPPAKLKWFLGDEELIAKSNQ-TNSPEADNRRTWSAL  189
              G  +      +  ++CVS+ G P A++ W  G   ++ K  +    P AD+RR  +A 
Sbjct  194  --GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRI-TAR  250

Query  190  SVIEISAEKSQNGRMLRCVALH---ESYPSKSLSVDVR  224
            S+++++ +K  +     C A +    +Y S  L ++V+
Sbjct  251  SILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVK  288



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02060.1.1 Elongation

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHX7_DROME  unnamed protein product                                 394     2e-137
Q9VCY6_DROME  unnamed protein product                                 267     8e-88 
Q9VCY7_DROME  unnamed protein product                                 215     3e-67 


>Q9VHX7_DROME unnamed protein product
Length=329

 Score = 394 bits (1013),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 238/308 (77%), Gaps = 6/308 (2%)

Query  21   DFYFDVMNNRSDPRVKDWFLMSGPLPTVCICLSYAFIVKIVGPKLMEDRKPFQLRKTLIV  80
            D + D+M+N+SDPR +D+ LMS P PT+ I L+YA+IVK++GPKLME+RKPF+LRK LIV
Sbjct  9    DGWRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIV  68

Query  81   YNFLQVLFSSWLFYEAMDGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFD  140
            YN  QV+FS+WLFYE+  G W   Y+LRCEPV+YS +PKA+R A GCWWY+FSKFTEFFD
Sbjct  69   YNAAQVIFSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFD  128

Query  141  TFFFVMRKKYDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFVHIIMYFYYML  200
            TFFFVMRK+YDQVSTLHVIHHG+MP+S W+GVKFTPGGHSTFFG LNTFVHI MY YYML
Sbjct  129  TFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYML  188

Query  201  AAFGPHMQKYLWWKKYLTSLQMIQFVCILIHAFQLFFI-ECDYPKAFAWWIGGHAVMFYF  259
            AA GP +QKYLWWKKYLT +QMIQFV +++H+FQLFF  +C+YP  FA++IG HAVMFYF
Sbjct  189  AAMGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYF  248

Query  260  LFSNFYKETYVKKPKKDGAAPQVTREKNGHANNSK-----PKTNGAPSSFAGRLFAFQTP  314
            LFSNFYK  YVK+  KD A+ +     NGH    K     P +NG  + F      F T 
Sbjct  249  LFSNFYKRAYVKRDGKDKASVKANGHANGHVKALKDGDVAPTSNGQANGFHNTFSKFTTD  308

Query  315  CFLPAVTD  322
               PA+  
Sbjct  309  MCNPALNS  316


>Q9VCY6_DROME unnamed protein product
Length=295

 Score = 267 bits (682),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 169/246 (69%), Gaps = 2/246 (1%)

Query  21   DFYFDVMNNRSDPRVKDWFLMSGPLPTVCICLSYAFIVKIVGPKLMEDRKPFQLRKTLIV  80
            D++  +  + +DPR  DWFL+  PLP + I   Y F V   GPK M+DRKPF+L +TL+V
Sbjct  10   DYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLV  69

Query  81   YNFLQVLFSSWLFYEAMDGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFD  140
            YNF QV  S W+ YE +    ++ YS RC+PVD+S TPKA R AR  + Y+ +K TE  D
Sbjct  70   YNFFQVALSVWMVYEGV--VIWQYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLD  127

Query  141  TFFFVMRKKYDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFVHIIMYFYYML  200
            T FFV+RK   QV+ LHV HH VMP+ +W   K+ PGGH TF G +N+FVHIIMY YY L
Sbjct  128  TIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFL  187

Query  201  AAFGPHMQKYLWWKKYLTSLQMIQFVCILIHAFQLFFIECDYPKAFAWWIGGHAVMFYFL  260
            +AFGP MQKYLWWKKY+T+LQMIQF C  IH  QL + +C YP+    +   +AV FYFL
Sbjct  188  SAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFL  247

Query  261  FSNFYK  266
            F++FY+
Sbjct  248  FNDFYQ  253


>Q9VCY7_DROME unnamed protein product
Length=322

 Score = 215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 154/250 (62%), Gaps = 4/250 (2%)

Query  32   DPRVKDWFLMSGPLPTVCICLSYAFIVKIVGPKLMEDRKPFQLRKTLIVYNFLQVLFSSW  91
            D  V  WFLMS P+P V + L Y   V  +GP+ M++RKP  L++ ++ YN  QVL+S W
Sbjct  20   DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIW  79

Query  92   LFYEAM--DGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFDTFFFVMRKK  149
            +   ++         +S +CE     T  + + +  G W+YFFSK  +  DT FFV+RKK
Sbjct  80   MCRTSIQESNVMASIFSKKCEI--NRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKK  137

Query  150  YDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFVHIIMYFYYMLAAFGPHMQK  209
             +QVS LHV HH +  L +W  +K+ PG      G+LN+ VHIIMYFYYM+AA GP  QK
Sbjct  138  DNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQK  197

Query  210  YLWWKKYLTSLQMIQFVCILIHAFQLFFIECDYPKAFAWWIGGHAVMFYFLFSNFYKETY  269
            YLWWKKY+TS+Q+IQFV IL +   +    C+ PK   ++  G+ V+F +LF NFY++TY
Sbjct  198  YLWWKKYMTSIQLIQFVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTY  257

Query  270  VKKPKKDGAA  279
             K    DG +
Sbjct  258  KKAKSVDGGS  267



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02070.1.1 Zinc

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCY3_DROME  unnamed protein product                                 156     2e-39
O61360_DROME  unnamed protein product                                 155     4e-39
O61361_DROME  unnamed protein product                                 154     9e-39


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 179/420 (43%), Gaps = 56/420 (13%)

Query  332  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVA  451
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C +T+        HV 
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDFCSKTFTRKEHLLNHV-  380

Query  452  ACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARH  511
              R+   +    C  C + F+ ++ L++H   H GE   + C +  CT+ F     +  H
Sbjct  381  --RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKCTY--CTKAFTRKDHMVNH  435

Query  512  VSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQ  569
            V  H  +  + C  C   FT K  LT H+ R HTG   + C+ C   F     L  HVR 
Sbjct  436  VRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  494

Query  570  HTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCT  629
            HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++ F R   L  H +  H  
Sbjct  495  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554

Query  630  GEMYECCHCARSFP--------------------------------CKSYLIPHLRVHTG  657
               + C  C +SFP                                CK +L+ H+R H+G
Sbjct  555  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  614

Query  658  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  714
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  615  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  674


 Score = 148 bits (374),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 152/339 (45%), Gaps = 33/339 (10%)

Query  376  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  435
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  436  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------  487
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE        
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  488  -----ERRYVCNHMQ------------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMF  528
                  + ++ NH++            C++ F     L  HV  H  +  + C  C   F
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  398

Query  529  TCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRK  588
            T K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF RK
Sbjct  399  TRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRK  457

Query  589  ATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYL  648
              + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +L
Sbjct  458  EHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHL  516

Query  649  IPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  687
              H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  517  NNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  555


 Score = 112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 107/223 (48%), Gaps = 33/223 (15%)

Query  461  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  520
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  521  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  580
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  581  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  639
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C+
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDFCS  367

Query  640  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKK  682
            ++F  K +L+ H+R HTGE P+ C+ C   + R   LV H+++
Sbjct  368  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  410


>O61360_DROME unnamed protein product
Length=962

 Score = 155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  332  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  445
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  446  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  486
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  487  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  544
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ET-PHRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  545  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  604
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  605  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  664
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  665  LCTVRYLRSYELVLHLKKCHRED  687
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 152 bits (384),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 168/360 (47%), Gaps = 19/360 (5%)

Query  365  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  424
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  425  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  484
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  485  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  542
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  543  TGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLM-LHTGA  601
            TG   + C  C   F     L  H+RQH+ + P  C VC + F RK  + +H+   HTG 
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  602  KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSFPCKSYLIPHLRVHTG  657
            +P+ C  C + F     L  H   +H  G+  E    C  C ++F CK +L+ H+R H+G
Sbjct  640  RPFTCETCGKSFPLKGNLLFH-QRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  658  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  714
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  758


 Score = 146 bits (368),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  376  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  435
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  436  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  495
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  496  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  553
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  554  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  613
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  614  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  672
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  673  SYELVLHLKK  682
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 165/379 (44%), Gaps = 56/379 (15%)

Query  336  TCGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
             C  CG +F+F    I   RYH                E K + C  C +   T   L  
Sbjct  222  VCDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTR  266

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVA  451
            H ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+    + K+H+ 
Sbjct  267  HGKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTF----ARKEHLD  321

Query  452  ACREKRRKET-FPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHM  496
                    ET F C+ C + F+ ++ +++H   H GE              +  YV ++M
Sbjct  322  NHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  497  Q-----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHT  543
                        C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HT
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHT  440

Query  544  GSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKP  603
            G   + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P
Sbjct  441  GETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP  500

Query  604  YACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYA  662
            + CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ 
Sbjct  501  FKCTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHR  558

Query  663  CNLCTVRYLRSYELVLHLK  681
            C+ C   + R   L  H++
Sbjct  559  CSYCKKTFTRKEHLTNHVR  577


 Score = 107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  461  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  520
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  521  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  580
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  581  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  639
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  640  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  681
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  547  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  606
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  607  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  666
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  667  TVRYLRSYELVLHLKK  682
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354


>O61361_DROME unnamed protein product
Length=891

 Score = 154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  332  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  391
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  392  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  445
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  446  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  486
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  487  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  544
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ETP-HRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  545  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  604
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  605  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  664
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  665  LCTVRYLRSYELVLHLKKCHRED  687
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 145 bits (366),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  376  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  435
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  436  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  495
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  496  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  553
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  554  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  613
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  614  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  672
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  673  SYELVLHLKK  682
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 108/377 (29%), Positives = 161/377 (43%), Gaps = 54/377 (14%)

Query  337  CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  392
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  393  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  452
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  453  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  497
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  498  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  545
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  546  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  605
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  606  CTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACN  664
            CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ C+
Sbjct  503  CTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCS  560

Query  665  LCTVRYLRSYELVLHLK  681
             C   + R   L  H++
Sbjct  561  YCKKTFTRKEHLTNHVR  577


 Score = 134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 140/304 (46%), Gaps = 14/304 (5%)

Query  374  YQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSC  433
            +QC  C K+   +  L  H+R H+ E  F CE C  SF +K H  +H+   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHI-LWHTGETPHRC  447

Query  434  NSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVC  493
            + C +T+        HV   R+   +    C  C + F+ ++ L++H   H GE   + C
Sbjct  448  DFCSKTFTRKEHLLNHV---RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKC  503

Query  494  NHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCT  551
             +  CT+ F     +  HV  H  +  + C  C   FT K  LT H+ R HTG   + C+
Sbjct  504  TY--CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCS  560

Query  552  QCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQ  611
             C   F     L  HVR HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++
Sbjct  561  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNK  620

Query  612  KFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG----EKPYACNLCT  667
             F R   L  H +  H     + C  C +SFP K  L+ H R HT     E+P+AC  C 
Sbjct  621  PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCP  680

Query  668  VRYL  671
              ++
Sbjct  681  KNFI  684


 Score = 106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  461  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  520
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  521  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  580
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  581  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  639
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  640  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  681
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 117/284 (41%), Gaps = 43/284 (15%)

Query  365  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  424
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  425  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  484
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  485  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  542
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  543  TGSLSYPCTQCPGKFYSAYELRQHVRQH-----------------------------TDE  573
            TG   + C  C   F     L  H+RQH                             T +
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  574  RPFPCPVCQRTFRRKATMESHLMLHTGA----KPYACTECDQKF  613
            RPF C  C ++F  K  +  H   HT      +P+AC +C + F
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  547  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  606
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  607  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  666
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  667  TVRYLRSYELVLHLKK  682
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02070.1.2 Zinc

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCY3_DROME  unnamed protein product                                 157     1e-39
O61360_DROME  unnamed protein product                                 157     3e-39
O61361_DROME  unnamed protein product                                 155     4e-39


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 179/420 (43%), Gaps = 56/420 (13%)

Query  365  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  424
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  425  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVA  484
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C +T+        HV 
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDFCSKTFTRKEHLLNHV-  380

Query  485  ACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARH  544
              R+   +    C  C + F+ ++ L++H   H GE   + C +  CT+ F     +  H
Sbjct  381  --RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKCTY--CTKAFTRKDHMVNH  435

Query  545  VSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQ  602
            V  H  +  + C  C   FT K  LT H+ R HTG   + C+ C   F     L  HVR 
Sbjct  436  VRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  494

Query  603  HTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCT  662
            HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++ F R   L  H +  H  
Sbjct  495  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554

Query  663  GEMYECCHCARSFP--------------------------------CKSYLIPHLRVHTG  690
               + C  C +SFP                                CK +L+ H+R H+G
Sbjct  555  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  614

Query  691  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  747
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  615  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  674


 Score = 149 bits (376),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 152/339 (45%), Gaps = 33/339 (10%)

Query  409  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  468
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  469  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------  520
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE        
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  521  -----ERRYVCNHMQ------------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMF  561
                  + ++ NH++            C++ F     L  HV  H  +  + C  C   F
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  398

Query  562  TCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRK  621
            T K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF RK
Sbjct  399  TRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRK  457

Query  622  ATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYL  681
              + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +L
Sbjct  458  EHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHL  516

Query  682  IPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  720
              H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  517  NNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  555


 Score = 112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 107/223 (48%), Gaps = 33/223 (15%)

Query  494  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  553
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  554  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  613
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  614  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  672
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C+
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDFCS  367

Query  673  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKK  715
            ++F  K +L+ H+R HTGE P+ C+ C   + R   LV H+++
Sbjct  368  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  410


>O61360_DROME unnamed protein product
Length=962

 Score = 157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  365  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  424
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  425  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  478
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  479  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  519
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  520  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  577
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ET-PHRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  578  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  637
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  638  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  698  LCTVRYLRSYELVLHLKKCHRED  720
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 168/360 (47%), Gaps = 19/360 (5%)

Query  398  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  457
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  458  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  517
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  518  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  575
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  576  TGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLM-LHTGA  634
            TG   + C  C   F     L  H+RQH+ + P  C VC + F RK  + +H+   HTG 
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  635  KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSFPCKSYLIPHLRVHTG  690
            +P+ C  C + F     L  H   +H  G+  E    C  C ++F CK +L+ H+R H+G
Sbjct  640  RPFTCETCGKSFPLKGNLLFH-QRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  691  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  747
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  758


 Score = 147 bits (370),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  409  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  468
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  469  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  528
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  529  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  586
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  587  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  646
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  647  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  705
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  706  SYELVLHLKK  715
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 108/377 (29%), Positives = 161/377 (43%), Gaps = 54/377 (14%)

Query  370  CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  425
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  426  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  485
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  486  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  530
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  531  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  578
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  579  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  638
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  639  CTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
            CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ C+
Sbjct  503  CTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCS  560

Query  698  LCTVRYLRSYELVLHLK  714
             C   + R   L  H++
Sbjct  561  YCKKTFTRKEHLTNHVR  577


 Score = 107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  494  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  553
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  554  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  613
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  614  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  672
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  673  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  714
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  580  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  639
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  640  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  699
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  700  TVRYLRSYELVLHLKK  715
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354


>O61361_DROME unnamed protein product
Length=891

 Score = 155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 172/383 (45%), Gaps = 44/383 (11%)

Query  365  AEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMV  424
               FTC  C  +F   ++   HM            +   +K + C  C K  A +  L  
Sbjct  274  GPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPFACTICQKTFARKEHLDN  322

Query  425  HLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQT------WLGYTS  478
            H R H+GE  F C+YC+ +F +K H+ +HV K H       C+ C ++      ++ +  
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYM  381

Query  479  W------------------KQHVAACREKRRKET-FPCKRCDERFSTRDELISHSSYHGG  519
            W                  K+H+A        ET F C+ C + FS ++   +H  +H G
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  520  EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTG  577
            E   + C+   C++ F     L  HV  H  +  + C  C   FT K  L  H+ R HTG
Sbjct  442  ETP-HRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI-RQHTG  497

Query  578  SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPY  637
               + CT C   F     +  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+
Sbjct  498  ETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  557

Query  638  ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
             C+ C + F R   L  H  L H     ++C +C ++F  K +L  H+R H+ + P+ CN
Sbjct  558  RCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCN  616

Query  698  LCTVRYLRSYELVLHLKKCHRED  720
            +C   + R   L+ H+ +CH  D
Sbjct  617  VCNKPFTRKEHLINHMSRCHTGD  639


 Score = 146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 145/310 (47%), Gaps = 13/310 (4%)

Query  409  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  468
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  469  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  528
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  529  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  586
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  587  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  646
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  647  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  705
             R   L  H      TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNHVRQH--TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  706  SYELVLHLKK  715
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 108/377 (29%), Positives = 161/377 (43%), Gaps = 54/377 (14%)

Query  370  CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  425
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  426  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  485
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  486  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  530
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  531  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  578
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  579  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  638
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  639  CTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACN  697
            CT C + F R   +  H      TGE  ++C +C ++F  K +L  H+R HTG+ P+ C+
Sbjct  503  CTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCS  560

Query  698  LCTVRYLRSYELVLHLK  714
             C   + R   L  H++
Sbjct  561  YCKKTFTRKEHLTNHVR  577


 Score = 136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 140/304 (46%), Gaps = 14/304 (5%)

Query  407  YQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSC  466
            +QC  C K+   +  L  H+R H+ E  F CE C  SF +K H  +H+   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHI-LWHTGETPHRC  447

Query  467  NSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVC  526
            + C +T+        HV   R+   +    C  C + F+ ++ L++H   H GE   + C
Sbjct  448  DFCSKTFTRKEHLLNHV---RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKC  503

Query  527  NHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCT  584
             +  CT+ F     +  HV  H  +  + C  C   FT K  LT H+ R HTG   + C+
Sbjct  504  TY--CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCS  560

Query  585  QCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQ  644
             C   F     L  HVR HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++
Sbjct  561  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNK  620

Query  645  KFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG----EKPYACNLCT  700
             F R   L  H +  H     + C  C +SFP K  L+ H R HT     E+P+AC  C 
Sbjct  621  PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCP  680

Query  701  VRYL  704
              ++
Sbjct  681  KNFI  684


 Score = 106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  494  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  553
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  554  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  613
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  614  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  672
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  673  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  714
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 117/284 (41%), Gaps = 43/284 (15%)

Query  398  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  457
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  458  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  517
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  518  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  575
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  576  TGSLSYPCTQCPGKFYSAYELRQHVRQH-----------------------------TDE  606
            TG   + C  C   F     L  H+RQH                             T +
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  607  RPFPCPVCQRTFRRKATMESHLMLHTGA----KPYACTECDQKF  646
            RPF C  C ++F  K  +  H   HT      +P+AC +C + F
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  580  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  639
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  640  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  699
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  700  TVRYLRSYELVLHLKK  715
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02070.1.3 Zinc

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCY3_DROME  unnamed protein product                                 156     9e-41
O61360_DROME  unnamed protein product                                 155     3e-40
O61361_DROME  unnamed protein product                                 154     3e-40


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 122/435 (28%), Positives = 189/435 (43%), Gaps = 53/435 (12%)

Query  66   GYRVTTPIKRKFQV-TPAEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGY  124
            G+  +  + R  ++      FTC  C  +F   ++   HM            +   +K +
Sbjct  257  GFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPF  305

Query  125  QCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCN  184
             C  C K  A +  L  H R H+GE  F C+YC+ +F +K H+ +HV K H       C+
Sbjct  306  ACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCD  364

Query  185  SCGQTWL-------------------------GYTSWKQHVAACREKRRKETFPCKRCDE  219
             C +T+                           +T  +  V   R+   +  F C  C +
Sbjct  365  FCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTK  424

Query  220  RFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHM  277
             F+ +D +++H   H GE   + C +  CT+ F     L  HV  H     + C  C   
Sbjct  425  AFTRKDHMVNHVRQHTGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKT  481

Query  278  FTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRR  337
            FT K  LT H+ RLHTG   + C  C   F     L  H+RQH+ + P  C VC + F R
Sbjct  482  FTRKEHLTNHV-RLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  540

Query  338  KATMESHLM-LHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSF  392
            K  + +H+   HTG +P+ C  C + F     L  H   +H  G+  E    C  C ++F
Sbjct  541  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQR-SHTKGQEMERPFACEKCPKNF  599

Query  393  PCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDV  449
             CK +L+ H+R H+GEKP+AC LC+  ++    L  H+K  H +    P        +  
Sbjct  600  ICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPA  659

Query  450  NTVAQVKQEYEELPV  464
              + QVKQE + + +
Sbjct  660  GVLTQVKQEVKPIII  674


 Score = 147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 152/339 (45%), Gaps = 33/339 (10%)

Query  126  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  185
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  186  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------  237
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE        
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  238  -----ERRYVCNHMQ------------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMF  278
                  + ++ NH++            C++ F     L  HV  H  +  + C  C   F
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  398

Query  279  TCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRK  338
            T K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF RK
Sbjct  399  TRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRK  457

Query  339  ATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYL  398
              + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +L
Sbjct  458  EHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHL  516

Query  399  IPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  437
              H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  517  NNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  555


 Score = 110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 107/223 (48%), Gaps = 33/223 (15%)

Query  211  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  270
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  271  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  330
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  331  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  389
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C+
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDFCS  367

Query  390  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKK  432
            ++F  K +L+ H+R HTGE P+ C+ C   + R   LV H+++
Sbjct  368  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  410


>O61360_DROME unnamed protein product
Length=962

 Score = 155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/400 (29%), Positives = 179/400 (45%), Gaps = 45/400 (11%)

Query  66   GYRVTTPIKRKFQV-TPAEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGY  124
            G+  +  + R  ++      FTC  C  +F   ++   HM            +   +K +
Sbjct  257  GFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPF  305

Query  125  QCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCN  184
             C  C K  A +  L  H R H+GE  F C+YC+ +F +K H+ +HV K H       C+
Sbjct  306  ACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCD  364

Query  185  SCGQT------WLGYTSW------------------KQHVAACREKRRKET-FPCKRCDE  219
             C ++      ++ +  W                  K+H+A        ET F C+ C +
Sbjct  365  ICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGK  424

Query  220  RFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHM  277
             FS ++   +H  +H GE   + C+   C++ F     L  HV  H  +  + C  C   
Sbjct  425  SFSRKEHFTNHILWHTGET-PHRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKT  481

Query  278  FTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRR  337
            FT K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF R
Sbjct  482  FTRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTR  540

Query  338  KATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSY  397
            K  + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +
Sbjct  541  KEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEH  599

Query  398  LIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  437
            L  H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  600  LNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639


 Score = 152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 168/360 (47%), Gaps = 19/360 (5%)

Query  115  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  174
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  175  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  234
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  235  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  292
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  293  TGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLM-LHTGA  351
            TG   + C  C   F     L  H+RQH+ + P  C VC + F RK  + +H+   HTG 
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  352  KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYE----CCHCARSFPCKSYLIPHLRVHTG  407
            +P+ C  C + F     L  H   +H  G+  E    C  C ++F CK +L+ H+R H+G
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQR-SHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  408  EKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAF---VDVNTVAQVKQEYEELPV  464
            EKP+AC LC+  ++    L  H+K  H +    P        +    + QVKQE + + +
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIII  758


 Score = 145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 143/309 (46%), Gaps = 11/309 (4%)

Query  126  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  185
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  186  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  245
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  246  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  303
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  304  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  363
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  364  NRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRS  423
             R   L  H    H     + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R 
Sbjct  455  TRKEHLLNHVR-QHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRK  513

Query  424  YELVLHLKK  432
              +V H+++
Sbjct  514  DHMVNHVRQ  522


 Score = 135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 105/376 (28%), Positives = 161/376 (43%), Gaps = 52/376 (14%)

Query  87   CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  142
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  143  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  202
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  203  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  247
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  248  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  295
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  296  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  355
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  356  CTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNL  415
            CT C + F R   + +++   H     ++C +C ++F  K +L  H+R HTG+ P+ C+ 
Sbjct  503  CTYCTKAFTRKDHM-VNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSY  561

Query  416  CTVRYLRSYELVLHLK  431
            C   + R   L  H++
Sbjct  562  CKKTFTRKEHLTNHVR  577


 Score = 105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  211  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  270
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  271  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  330
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  331  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  389
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  390  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  431
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  297  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  356
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  357  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  416
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  417  TVRYLRSYELVLHLKK  432
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354


>O61361_DROME unnamed protein product
Length=891

 Score = 154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/400 (29%), Positives = 179/400 (45%), Gaps = 45/400 (11%)

Query  66   GYRVTTPIKRKFQV-TPAEWFTCGKCGTIFKFISTYRYHMDTECNTKAVLMVKQKEEKGY  124
            G+  +  + R  ++      FTC  C  +F   ++   HM            +   +K +
Sbjct  257  GFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMK-----------RHSTDKPF  305

Query  125  QCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCN  184
             C  C K  A +  L  H R H+GE  F C+YC+ +F +K H+ +HV K H       C+
Sbjct  306  ACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETPHRCD  364

Query  185  SCGQT------WLGYTSW------------------KQHVAACREKRRKET-FPCKRCDE  219
             C ++      ++ +  W                  K+H+A        ET F C+ C +
Sbjct  365  ICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGK  424

Query  220  RFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHM  277
             FS ++   +H  +H GE   + C+   C++ F     L  HV  H  +  + C  C   
Sbjct  425  SFSRKEHFTNHILWHTGETP-HRCDF--CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKT  481

Query  278  FTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRR  337
            FT K  L  H+ R HTG   + CT C   F     +  HVRQHT E P  C  C +TF R
Sbjct  482  FTRKEHLVNHI-RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTR  540

Query  338  KATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSY  397
            K  + +H+  HTG  P+ C+ C + F R   L  H  L H     ++C +C ++F  K +
Sbjct  541  KEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEH  599

Query  398  LIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRED  437
            L  H+R H+ + P+ CN+C   + R   L+ H+ +CH  D
Sbjct  600  LNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639


 Score = 145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 146/310 (47%), Gaps = 13/310 (4%)

Query  126  CPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNS  185
            C  C K    R  L+VH R HS  + F C+ C   F     L  H  KIH+    F+C  
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIV  281

Query  186  CGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVCNH  245
            C   +   TS ++H+   +     + F C  C + F+ ++ L +H   H GE   + C +
Sbjct  282  CFNVFANNTSLERHM---KRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP-FRCQY  337

Query  246  MQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCTQC  303
              C + F     +  HV  H  +  + C IC   FT K     H    HTG   + C  C
Sbjct  338  --CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDVC  394

Query  304  PGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQKF  363
              K+     L  H+R HT+E PF C +C ++F RK    +H++ HTG  P+ C  C + F
Sbjct  395  GKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF  454

Query  364  NRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR  422
             R   L  H  +   TGE  + C +C ++F  K +L+ H+R HTGE P+ C  CT  + R
Sbjct  455  TRKEHLLNH--VRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  423  SYELVLHLKK  432
               +V H+++
Sbjct  513  KDHMVNHVRQ  522


 Score = 135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 140/304 (46%), Gaps = 14/304 (5%)

Query  124  YQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSC  183
            +QC  C K+   +  L  H+R H+ E  F CE C  SF +K H  +H+   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHI-LWHTGETPHRC  447

Query  184  NSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYHGGEERRYVC  243
            + C +T+        HV   R+   +    C  C + F+ ++ L++H   H GE   + C
Sbjct  448  DFCSKTFTRKEHLLNHV---RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKC  503

Query  244  NHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGSLSYPCT  301
             +  CT+ F     +  HV  H  +  + C  C   FT K  LT H+ R HTG   + C+
Sbjct  504  TY--CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCS  560

Query  302  QCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYACTECDQ  361
             C   F     L  HVR HT + P  C  CQ+TF RK  + +H+  H+   P+ C  C++
Sbjct  561  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNK  620

Query  362  KFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG----EKPYACNLCT  417
             F R   L  H +  H     + C  C +SFP K  L+ H R HT     E+P+AC  C 
Sbjct  621  PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCP  680

Query  418  VRYL  421
              ++
Sbjct  681  KNFI  684


 Score = 135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 105/376 (28%), Positives = 161/376 (43%), Gaps = 52/376 (14%)

Query  87   CGKCGTIFKF----ISTYRYHMDTECNTKAVLMVKQKEEKGYQCPQCPKQVATRTSLMVH  142
            C  CG +F+F    I   RYH                E K + C  C +   T   L  H
Sbjct  223  CDICGKMFQFRYQLIVHRRYH---------------SERKPFMCQVCGQGFTTSQDLTRH  267

Query  143  LRLHSGERRFPCEYCSLSFYQKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAA  202
             ++H G   F C  C   F     L+ H+ K H   K F+C  C +T+        H   
Sbjct  268  GKIHIGGPMFTCIVCFNVFANNTSLERHM-KRHSTDKPFACTICQKTFARKEHLDNHF--  324

Query  203  CREKRRKETFPCKRCDERFSTRDELISHSSYHGGE--------------ERRYVCNHMQ-  247
             R    +  F C+ C + F+ ++ +++H   H GE              +  YV ++M  
Sbjct  325  -RSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH  383

Query  248  ----------CTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLHTGS  295
                      C +++     LA H+ +H  +  + C ICG  F+ K   T H+   HTG 
Sbjct  384  TGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGE  442

Query  296  LSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYA  355
              + C  C   F     L  HVRQHT E P  C  C +TF RK  + +H+  HTG  P+ 
Sbjct  443  TPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK  502

Query  356  CTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNL  415
            CT C + F R   + +++   H     ++C +C ++F  K +L  H+R HTG+ P+ C+ 
Sbjct  503  CTYCTKAFTRKDHM-VNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSY  561

Query  416  CTVRYLRSYELVLHLK  431
            C   + R   L  H++
Sbjct  562  CKKTFTRKEHLTNHVR  577


 Score = 105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 103/222 (46%), Gaps = 33/222 (15%)

Query  211  TFPCKRCDERFSTRDELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYT  270
            T  C  C + F  R +LI H  YH   ER+                            + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYH--SERK---------------------------PFM  250

Query  271  CHICGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPV  330
            C +CG  FT  + LT+H  ++H G   + C  C   F +   L +H+++H+ ++PF C +
Sbjct  251  CQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI  309

Query  331  CQRTFRRKATMESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCA  389
            CQ+TF RK  +++H   HTG  P+ C  C + F R   +  H      TGE  + C  C 
Sbjct  310  CQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICK  367

Query  390  RSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLK  431
            +SF  K + + H   HTG+ P+ C++C  +Y R   L  H++
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR  409


 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 117/284 (41%), Gaps = 43/284 (15%)

Query  115  MVKQKEEKGYQCPQCPKQVATRTSLMVHLRLHSGERRFPCEYCSLSFYQKHHLKDHVNKI  174
            M     E  ++C  C K  + +     H+  H+GE    C++CS +F +K HL +HV + 
Sbjct  408  MRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQ-  466

Query  175  HLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDELISHSSYH  234
            H       C+ C +T+        H+   R+   +  F C  C + F+ +D +++H   H
Sbjct  467  HTGESPHRCSYCMKTFTRKEHLVNHI---RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH  523

Query  235  GGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHICGHMFTCKRRLTQHLARLH  292
             GE   + C +  CT+ F     L  HV  H     + C  C   FT K  LT H+ RLH
Sbjct  524  TGESP-HKCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLH  579

Query  293  TGSLSYPCTQCPGKFYSAYELRQHVRQH-----------------------------TDE  323
            TG   + C  C   F     L  H+RQH                             T +
Sbjct  580  TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD  639

Query  324  RPFPCPVCQRTFRRKATMESHLMLHTGA----KPYACTECDQKF  363
            RPF C  C ++F  K  +  H   HT      +P+AC +C + F
Sbjct  640  RPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 1/136 (1%)

Query  297  SYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKATMESHLMLHTGAKPYAC  356
            ++ C  C   F   Y+L  H R H++ +PF C VC + F     +  H  +H G   + C
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  357  TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC  416
              C   F  N+ L+ H    H T + + C  C ++F  K +L  H R HTGE P+ C  C
Sbjct  280  IVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  417  TVRYLRSYELVLHLKK  432
               + R   +V H++K
Sbjct  339  AKTFTRKEHMVNHVRK  354



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02080.1.1 Unknown

Length=144


***** No hits found *****



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02090.1.1 Nephrin

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KIB0_DROME  unnamed protein product                                 128     1e-35
Q9VFU7_DROME  unnamed protein product                                 124     3e-34
Q59DZ1_DROME  unnamed protein product                                 120     6e-33


>Q0KIB0_DROME unnamed protein product
Length=1689

 Score = 128 bits (321),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 0/95 (0%)

Query  15   PMVTLRLGPKLKPNAIKEGDDVYFECKVRANPKEHKITWYHNGIAVKRNSSSGVILSTES  74
            P VTL LG  L+P+ IKEGDDVYFEC +++NPKEH+I W H+G  V +N S G+I+ST S
Sbjct  375  PQVTLSLGSTLRPDDIKEGDDVYFECHIKSNPKEHRIMWSHDGQPVTQNVSWGIIISTRS  434

Query  75   LVLQKVSRHNSGRYTCQAVNDRGETSSHPVTLRVQ  109
            LVLQ+V R +SG Y C A NDRGET S PV LR++
Sbjct  435  LVLQRVGRIHSGFYACSAANDRGETQSAPVNLRIR  469


 Score = 33.1 bits (74),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query  32   EGDDVYFECKVRANPKEHKITWYHNGIAVKRNS--SSGVILSTESLVLQKVSRHN-SGRY  88
            EGD++   C+VR    E  +TW +    ++  S  S G  ++   L + ++SR   +  Y
Sbjct  192  EGDNIVLTCEVRGGRPEPTVTWMNGTRTLEAGSGVSMGRHVTVNRLEVAQISRSALNNTY  251

Query  89   TCQAVNDR  96
             CQA N +
Sbjct  252  RCQASNTK  259


>Q9VFU7_DROME unnamed protein product
Length=1001

 Score = 124 bits (311),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%), Gaps = 0/101 (0%)

Query  9    LVISDQPMVTLRLGPKLKPNAIKEGDDVYFECKVRANPKEHKITWYHNGIAVKRNSSSGV  68
            L++  QP  TL++G  L P+ IKEGDD YFEC V ANPK +K++W+HNG  ++ N S+GV
Sbjct  390  LIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGV  449

Query  69   ILSTESLVLQKVSRHNSGRYTCQAVNDRGETSSHPVTLRVQ  109
            ILS +SLVLQ VSR ++G YTC AVN  G+  S+PVTLR++
Sbjct  450  ILSDQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPVTLRIR  490


 Score = 28.1 bits (61),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 16/32 (50%), Gaps = 0/32 (0%)

Query  29   AIKEGDDVYFECKVRANPKEHKITWYHNGIAV  60
            +  EG+D+   C+V        +TWY +  A+
Sbjct  211  SFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAI  242


>Q59DZ1_DROME unnamed protein product
Length=1064

 Score = 120 bits (302),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)

Query  15   PMVTLRLGPKLKPNAIKEGDDVYFECKVRANPKEHKITWYHNGIAVKRNSSSGVILSTES  74
            P+VTLRLG  L P+ IKEGDDVYFEC V++NP+  K+ W HNGI ++ N+S+ VI S +S
Sbjct  367  PLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSNQS  426

Query  75   LVLQKVSRHNSGRYTCQAVNDRGETSSHPVTLRVQ  109
            LVLQK+++H +G Y C A+ND GET S+ + LRV+
Sbjct  427  LVLQKITKHYAGNYACSAINDEGETVSNQLPLRVK  461


 Score = 42.0 bits (97),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 52/99 (53%), Gaps = 7/99 (7%)

Query  2    YSIPILCLVISDQPMVTLRLGPKLKPNAI---KEGDDVYFECKVRANPKEHKITWYHNGI  58
            +   +  +++ +QP++  R G +L    +   +EGDD+   C+V     + ++ W  NG+
Sbjct  154  FRFNLSVIILPEQPIIMDRWGRQLNGTQLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGL  213

Query  59   AVKRNS--SSGVILSTESLVLQKVSRHN-SGRYTCQAVN  94
             V   +  +SG ++    L+   V R++ +  +TCQA+N
Sbjct  214  LVDNQNEHNSGDVIENR-LLWPSVQRNDLNSVFTCQALN  251



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02100.1.1 Cystinosin

Length=396
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CTNS_CAEEL  unnamed protein product                                   246     1e-77
LAAT1_CAEEL  unnamed protein product                                  40.4    0.001
CUP_DROME  unnamed protein product                                    35.4    0.10 


>CTNS_CAEEL unnamed protein product
Length=404

 Score = 246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 173/276 (63%), Gaps = 2/276 (1%)

Query  117  DIKPSDIHVAVEKDFRLGLASDIIGWIYFSAWTISFYPQLYTNYKKKSVIGLNFDFLGLN  176
            D++ +   + V +   L +   I+GW YF AW+ISFYPQ+Y N+K+KSV+GLNFDFL LN
Sbjct  109  DLEDAFARITVIRSHFLAILIQIVGWTYFFAWSISFYPQMYLNFKRKSVVGLNFDFLSLN  168

Query  177  LIGFTLYSLYNLGYYSSSLIQDQFFEKNGTNSNPVQLNDVFFSIHATIITLLTIFQCLIY  236
            L+GF  Y+++NL  Y +S +++++   N  +  PV LNDV F++HA +   +TI QCL Y
Sbjct  169  LVGFCAYAIFNLLMYYNSHVKNEYNIVNPRSPPPVLLNDVVFAVHAFLACFITILQCLFY  228

Query  237  ERGTQKVSIGARCLMCAYFLYLSGVLGLVLFNKFQWIDFLNQCSDVKLTITLIKYIPQAY  296
            ER  Q VS     LM     +        +  K Q + F+   S +K+ +T  KY PQAY
Sbjct  229  ERDNQSVSSKCIALMIVLISFGFCSAAATVLRKIQLLSFVTSLSYIKMAVTCCKYFPQAY  288

Query  297  MNFQRKSTSGWSIGNVLLDFTGGMFSILQMVILAINFDDWDGFLIDRTKLGLGLFSVSFD  356
             N+ RKST GWSIGN++LDFTGG   ILQM++ A+N +DW  F  +  K GLG  S+ FD
Sbjct  289  FNYTRKSTVGWSIGNIMLDFTGGTLDILQMILQAVNVNDWSAFYANPVKFGLGFVSIFFD  348

Query  357  ILFMIQHYVLYSVNYQVLYSD-DSHSSSSEDSIKHD  391
            I+FM+QHYVLY  N +V +++     + + D+I  D
Sbjct  349  IIFMVQHYVLYP-NAEVPHNEYHGVDNPNPDNIARD  383


>LAAT1_CAEEL unnamed protein product
Length=311

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  130  DFRLGLASDIIGWIYFSAWTISFYPQLYTNYKKKSVIGLNFDFLGLNLIGFT  181
            D  L L   IIG I  + W I  +PQL+ NYK K   GL+  FL   L+G T
Sbjct  35   DTDLKLLGFIIGLISLALWLIPLFPQLWQNYKTKKCEGLSLAFLFFWLVGDT  86


>CUP_DROME unnamed protein product
Length=1117

 Score = 35.4 bits (80),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 37/87 (43%), Gaps = 0/87 (0%)

Query  170  FDFLGLNLIGFTLYSLYNLGYYSSSLIQDQFFEKNGTNSNPVQLNDVFFSIHATIITLLT  229
             D L   +I   L +L+NL     +L   Q  + N     P QL+      HA +I    
Sbjct  908  LDMLSSTVIASQLQNLHNLAIVQQTLAARQQPQHNPQTQAPHQLSQEDLQAHANVIMRNA  967

Query  230  IFQCLIYERGTQKVSIGARCLMCAYFL  256
            + +  I E+ ++ ++ GA+      +L
Sbjct  968  VMKRKIEEQTSKLINGGAKHQAQQQYL  994



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


Query= Dcitr00g02110.1.1 Cystinosin

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CTNS_CAEEL  unnamed protein product                                   235     1e-71
G5EBY3_CAEEL  unnamed protein product                                 38.5    0.016
Q22869_CAEEL  unnamed protein product                                 38.5    0.016


>CTNS_CAEEL unnamed protein product
Length=404

 Score = 235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 157/253 (62%), Gaps = 0/253 (0%)

Query  286  KDVVVHVDVEKGHHWTTLSTIIGWIYFVSWGASAHCQVLVNWQRKSVIGLNFDYLGLNMI  345
            +D    + V + H    L  I+GW YF +W  S + Q+ +N++RKSV+GLNFD+L LN++
Sbjct  111  EDAFARITVIRSHFLAILIQIVGWTYFFAWSISFYPQMYLNFKRKSVVGLNFDFLSLNLV  170

Query  346  GHSLYGVYNFVLYFSYPVQEEYYLRNPHSANPIQLNDVVFSAHNSLVTLYTVYQCYKYER  405
            G   Y ++N ++Y++  V+ EY + NP S  P+ LNDVVF+ H  L    T+ QC  YER
Sbjct  171  GFCAYAIFNLLMYYNSHVKNEYNIVNPRSPPPVLLNDVVFAVHAFLACFITILQCLFYER  230

Query  406  GNQRLSKGAKLLYTVYAVWVFLSGFLALVHKIHWLDFINQCALIKLTITLIKYAPQAYMN  465
             NQ +S     L  V   + F S    ++ KI  L F+   + IK+ +T  KY PQAY N
Sbjct  231  DNQSVSSKCIALMIVLISFGFCSAAATVLRKIQLLSFVTSLSYIKMAVTCCKYFPQAYFN  290

Query  466  FKRKSTVGWSIGNVLLDFAGGLFSLLQMLILAYNFDDWNSLLTDTTKLGLAAFTLMFDVL  525
            + RKSTVGWSIGN++LDF GG   +LQM++ A N +DW++   +  K GL   ++ FD++
Sbjct  291  YTRKSTVGWSIGNIMLDFTGGTLDILQMILQAVNVNDWSAFYANPVKFGLGFVSIFFDII  350

Query  526  FLVQHYILYTDHD  538
            F+VQHY+LY + +
Sbjct  351  FMVQHYVLYPNAE  363


>G5EBY3_CAEEL unnamed protein product
Length=2003

 Score = 38.5 bits (88),  Expect = 0.016, Method: Composition-based stats.
 Identities = 27/131 (21%), Positives = 63/131 (48%), Gaps = 2/131 (2%)

Query  73    TTEVEYKMKD-KITVADHKNNLSTQSKQGAVKYTLLEDISTPSKSNHNTSKVKSEETNNT  131
             T E+E KM+     +A+ +NN     ++  + + +L D  T +    N    K +  +  
Sbjct  1451  TREMERKMRKFDQQLAEERNNTLLAQQERDMAHQMLRDAETKALVLSNELSEKKDIVDQL  1510

Query  132   VSETVTPSI-LDNISSKEMEFNEGVYDLQRVNKKLTKDIELLEKDIKDLKQVVPVSTEVN  190
               +  T  + +DN++S + +  + VY+L++  ++L +++   E+ I +L+  + ++ +  
Sbjct  1511  EKDKRTLKLEIDNLASTKDDAGKNVYELEKTKRRLDEELSRAEQQIIELEDALQLADDAR  1570

Query  191   DRQVYNTSLYR  201
              R   N    R
Sbjct  1571  SRVEVNMQAMR  1581


>Q22869_CAEEL unnamed protein product
Length=2003

 Score = 38.5 bits (88),  Expect = 0.016, Method: Composition-based stats.
 Identities = 27/131 (21%), Positives = 63/131 (48%), Gaps = 2/131 (2%)

Query  73    TTEVEYKMKD-KITVADHKNNLSTQSKQGAVKYTLLEDISTPSKSNHNTSKVKSEETNNT  131
             T E+E KM+     +A+ +NN     ++  + + +L D  T +    N    K +  +  
Sbjct  1451  TREMERKMRKFDQQLAEERNNTLLAQQERDMAHQMLRDAETKALVLSNELSEKKDIVDQL  1510

Query  132   VSETVTPSI-LDNISSKEMEFNEGVYDLQRVNKKLTKDIELLEKDIKDLKQVVPVSTEVN  190
               +  T  + +DN++S + +  + VY+L++  ++L +++   E+ I +L+  + ++ +  
Sbjct  1511  EKDKRTLKLEIDNLASTKDDAGKNVYELEKTKRRLDEELSRAEQQIIELEDALQLADDAR  1570

Query  191   DRQVYNTSLYR  201
              R   N    R
Sbjct  1571  SRVEVNMQAMR  1581



Lambda      K        H
   0.326    0.138    0.418 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5799002400


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Apr 30, 2020  2:49 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g02120.1.1 Unknown

Length=130
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I0S6_DROME  unnamed protein product                                 28.1    2.6  
Q9VPG5_DROME  unnamed protein product                                 28.1    2.6  
Q9VPG4_DROME  unnamed protein product                                 28.1    2.6  


>Q8I0S6_DROME unnamed protein product
Length=401

 Score = 28.1 bits (61),  Expect = 2.6, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  49   FMGYCCLVASCIAFATAVLNKSKKAKR  75
            F+G CCL+  C +F  A+   +K   R
Sbjct  205  FLGLCCLLTGCTSFEEAIQLATKGDNR  231


>Q9VPG5_DROME unnamed protein product
Length=417

 Score = 28.1 bits (61),  Expect = 2.6, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  49   FMGYCCLVASCIAFATAVLNKSKKAKR  75
            F+G CCL+  C +F  A+   +K   R
Sbjct  221  FLGLCCLLTGCTSFEEAIQLATKGDNR  247


>Q9VPG4_DROME unnamed protein product
Length=419

 Score = 28.1 bits (61),  Expect = 2.6, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  49   FMGYCCLVASCIAFATAVLNKSKKAKR  75
            F+G CCL+  C +F  A+   +K   R
Sbjct  223  FLGLCCLLTGCTSFEEAIQLATKGDNR  249



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02130.1.1 Retrovirus-related

Length=209
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I4Z1_PLAF7  unnamed protein product                                 30.8    0.87 
DHX16_CAEEL  unnamed protein product                                  28.9    4.0  
Q8I0B7_DROME  unnamed protein product                                 28.5    4.4  


>Q8I4Z1_PLAF7 unnamed protein product
Length=1846

 Score = 30.8 bits (68),  Expect = 0.87, Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 0/61 (0%)

Query  137  NPATDNVPSESNDAMDKAVENLPTQVHSSTPLPADIPEDEDMHHHNIQLLGIFDPKSWLS  196
            N A  +   E  +  D+ ++NL      +  L  +I E+EDM + N+Q + + +P+  ++
Sbjct  320  NTALSDDSDERKNKNDRTIKNLEKLFVRNLTLMQNIEENEDMSYKNLQNINLPNPRVTIT  379

Query  197  L  197
            L
Sbjct  380  L  380


>DHX16_CAEEL unnamed protein product
Length=1008

 Score = 28.9 bits (63),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 45/94 (48%), Gaps = 20/94 (21%)

Query  79   VAELREDLRSIFESILDASSSLDPSPASNFFIPEFFPDLKKPQIPFNNEIVASQSSPSNP  138
            +A  R+DL+     +L +S++LD    S+FF  +  P  + P   F  +I  +Q+    P
Sbjct  504  IARFRKDLK-----LLISSATLDAEKFSSFF--DDAPIFRIPGRRFPVDIYYTQA----P  552

Query  139  ATDNVPSESNDAMDKAVENLPTQVHSSTPLPADI  172
              D V        D A+  +  Q+H + PLP DI
Sbjct  553  EADYV--------DAAIVTI-MQIHLTQPLPGDI  577


>Q8I0B7_DROME unnamed protein product
Length=563

 Score = 28.5 bits (62),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 17/32 (53%), Gaps = 0/32 (0%)

Query  121  QIPFNNEIVASQSSPSNPATDNVPSESNDAMD  152
            Q+P  N I A    PS P  D  P+ S DA++
Sbjct  12   QVPLPNAIAAKYQEPSEPRDDEQPTTSKDALE  43



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02140.1.1 Myeloid

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MLF_DROME  unnamed protein product                                    165     2e-48
UNC89_CAEEL  unnamed protein product                                  30.8    1.7  
Q7KU01_DROME  unnamed protein product                                 29.3    4.6  


>MLF_DROME unnamed protein product
Length=376

 Score = 165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 136/221 (62%), Gaps = 36/221 (16%)

Query  1    MFGSLMRFVDGDEDDILGAHMQNMNQMMSSMNSMFANPFGMMGG-MPG-FGGASPF----  54
            +FG+LM    GD DD LG    +MN  M++MN    +   +M   MP  F   SPF    
Sbjct  3    LFGALM----GDFDDDLGLMNNHMNHTMNAMNMQMRSMNRLMNSFMPDPFMQVSPFDQGF  58

Query  55   -------------MPMM-----PQMPNMSQLMSQMQNNGNCHSYSSSTVMSMTNGPDGRP  96
                         MP M     P MPN ++L++      +  S+  STVM+M++GPDGRP
Sbjct  59   QQNALMERPQMPAMPAMGLFGMPMMPNFNRLLNADIGGNSGASFCQSTVMTMSSGPDGRP  118

Query  97   QVYQATSSTRSAPGGIRETKKAVCDSRTGVKKLAIGHAIGDKEHIIEREQNLRSGEQEER  156
            Q+YQA++ST++ PGG+RET++ V DSRTGVKK+AIGH IG++ HIIE+EQ++RSG+ EER
Sbjct  119  QIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEER  178

Query  157  QDFINLDEEESEAFNQEWRQKAREAQLLQHSVNYPQTRHQA  197
            Q+FINL+E E+E F++E+  +A    +        Q+RH A
Sbjct  179  QEFINLEEGEAEQFDREFTSRASRGAV--------QSRHHA  211


>UNC89_CAEEL unnamed protein product
Length=8081

 Score = 30.8 bits (68),  Expect = 1.7, Method: Composition-based stats.
 Identities = 19/68 (28%), Positives = 33/68 (49%), Gaps = 11/68 (16%)

Query  232   PSRKRDHSGADKMKPAAKKECNSGEQTKQECNRTSP-----------APPSGETKKQSSH  280
             P++K     A+++K   KKE +    TK+E + +SP           +PP   TKK+ S 
Sbjct  1415  PTKKEKSPAAEEVKSPTKKEKSPSSPTKKEKSPSSPTKKTGDEVKEKSPPKSPTKKEKSP  1474

Query  281   HGEKKLKT  288
                + +K+
Sbjct  1475  EKPEDVKS  1482


>Q7KU01_DROME unnamed protein product
Length=1135

 Score = 29.3 bits (64),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 39/85 (46%), Gaps = 8/85 (9%)

Query  15   DILGAHMQNMNQMMSSMNS---MFANPFG-MMGGMPGFGGASPFMPMMP-QMPNMSQLMS  69
            +I G+ M   + M++ + +   +  NPF   MGGMP   G  P   MMP Q+PN +    
Sbjct  882  NISGSDMGFNDNMLTGLGAGPNLMQNPFDPFMGGMPAPTGMPPGPNMMPNQVPNGT---P  938

Query  70   QMQNNGNCHSYSSSTVMSMTNGPDG  94
            Q+  N          V  M NGP G
Sbjct  939  QIWQNQMGPVGGPPGVPPMMNGPGG  963



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02150.1.1 Galactose-1-phosphate

Length=296
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GALT_DROME  unnamed protein product                                   258     1e-84
UGT52_DICDI  unnamed protein product                                  31.6    0.99 
Q965F9_CAEEL  unnamed protein product                                 30.4    2.1  


>GALT_DROME unnamed protein product
Length=350

 Score = 258 bits (659),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 199/348 (57%), Gaps = 62/348 (18%)

Query  4    FQADEHQHVRYNPLKGEWILVSPHRMKRPWSGQEEKSNEDPIAEFDRRIRSALQLPGVN-  62
            F A EH H R NPL G+W+LV PHR +RPWSGQ+EK+ ++ + EFD    +    PGV  
Sbjct  3    FVASEHPHRRLNPLNGQWVLVCPHRTQRPWSGQQEKAQKNELPEFDP---TNPLCPGVTR  59

Query  63   ------PNYDSVFVFNNDFPALLENVPSPPVQDDPLFKMG-----MRLAC--ARSFVSIP  109
                  P Y+S +VF NDFPAL+E VP PP  DDPLF++       R+ C   +S +++P
Sbjct  60   PNGIQTPEYESTYVFENDFPALVEVVPVPPNNDDPLFQIAPARGNCRVMCFHPKSNLTLP  119

Query  110  S-----------------------------------------PTPHYP--SCP-LRKFAR  125
            +                                         P PH    SC  L    +
Sbjct  120  TMSAAEIVVVIDEWISQFNELSAKYAWVQIFENKGAAMGCSNPHPHCQIWSCSFLPTEPQ  179

Query  126  IKDIHQREYYQTHGKPLLMDYVSKELLKRDRVVYETQTGWLWYRSGPSGHFETMILPRTH  185
            +K    R YY T+ +P+L DYV +EL +++R+V E +   +      +  FETM++ R +
Sbjct  180  LKQERLRAYYATNERPMLADYVERELQRQERIVIENRDWLVVVPFWATWPFETMLISRNN  239

Query  186  VLRFTDLDDQQRNNLADIIKKITTKYDNLFKVSFPYSMGFHGAPTGSK-VHQNNSHWVFH  244
              R  DL  +QR NLA  IK++TTKYDNLF+ SFPYSMG+HGAPTG +  H +++HW  H
Sbjct  240  NKRINDLTAEQRYNLALTIKELTTKYDNLFQCSFPYSMGWHGAPTGPEHAHASSAHWTLH  299

Query  245  ASYLPPLLRSATVKKFMVGYELLAQTQRDLTPEQAAERLRNSPHDKHY  292
            A Y PPLLRSA+V+KFMVG+ELLA  QRDLTPEQAA+RLR      HY
Sbjct  300  AIYYPPLLRSASVRKFMVGFELLAMAQRDLTPEQAAQRLREVDGKCHY  347


>UGT52_DICDI unnamed protein product
Length=1697

 Score = 31.6 bits (70),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 31/125 (25%), Positives = 52/125 (42%), Gaps = 11/125 (9%)

Query  131  QREYYQTHGKPLLMD----YVSKELLKRDRVVYETQTGWLWYRSGPSGHFETMILPRTHV  186
            Q+ +  + G  LL++    +   E    + V+Y T  G L++ S  S     +I+P + +
Sbjct  409  QKTFKLSQGVNLLIETPCVFYQDEEFSYEGVLYATTEGTLYFSSLDS----VLIIPESDI  464

Query  187  LRFTDLDDQQRNNLADIIKKITTKYDNLFKVSFPYSMGFHGAPTGSKVHQNNSHWVFHAS  246
               T +D +  N   D +K  TT YD LF  S      F    + S    N   +     
Sbjct  465  YAIT-IDRKSDNR--DALKVYTTDYDVLFFDSIDDIETFFNVISTSLARSNPKIFFSTVG  521

Query  247  YLPPL  251
             +PP+
Sbjct  522  QIPPI  526


>Q965F9_CAEEL unnamed protein product
Length=582

 Score = 30.4 bits (67),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (12%)

Query  48   FDRRIRSALQLPGVNPNYDSVFVFNNDFPALLENVPSPPVQDD-PLFKMGMRL---ACAR  103
            FDR +R       +  +YD +F+        L+  P+PP+ ++ P  KM   L   +  R
Sbjct  63   FDRMVRKLKNQENIESSYDDLFICEEK----LQKAPTPPISEEIPAQKMTRSLSQRSKRR  118

Query  104  SFVSIPSPT  112
             F SI  PT
Sbjct  119  LFFSIAGPT  127



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02160.1.1 CG12123-RA

Length=180


***** No hits found *****



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02170.1.1 Constitutive

Length=402


***** No hits found *****



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02180.1.1 Galactose-1-phosphate

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GALT_DROME  unnamed protein product                                   454     4e-161
Q38CI3_TRYB2  unnamed protein product                                 30.8    2.0   
SCC4_DROME  unnamed protein product                                   28.9    7.3   


>GALT_DROME unnamed protein product
Length=350

 Score = 454 bits (1169),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 256/345 (74%), Gaps = 1/345 (0%)

Query  4    FQADEHQHVRYNPLKGEWILVSPHRMKRPWSGQEEKSNEDPIAEFDPKNPLCPTATRGNG  63
            F A EH H R NPL G+W+LV PHR +RPWSGQ+EK+ ++ + EFDP NPLCP  TR NG
Sbjct  3    FVASEHPHRRLNPLNGQWVLVCPHRTQRPWSGQQEKAQKNELPEFDPTNPLCPGVTRPNG  62

Query  64   EVNPNYDSVFVFNNDFPALLENVPSPPVQDDPLFKMGNASGVCKVICFHPKSNTTLPIMS  123
               P Y+S +VF NDFPAL+E VP PP  DDPLF++  A G C+V+CFHPKSN TLP MS
Sbjct  63   IQTPEYESTYVFENDFPALVEVVPVPPNNDDPLFQIAPARGNCRVMCFHPKSNLTLPTMS  122

Query  124  IEEIRKVIDTWVDETASLGKTYEWVQIFENKGAIMGCSNPHPHCQVWASSFLPNLPRIKD  183
              EI  VID W+ +   L   Y WVQIFENKGA MGCSNPHPHCQ+W+ SFLP  P++K 
Sbjct  123  AAEIVVVIDEWISQFNELSAKYAWVQIFENKGAAMGCSNPHPHCQIWSCSFLPTEPQLKQ  182

Query  184  IHQREYYQTHGKPLLMDYVSKELLKRDRVVVRNPDWVVVVPFWAEWPFETMILPRTHVLR  243
               R YY T+ +P+L DYV +EL +++R+V+ N DW+VVVPFWA WPFETM++ R +  R
Sbjct  183  ERLRAYYATNERPMLADYVERELQRQERIVIENRDWLVVVPFWATWPFETMLISRNNNKR  242

Query  244  FTDLDDQQRNNLADIIKKITTKYDNLFKVSFPYSMGFHGAPTGSK-VHQNNSHWVFHASY  302
              DL  +QR NLA  IK++TTKYDNLF+ SFPYSMG+HGAPTG +  H +++HW  HA Y
Sbjct  243  INDLTAEQRYNLALTIKELTTKYDNLFQCSFPYSMGWHGAPTGPEHAHASSAHWTLHAIY  302

Query  303  LPPLLRSATVKKFMVGYELLAQTQRDLTPEQAAERLRNSPHDKHY  347
             PPLLRSA+V+KFMVG+ELLA  QRDLTPEQAA+RLR      HY
Sbjct  303  YPPLLRSASVRKFMVGFELLAMAQRDLTPEQAAQRLREVDGKCHY  347


>Q38CI3_TRYB2 unnamed protein product
Length=1685

 Score = 30.8 bits (68),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  213  VVRNPDWVVVVPFWAEWPFETMILPRTHVL  242
            VVRN D++V V   A +PF T + PR+ V 
Sbjct  612  VVRNADYLVRVVLLAYFPFLTDVPPRSEVF  641


>SCC4_DROME unnamed protein product
Length=632

 Score = 28.9 bits (63),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  163  PHPHCQVWASSFLPNLPRI-KDI-HQREYYQTHGK  195
            P  H Q+W S+ L +L R+ KD+ H+++ Y  H K
Sbjct  527  PDIHVQLWGSAILKDLHRMSKDVQHEKDAYANHVK  561



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02190.1.1 CG12123-RA

Length=238
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T499_DROME  unnamed protein product                                 30.4    1.3  
A1Z957_DROME  unnamed protein product                                 29.6    1.9  
Q19015_CAEEL  unnamed protein product                                 27.7    10.0 


>Q8T499_DROME unnamed protein product
Length=278

 Score = 30.4 bits (67),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 17/72 (24%), Positives = 34/72 (47%), Gaps = 4/72 (6%)

Query  33   LPVVLH--DDTLKSTKYLQLSLDGYRFSCIKKILVMSPTYRRNVIEYFANLSKDSNWKIN  90
            +PV  H  D+ +K+T  L+     Y+   ++ I+  SP      I YF  L +DS   + 
Sbjct  144  IPVEYHTEDEVIKAT--LEQMFAEYKECSMRDIIAFSPPNNSKCIAYFTQLVRDSTTHVG  201

Query  91   VKLIEPSQHVLD  102
              ++  +++  +
Sbjct  202  CGILRQTKNTTN  213


>A1Z957_DROME unnamed protein product
Length=291

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 17/72 (24%), Positives = 34/72 (47%), Gaps = 4/72 (6%)

Query  33   LPVVLH--DDTLKSTKYLQLSLDGYRFSCIKKILVMSPTYRRNVIEYFANLSKDSNWKIN  90
            +PV  H  D+ +K+T  L+     Y+   ++ I+  SP      I YF  L +DS   + 
Sbjct  157  IPVEYHTEDEVIKAT--LEQMFAEYKECSMRDIIAFSPPNNSKCIAYFTQLVRDSTTHVG  214

Query  91   VKLIEPSQHVLD  102
              ++  +++  +
Sbjct  215  CGILRQTKNTTN  226


>Q19015_CAEEL unnamed protein product
Length=1270

 Score = 27.7 bits (60),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 21/39 (54%), Gaps = 0/39 (0%)

Query  91   VKLIEPSQHVLDYKWANMIDSKVIERRELDNSFSWMSTL  129
            V++IEP+  +L     N + S + E  E   SFS +S L
Sbjct  663  VEIIEPNSTILQEHEHNFVGSVITENEEQKISFSGISKL  701



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02200.1.1 Pro-Pol

Length=450
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57X97_TRYB2  unnamed protein product                                 32.0    1.3  


>Q57X97_TRYB2 unnamed protein product
Length=458

 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 42/93 (45%), Gaps = 9/93 (10%)

Query  348  PGEMNPADLPSRGCYPKRFVKSRWWEG-----PTWLKGNPEDWPQVVSEFDEEEINMERK  402
            P +   + L SR  Y  RF+ SR  +        WL    ED    VS+  ++   + ++
Sbjct  306  PAQDIISRLRSRDIY--RFILSRALKSEAAPPDNWLNDVAEDIVAAVSK--KQSTKITKE  361

Query  403  KTVVSSMLNTEGSGQFNPAPNIVSYEPKLPTMS  435
              +V  ++   G G  +P  +++ + PK P+ S
Sbjct  362  DIIVDQVVINHGKGNSDPLQSVLFFNPKRPSQS  394



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02210.1.1 Myeloid

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MLF_DROME  unnamed protein product                                    165     2e-48
UNC89_CAEEL  unnamed protein product                                  30.8    1.7  
Q7KU01_DROME  unnamed protein product                                 29.3    4.6  


>MLF_DROME unnamed protein product
Length=376

 Score = 165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 136/221 (62%), Gaps = 36/221 (16%)

Query  1    MFGSLMRFVDGDEDDILGAHMQNMNQMMSSMNSMFANPFGMMGG-MPG-FGGASPF----  54
            +FG+LM    GD DD LG    +MN  M++MN    +   +M   MP  F   SPF    
Sbjct  3    LFGALM----GDFDDDLGLMNNHMNHTMNAMNMQMRSMNRLMNSFMPDPFMQVSPFDQGF  58

Query  55   -------------MPMM-----PQMPNMSQLMSQMQNNGNCHSYSSSTVMSMTNGPDGRP  96
                         MP M     P MPN ++L++      +  S+  STVM+M++GPDGRP
Sbjct  59   QQNALMERPQMPAMPAMGLFGMPMMPNFNRLLNADIGGNSGASFCQSTVMTMSSGPDGRP  118

Query  97   QVYQATSSTRSAPGGIRETKKAVCDSRTGVKKLAIGHAIGDKEHIIEREQNLRSGEQEER  156
            Q+YQA++ST++ PGG+RET++ V DSRTGVKK+AIGH IG++ HIIE+EQ++RSG+ EER
Sbjct  119  QIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEER  178

Query  157  QDFINLDEEESEAFNQEWRQKAREAQLLQHSVNYPQTRHQA  197
            Q+FINL+E E+E F++E+  +A    +        Q+RH A
Sbjct  179  QEFINLEEGEAEQFDREFTSRASRGAV--------QSRHHA  211


>UNC89_CAEEL unnamed protein product
Length=8081

 Score = 30.8 bits (68),  Expect = 1.7, Method: Composition-based stats.
 Identities = 19/68 (28%), Positives = 33/68 (49%), Gaps = 11/68 (16%)

Query  232   PSRKRDHSGADKMKPAAKKECNSGEQTKQECNRTSP-----------APPSGETKKQSSH  280
             P++K     A+++K   KKE +    TK+E + +SP           +PP   TKK+ S 
Sbjct  1415  PTKKEKSPAAEEVKSPTKKEKSPSSPTKKEKSPSSPTKKTGDEVKEKSPPKSPTKKEKSP  1474

Query  281   HGEKKLKT  288
                + +K+
Sbjct  1475  EKPEDVKS  1482


>Q7KU01_DROME unnamed protein product
Length=1135

 Score = 29.3 bits (64),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 39/85 (46%), Gaps = 8/85 (9%)

Query  15   DILGAHMQNMNQMMSSMNS---MFANPFG-MMGGMPGFGGASPFMPMMP-QMPNMSQLMS  69
            +I G+ M   + M++ + +   +  NPF   MGGMP   G  P   MMP Q+PN +    
Sbjct  882  NISGSDMGFNDNMLTGLGAGPNLMQNPFDPFMGGMPAPTGMPPGPNMMPNQVPNGT---P  938

Query  70   QMQNNGNCHSYSSSTVMSMTNGPDG  94
            Q+  N          V  M NGP G
Sbjct  939  QIWQNQMGPVGGPPGVPPMMNGPGG  963



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02220.1.1 endoribonuclease

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q23342_CAEEL  unnamed protein product                                 33.1    0.53 


>Q23342_CAEEL unnamed protein product
Length=339

 Score = 33.1 bits (74),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 23/151 (15%)

Query  132  PQAKLRPVVIDGSNVA----------MSHGNKELFSCIGIKICVDWFRARGHKEITVFVP  181
            P +  R +VIDG+NV            +  +  +   + +   + +F  R  +   V   
Sbjct  66   PNSVARTIVIDGANVMHCGSGYPDRRENSKSSHIPDVMPLLSLIRFFVVRDFEVFVVISR  125

Query  182  KWRKESCRPDNLIKNQEVLSELEKDRILVYTPSRLIGGKRLVCYDDRFILRLAADTDGIV  241
            K+ K+     +    +  +  L ++ + V  PS  +        DD   L+ A+  +G+V
Sbjct  126  KYAKQ-----DATNFKSAIDRLIENHLCVVVPSSNL--------DDSVALQFASQINGVV  172

Query  242  VSNDNYRDLCLESPDFRKVVEDRILMYSFVN  272
            ++ D YRD   +S  F  +V +  L   + N
Sbjct  173  ITTDQYRDHASDSLRFNTIVRENRLGIKWEN  203



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02230.1.1 embryo

Length=198
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    89.4    1e-20


>VIR_DROME unnamed protein product
Length=1854

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 9/66 (14%)

Query  4     RKPFVTPMRGRGFR----TISSIQRGDIFRTRLPNTSRPPSLHVDDFVALETCGQQPTGP  59
             +K FV+ +RGRGF     +     RGD+FR+R PNTSRPPSLHVDDF+ALETCG QPTGP
Sbjct  1713  KKMFVSSVRGRGFARPPPS-----RGDLFRSRPPNTSRPPSLHVDDFLALETCGAQPTGP  1767

Query  60    TGYNKM  65
             TGYNK+
Sbjct  1768  TGYNKI  1773



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02240.1.1 ATP-dependent

Length=1082
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38AX7_TRYB2  unnamed protein product                                 156     5e-40
DDX18_DROME  unnamed protein product                                  157     1e-39
DDX49_DROME  unnamed protein product                                  153     6e-39


>Q38AX7_TRYB2 unnamed protein product
Length=512

 Score = 156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 120/391 (31%), Positives = 184/391 (47%), Gaps = 70/391 (18%)

Query  481  RDICVSAPTGSGKTLAFVLPILQILQYRV-VPRIRALVVLPTQDLASQVYSVFKTYIKGT  539
            RDI   A TGSGKT A+VLP++  L  +  VP +  LV++PT++LA QV + F       
Sbjct  78   RDIIGVAQTGSGKTGAYVLPLVNWLLTQAKVPYLSILVMVPTRELAQQVAAQFVMLGSSV  137

Query  540  KLQVVLTVGSTPMLDEQRKLVAVDKVTGKHVSLVDIVVTTPGRLVDHLTNSPGFDLSELK  599
             L+V   VG   M+D+     A +     HV     VV TPGR+ DHL N+ GF L +L 
Sbjct  138  GLRVATLVGGADMVDQ-----ACELSRRPHV-----VVGTPGRVKDHLNNTKGFQLVKLH  187

Query  600  FLVVDEADRMIDNNDCNWLLHINKHINYQGLNSVPPLSLHTFLTYPSRPQRLLFSATLSH  659
             LV+DEAD+M++ +    +  I +H+                   P   Q LLFSATLS 
Sbjct  188  ALVLDEADKMLEMDYEKEINAILEHL-------------------PHNRQTLLFSATLST  228

Query  660  DPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTT  719
              ++L   SL  P L                  E    N +   + ++   A  ++ L  
Sbjct  229  KIDRLQNASLNDPVLL-----------------EVHRKNTTVDTLKQYYVFAPFAQML--  269

Query  720  CSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVY  779
                  P +   L R+     +L F  +A   HR+   L  + + A    G         
Sbjct  270  ------PYLHLYLTRESGNH-ILVFCRSAALVHRITLTLRVLGHQALPLMG---------  313

Query  780  SDLKFDQ--RNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIG  837
               + DQ  RN  + +F+  ++ ++V +D   RG+D+   DVV+N+  PD ++ YIHR+G
Sbjct  314  ---RMDQKNRNIALTKFKEGRVRILVCTDVAQRGLDIPRTDVVVNFALPDRVEDYIHRVG  370

Query  838  RTARGGRQGTSVTLVTTHERSAFLKMLSSVG  868
            RTAR G QG +V +++ ++     K+ +S G
Sbjct  371  RTARAGAQGKAVNIISQYDIVLLQKVEASTG  401


>DDX18_DROME unnamed protein product
Length=680

 Score = 157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 116/426 (27%), Positives = 198/426 (46%), Gaps = 74/426 (17%)

Query  469  IKQHSRRSLFWPRDICVSAPTGSGKTLAFVLPILQIL-QYRVVPR--IRALVVLPTQDLA  525
            I+  S   L   RD+  +A TGSGKTLAF++P ++++ + R +PR     +++ PT++L+
Sbjct  213  IQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFMPRNGTGVIIISPTRELS  272

Query  526  SQVYSVFKTYIKGTKLQVVLTVGSTPMLDEQRKLVAVDKVTGKHVSLVDIVVTTPGRLVD  585
             Q + V K  +        L +G +    E  KL       GK +   +I+V TPGRL+D
Sbjct  273  MQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKL-------GKGI---NILVATPGRLLD  322

Query  586  HLTNSPGFDLSELKFLVVDEADRMIDNNDCNWLLHINKHINYQGLNSVPPLSLHTFLTYP  645
            HL NSP F    L+ L++DE DR+++     +   + + IN                  P
Sbjct  323  HLQNSPDFLYKNLQCLIIDEVDRILE---IGFEEELKQIIN----------------LLP  363

Query  646  SRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIG  705
             R Q +LFSAT +   E L +L+L    ++       G  D Q T++    D L  G+I 
Sbjct  364  KRRQTMLFSATQTARIEALSKLALKSEPIYV------GVHDNQDTAT---VDGLEQGYI-  413

Query  706  KFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVA  765
                          C +  + LVL+  ++K+  + V+ F ++         L ++ID   
Sbjct  414  -------------VCPSEKRLLVLFTFLKKNRKKKVMVFFSSCMSVKYHHELFNYID---  457

Query  766  TKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEA  825
                   + +  ++   K  +R     +F   +  +++ +D  ARG+D+  +D ++ Y+ 
Sbjct  458  -------LPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQYDP  510

Query  826  PDNIKKYIHRIGRTARGGRQGTSVTLVTTHERSAFLKMLSS---------VGKQNIEDLE  876
            PD+ ++YIHR+GRTARG        L+   E   FL+ L +            Q I D++
Sbjct  511  PDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLRYLKAAKVPLNEFEFSWQKIADIQ  570

Query  877  CTEEEL  882
               E+L
Sbjct  571  LQLEKL  576


>DDX49_DROME unnamed protein product
Length=521

 Score = 153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 122/418 (29%), Positives = 189/418 (45%), Gaps = 82/418 (20%)

Query  441  LNPYFKKLLRRNEVTNFFPVQSELIPFLIKQHSRRSLFWPRDICVSAPTGSGKTLAFVLP  500
            L P+  K L +  +    P+Q + IP         ++   +D   +A TGSGKT AF LP
Sbjct  14   LRPWLVKQLTKLGLKGATPIQQKCIP---------AILAGQDCIGAAKTGSGKTFAFALP  64

Query  501  ILQILQYRVVPRIRALVVLPTQDLASQVYSVFKTYIKGTKLQVVLTVGSTPMLDEQRKLV  560
            IL+ L    V    ALV+ PT +LA Q+   F    +   ++V +  G T  + E +KL+
Sbjct  65   ILERLSEEPVSHF-ALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQKLM  123

Query  561  AVDKVTGKHVSLVDIVVTTPGRLVDHLTNSPGFDLSELKFLVVDEADRMIDNNDCNWLLH  620
                          IVV  PGRL DHLT    F    LK+LVVDEADRM+ N D +  L 
Sbjct  124  QRPH----------IVVAMPGRLADHLTGCDTFSFDNLKYLVVDEADRML-NGDFDESLS  172

Query  621  INKHINYQGLNSVPPLSLHTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVE  680
            I +                     P   Q L FSAT+    + + + S+F          
Sbjct  173  IIER------------------CLPKTRQNLFFSATMK---DFIKESSIF----------  201

Query  681  PAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQ-  739
                    P +S+    +  S       T   L ++   C+   + +VL + +RK+  + 
Sbjct  202  --------PIASDCFEWSQDS----DVATVETLDQRYLLCADYDRDMVLIEALRKYREEN  249

Query  740  ---GVLCFVNTAQGAHRLARLL--HHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEF  794
                V+ F NT +    L+  L    IDNV   G             ++  +R   +  F
Sbjct  250  ENANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGF------------MRQKERVAALSRF  297

Query  795  RRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLV  852
            +  +I  ++A+D  ARG+D+ ++++V+N+  P   K+YIHR+GRTAR GR+G S+++ 
Sbjct  298  KSNQIRTLIATDVAARGLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISIF  355



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02250.1.1 Activating

Length=111
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57YD5_TRYB2  unnamed protein product                                 28.9    0.96 
Q388I7_TRYB2  unnamed protein product                                 28.5    1.2  
Q57YD6_TRYB2  unnamed protein product                                 28.5    1.2  


>Q57YD5_TRYB2 unnamed protein product
Length=397

 Score = 28.9 bits (63),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query  19  WWTLIETDTKHKRANVYSLYSLNCTVQDSWIIEKETTVIDDAHDYFCDNSVWLTKEERAK  78
           W+ L+    K  RAN Y   +LN T  +  + E  T +   AH     ++  + K    K
Sbjct  4   WFVLLALLGKETRANYYERNALNATAANK-VCELSTYLKGVAHRVNSGSAAVMKKLSDLK  62

Query  79  IAQKQEELDRQRHS  92
           I   Q +L   R+S
Sbjct  63  IKSAQLQLSVMRNS  76


>Q388I7_TRYB2 unnamed protein product
Length=479

 Score = 28.5 bits (62),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 11/108 (10%)

Query  6    IKGLEEALKNVTAWWTLIETDTKHKR--ANVYSLYSLNCTVQDSWI--IEKETTVIDDAH  61
            I+GL E  K   +  T +E D K +   AN   ++   C    + I  I KE   +  + 
Sbjct  200  IRGLNEEYKGQRS--TKMEKDDKMRSTGANRQEVFK-KCDEISAKITSITKEMNAL--SE  254

Query  62   DYFCDNSVWLT--KEERAKIAQKQEELDRQRHSRLGPRKNHYRLCRTR  107
            D+     VW +   E RAK   K EE+ ++RH R   RKN  +L   R
Sbjct  255  DFQKAMEVWKSWCDEARAKHMAKMEEVRKERHRRFLERKNAPKLAEKR  302


>Q57YD6_TRYB2 unnamed protein product
Length=339

 Score = 28.5 bits (62),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query  19  WWTLIETDTKHKRANVYSLYSLNCTVQDSWIIEKETTVIDDAHDYFCDNSVWLTKEERAK  78
           W+ L+    K  RAN Y   +LN T  +  + E  T +   AH     ++  + K    K
Sbjct  4   WFVLLALLGKETRANYYERNALNATAANK-VCELSTYLKGVAHRVNSGSAAVMKKLSDLK  62

Query  79  IAQKQEELDRQRHS  92
           I   Q +L   R+S
Sbjct  63  IKSAQLQLSVMRNS  76



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02260.1.1 embryo

Length=118
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    94.7    1e-23
Q388R1_TRYB2  unnamed protein product                                 27.3    3.0  
M9PBS1_DROME  unnamed protein product                                 27.3    3.9  


>VIR_DROME unnamed protein product
Length=1854

 Score = 94.7 bits (234),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 1/62 (2%)

Query  8     RKPFVTPMRGRGFRTISSIQRGDIFRTRLPNTSRPPSLHVDDFVALETCGQQPTGPTGYN  67
             +K FV+ +RGRGF       RGD+FR+R PNTSRPPSLHVDDF+ALETCG QPTGPTGYN
Sbjct  1713  KKMFVSSVRGRGFARPPP-SRGDLFRSRPPNTSRPPSLHVDDFLALETCGAQPTGPTGYN  1771

Query  68    KM  69
             K+
Sbjct  1772  KI  1773


>Q388R1_TRYB2 unnamed protein product
Length=470

 Score = 27.3 bits (59),  Expect = 3.0, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  87   RGRGYILQPDRGGRFFPSMPQYRP  110
            R + Y+L  D GGR     P YRP
Sbjct  328  RAQVYVLTKDEGGRHTAFSPHYRP  351


>M9PBS1_DROME unnamed protein product
Length=603

 Score = 27.3 bits (59),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  9    KPFVTPMRGRGFRTISSIQRGDIFRT  34
            +PFV  + G+GFR  S++ R  I  T
Sbjct  336  RPFVCKVCGKGFRQASTLCRHKIIHT  361



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02270.1.1 Activating

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EDK1_CAEEL  unnamed protein product                                 107     7e-25
O44565_CAEEL  unnamed protein product                                 35.0    0.16 
Q8I2H7_PLAF7  unnamed protein product                                 34.7    0.20 


>G5EDK1_CAEEL unnamed protein product
Length=425

 Score = 107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 103/391 (26%), Positives = 174/391 (45%), Gaps = 33/391 (8%)

Query  123  KERRRCDCEASEHKLINNCLKCGRIVCSVEGSGPCLFCGELVCSREERRLIEQ-SDQGDT  181
            K R  C C+A  HKLI NCL CGRIVC  EGSGPC  CG LVC+REER ++ + +++   
Sbjct  33   KGRHECLCQARTHKLILNCLGCGRIVCEQEGSGPCFTCGTLVCTREEREILNRGTNKSRD  92

Query  182  LYQKLMD--------RKVIKGLEEALKNRDRLVDFDRNCEKRTTVIDDAHDY-FCDNSVW  232
            L  +L          +++    + A + R++L++ D + E+RT V D   DY   +NS +
Sbjct  93   LLARLTGDGSDIGSLKQISSSYQNATEFRNKLLEADADTERRTKVNDLQSDYSTIENSPF  152

Query  233  LTKEERAKIAQKQEELDRQRHSRLGPRKITIDFAGREVR------AEDNMVDTYSPDVLD  286
            L+  +R  +  ++EEL   R        +++DF G  V         + + D   P V+ 
Sbjct  153  LSASDREALKLRREELKALREKERKKFVVSLDFDGGVVHEMTRRSGTEALQDKNDP-VIQ  211

Query  287  DIVSKSSSQSGTPTMSPRVTIDVTSRTGNLALESKILSRGTGAGKQGILSLKFPQNSLVG  346
             I+ +   +          T D  +R   +    + ++      +Q            + 
Sbjct  212  RIMERVDEKHRIQEALHNSTAD--ARWNPIGFVPRYMTEDGDHPQQECSDGDIIDADSLM  269

Query  347  RVQDRGLLEMT-DVGACLSIHQPWATLLVKGIKKEEGRTWYTP--HRGKLWIASTSKQPT  403
             V D    ++T + G  L++ QP A+ LV G+ +     W T    +G L+I + +    
Sbjct  270  IVSDELAAQITEEKGYVLALAQPTASFLVNGLCR--FIRWPTDLNLKGPLFITAKAGGTN  327

Query  404  PEDIK-LAKNVYGEDNFPTK--FPSGCLLGCVLLVDCLPQEEYREQY------PDGVDDS  454
             + I+  AK    + N  ++  F  G +LG   L +C+  E++ ++Y      P G    
Sbjct  328  EKMIREFAKKYVRDVNKISELDFSDGAVLGRAFLQECMMLEDFLDKYGSKSAIPGGDGQF  387

Query  455  PYVFVCESPLELAIQFPMKGKPNIYKLDPKI  485
               F    PL   I         IY++D ++
Sbjct  388  VLCFSAFEPLVSTIPHISTADSYIYEMDRQL  418


>O44565_CAEEL unnamed protein product
Length=1790

 Score = 35.0 bits (79),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 75/158 (47%), Gaps = 28/158 (18%)

Query  17   EFPASPDLISYILEMENPLDIEHYFQSLLDVCNARHRQFIQEYAQRRAKLVGVA-SGYK-  74
            E  A+  LI  IL +  P    H FQ      +AR  Q + EY + + + + ++ S +K 
Sbjct  702  ERAAANILIDSIL-LAPPTSELHIFQG-----SARAEQHLTEYNRYQCRHLALSLSLFKD  755

Query  75   -KSEVLEDYITPMK----NKNKKENNDNSGN-----NSAGTSNE---NPTGKKKNKQAKG  121
             ++EV E Y+ P+     NK  + N D +G+     N  G   E   N  G++ ++ A G
Sbjct  756  QRNEVCERYVCPIAAALLNKTSECNCDATGSVSGICNVQGGQCECKPNVVGRRCDQCAIG  815

Query  122  -----PKERRRCDCEASEHKLINNCLK-CGRIVCSVEG  153
                 P   ++CDC+A    L N+C K  G+ VC  +G
Sbjct  816  TYGFGPSGCKKCDCDAV-GSLGNDCDKQSGQCVCREKG  852


>Q8I2H7_PLAF7 unnamed protein product
Length=1056

 Score = 34.7 bits (78),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 39/81 (48%), Gaps = 9/81 (11%)

Query  5    KTWLEKKLDELIEFPASPDLISYILEMENPLDIEHYFQSLLDVCNARHRQFIQEYAQRRA  64
            K ++  K+D  I  P    +  +IL   + LDIE YF    D+ N+R+   ++EY     
Sbjct  217  KKYINNKIDNEIYHPNVDKISDFILRNRHHLDIEDYF----DIYNSRNS--LEEYDN--I  268

Query  65   KLVGVASGYKKSEVLEDYITP  85
             L G    YKK E L D I P
Sbjct  269  GLCGYYENYKK-EFLYDLIKP  288



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02280.1.1 Xaa-Pro

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VG79_DROME  unnamed protein product                                 346     3e-117
Q38D78_TRYB2  unnamed protein product                                 311     1e-103
XPP_DROME  unnamed protein product                                    47.8    5e-06 


>Q9VG79_DROME unnamed protein product
Length=491

 Score = 346 bits (887),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 207/286 (72%), Gaps = 0/286 (0%)

Query  1    MRYASRISSEAHRSVMRKVSAGMYEYQAEAIFKHYILYVGGSRHVAYTCICASGGNGAVL  60
            +RY +++SS+AH  VMR +  G  E++ E++F H+   VGG RH +YTCIC SG N ++L
Sbjct  198  LRYVAKVSSDAHIKVMRFMRPGRMEFEGESLFLHHAYSVGGCRHASYTCICGSGTNSSIL  257

Query  61   HYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKFTEKQAYIYNAVLSANR  120
            HYGHA APN K V DGD+ +FDMG++YCGYA+DITC++P NGKFT+ Q +IYNAVL A  
Sbjct  258  HYGHAGAPNSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFIYNAVLDARN  317

Query  121  AVMEAAKPGVSWVDMHHLANKVVLSKLLDIGLLRGTIDELMEHNIGALFQPHGLGHLIGI  180
            AV E+A+ GVSWVDMH LA +V+L +L + G+L+G ++E++E  +  +FQPHGLGHLIG+
Sbjct  318  AVTESARDGVSWVDMHKLAGRVLLQRLKEGGMLKGDVEEMLEAGVSGVFQPHGLGHLIGL  377

Query  181  DVHDVGGYLPHCPPRGTLPGLKSLRTARVLAENMVLTIEPGCYFIPAILEKAFKDEKIAF  240
            DVHDVGGYLP  P R + P L  LR AR+L   M +TIEPGCYFI  ++++A  D  IA 
Sbjct  378  DVHDVGGYLPKEPKRPSEPWLSKLRFARILKAGMYVTIEPGCYFINWLMDRALADPNIAK  437

Query  241  LFNQDKIREYFNTGGVRIEDVVVVKANGIENLVNVPRTVEEIEKWM  286
              N +    + N GGVRIED V++   G+EN   VPRTVE+IE  M
Sbjct  438  FINAEMFNRFRNFGGVRIEDDVLITKTGVENFAIVPRTVEDIEATM  483


>Q38D78_TRYB2 unnamed protein product
Length=489

 Score = 311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 196/286 (69%), Gaps = 4/286 (1%)

Query  1    MRYASRISSEAHRSVMRKVSAGMYEYQAEAIFKHYILYVGGSRHVAYTCICASGGNGAVL  60
            +RY  R+SS+AH  VM++   GM ++Q E+ F H++ Y GG R VAYTCICA+G  GAVL
Sbjct  189  LRYVCRVSSDAHIHVMQQCKPGMSQHQLESTFLHHVYYHGGCRKVAYTCICATGHYGAVL  248

Query  61   HYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKFTEKQAYIYNAVLSANR  120
            HY +  AP    + DG M + DMG  Y GYASDITCS+PVNGKFT  Q  IYNAVL A+ 
Sbjct  249  HYPNNDAP----IEDGSMALLDMGGHYMGYASDITCSFPVNGKFTSDQVMIYNAVLDAHD  304

Query  121  AVMEAAKPGVSWVDMHHLANKVVLSKLLDIGLLRGTIDELMEHNIGALFQPHGLGHLIGI  180
            +VM++ +PG +WVDMH LA +V+   LL  GLL G +D +M+  I  LFQPHGLGHL+G+
Sbjct  305  SVMKSLRPGTNWVDMHKLALRVMCKHLLRAGLLMGDVDTIMQKRIMGLFQPHGLGHLLGM  364

Query  181  DVHDVGGYLPHCPPRGTLPGLKSLRTARVLAENMVLTIEPGCYFIPAILEKAFKDEKIAF  240
            DVHDVGGYL  CP R        LRTARVL + M LT+EPGCY   ++L  AF + ++  
Sbjct  365  DVHDVGGYLEDCPKRPVESDCCKLRTARVLEKGMCLTVEPGCYINRSLLTDAFVNPEMKP  424

Query  241  LFNQDKIREYFNTGGVRIEDVVVVKANGIENLVNVPRTVEEIEKWM  286
              +++ +R+ +N GGVRIE  VV+   G+ NL  VPRTVEEIE+ M
Sbjct  425  HLHEEGLRKLWNFGGVRIESDVVITETGVVNLTVVPRTVEEIERTM  470


>XPP_DROME unnamed protein product
Length=613

 Score = 47.8 bits (112),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 7/109 (6%)

Query  45   VAYTCICASGGNGAVLHYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKF  104
            +++T I ASG NG+V+HY H     ++++ND ++ + D G+ Y    +D+T +    G+ 
Sbjct  372  LSFTTISASGPNGSVIHY-HPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEP  429

Query  105  TEKQAYIYNAVLSANRAVMEAAKPG-VSWVDMHHLANKVVLSKLLDIGL  152
            TE Q   Y  VL    +      P  V    +  LA K     L D+GL
Sbjct  430  TEFQKEAYTRVLKGQLSFGSTVFPAKVKGQVLDTLARKA----LWDVGL  474



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02290.1.1 Protein

Length=1163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    146     4e-35


>VIR_DROME unnamed protein product
Length=1854

 Score = 146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/336 (28%), Positives = 169/336 (50%), Gaps = 31/336 (9%)

Query  804   EIVDYLNELYYLSFTHEGKHAISHVLTSDKNISLLLKIYKSKAEVDI---------KQKS  854
             ++  +++ +Y  +    G+     VL  + N+ + + + K +  +           K KS
Sbjct  882   KLATHMHAIYSQTCDPAGRQHTVEVLGLNNNLKIFMDLIKKEQRLQTQRQLSSPGTKYKS  941

Query  855   PSKLYISDLIKLAIKYSNHVPFLIKYSNDLMNL--NNQDYPD-----LVEIGPYLKPLYI  907
             P   Y  D++   ++Y   + +LI++   ++ L  N++ +       L E+  Y+KPL  
Sbjct  942   PVLSYAVDMVDACVRYCEQLDYLIEHGGVILELAKNHETFEPSVSAVLQEMYVYMKPLEA  1001

Query  908   KEIFSYDDIFEHVDILKKHMDNICNLSGEVITVLRILNYIS-----GNHLEDDIQEYKQL  962
               +F YDDI   V+++ + +D +    G++I  +RIL Y+S            + E  +L
Sbjct  1002  INVFVYDDIMPLVEVIGRSLDYLTTFPGDLIMAMRILRYLSISKPLAGQKAPPVTE--EL  1059

Query  963   KYKYVILQLYSLDGIHILTSILTKLVAHYEQAFVH----MFTNCYSLMSVISLSIKLLAK  1018
             K+++V LQLY+ DG+ +   I+ +L A++EQ   H    M         ++  ++++L +
Sbjct  1060  KHRFVALQLYAADGVQLCIQIMERLCAYFEQPGAHAPALMTIQGVHCCQIMLPTLQILRE  1119

Query  1019  MLYYVIQARNADYKDLTCVDTLLNIHTLCYYIPVSSNGYAIAQEICKDVVSVLLSYTLPV  1078
             +L Y I  R+  YKDLT +D L+ ++ L YY P         ++   +VV  LL+YT P 
Sbjct  1120  LLSYAILCRDGTYKDLTAIDHLVKVYYLLYYFPTRCQAGPEVEQCKMEVVQTLLAYTQP-  1178

Query  1079  TTEGDEKDALYNSLWSRMMTSVIKYVTNSPHLFIPG  1114
               E DE ++L+ SLW+ M+  V+K V    H FIPG
Sbjct  1179  -NEQDE-ESLHKSLWTLMIREVLKNVDGPAH-FIPG  1211


 Score = 103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/291 (27%), Positives = 148/291 (51%), Gaps = 30/291 (10%)

Query  493  VNIGLDYDKALNQVEASYKVRHIKIGVRLTEAILSLDQDINYVLLTEHGVD--KRLLHLF  550
            + I L +  A  Q + ++K+RHIK+G R+ E +L   +++   LL EH  D  + +  L+
Sbjct  496  LQIALSFQAACMQPQPAFKIRHIKLGARMAE-LLGSSEELFQHLLKEHKFDIFEAVFRLY  554

Query  551  QQEYMALSIKLLIIKTFDTLLVNSKVTQEFI--RRGGYKDLLEMIESKQLIRVKFALKNL  608
             + YMALSIKL ++K    LL      + F+  +  GY+ ++E I++ +L R K+AL+ +
Sbjct  555  HEPYMALSIKLQLLKAVYALLDTRMGIEHFMGAKNNGYQMIVEAIKTAKLTRTKYALQAI  614

Query  609  LHKIHMHETLQDLSDIIKRDIQD-------KESMEVCLLLLDQVLSGYK---------QI  652
            + K+H+ E L+ +    +R   D       ++ ME  ++   Q+   ++         Q+
Sbjct  615  IKKLHLWEGLESVQIWCRRLFVDRIIIPGNRDQMEDTVITCQQIEFAFEMLMDALFSSQL  674

Query  653  PYKIIQPKRFIPAGSQFDIAS--SIPGDLYRSIFLFYREFGLLESFLYLLTLSNLSHYTS  710
             Y  +QP+RF+P   +F++ +  +       ++  +  +  L ES L +L        T+
Sbjct  675  SY--LQPRRFLPVSKKFEVVTDPTAQRSFGNALQSYLGQNSLAESLLVMLANCKELPATT  732

Query  711  VISYIVELLSIVSESHDGLLFLMHYPGDVTNKLLRILLGSSNEEPEVPEHP  761
             +S +++L+  +  SH G+ + +     VT  ++ ILLG      EVP +P
Sbjct  733  YLS-MLDLMHTLLRSHVGIDYFVDDAFPVTQTIVAILLGLD----EVPRNP  778



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02300.1.1 Activating

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EDK1_CAEEL  unnamed protein product                                 108     2e-25
KLP68_DROME  unnamed protein product                                  32.7    0.76 


>G5EDK1_CAEEL unnamed protein product
Length=425

 Score = 108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 104/390 (27%), Positives = 174/390 (45%), Gaps = 32/390 (8%)

Query  98   KERRRCDCEASEHKLINNCLKCGRIVCSVEGSGPCLFCGELVCSREERRLIEQ-SDQGDT  156
            K R  C C+A  HKLI NCL CGRIVC  EGSGPC  CG LVC+REER ++ + +++   
Sbjct  33   KGRHECLCQARTHKLILNCLGCGRIVCEQEGSGPCFTCGTLVCTREEREILNRGTNKSRD  92

Query  157  LYQKLMD--------RKVIKGLEEALKNRDRLVDFDRNCEKRTTVIDDAHDY-FCDNSVW  207
            L  +L          +++    + A + R++L++ D + E+RT V D   DY   +NS +
Sbjct  93   LLARLTGDGSDIGSLKQISSSYQNATEFRNKLLEADADTERRTKVNDLQSDYSTIENSPF  152

Query  208  LTKEERAKIAQKQEELDRQRHSRLGPRKITIDFAGREVR------AEDNMVDTYSPDVLD  261
            L+  +R  +  ++EEL   R        +++DF G  V         + + D   P V+ 
Sbjct  153  LSASDREALKLRREELKALREKERKKFVVSLDFDGGVVHEMTRRSGTEALQDKNDP-VIQ  211

Query  262  DIVSKSSSQSGTPTMSPRVTIDVTSRTGNLALESKILSRGTGAGKQGILSLKFPQNSLVG  321
             I+ +   +          T D  +R   +    + ++      +Q            + 
Sbjct  212  RIMERVDEKHRIQEALHNSTAD--ARWNPIGFVPRYMTEDGDHPQQECSDGDIIDADSLM  269

Query  322  RVQDRGLLEMT-DVGACLSIHQPWATLLVKGTRKEGRTWYTP--HRGKLWIASTSKQPTP  378
             V D    ++T + G  L++ QP A+ LV G  +  R W T    +G L+I + +     
Sbjct  270  IVSDELAAQITEEKGYVLALAQPTASFLVNGLCRFIR-WPTDLNLKGPLFITAKAGGTNE  328

Query  379  EDIK-LAKNVYGEDNFPTK--FPSGCLLGCVLLVDCLPQEEYREQY------PDGVDDSP  429
            + I+  AK    + N  ++  F  G +LG   L +C+  E++ ++Y      P G     
Sbjct  329  KMIREFAKKYVRDVNKISELDFSDGAVLGRAFLQECMMLEDFLDKYGSKSAIPGGDGQFV  388

Query  430  YVFVCESPLELAIQFPMKGKPNIYKLDPKI  459
              F    PL   I         IY++D ++
Sbjct  389  LCFSAFEPLVSTIPHISTADSYIYEMDRQL  418


>KLP68_DROME unnamed protein product
Length=784

 Score = 32.7 bits (73),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query  210  KEERAKIAQKQEELDRQR--HSRLGPRKITIDFAGREVRAEDNMVDTYS  256
            KE  A++A+  EEL+R+R  +S+L  +    +  G+ VR   N++DTYS
Sbjct  432  KENEAEVAKSNEELERERVENSKLAAK--LAELEGQLVRGGKNLLDTYS  478



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02310.1.1 Xaa-Pro

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VG79_DROME  unnamed protein product                                 211     6e-66
Q38D78_TRYB2  unnamed protein product                                 185     6e-56
XPP_DROME  unnamed protein product                                    48.5    2e-06


>Q9VG79_DROME unnamed protein product
Length=491

 Score = 211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 125/162 (77%), Gaps = 0/162 (0%)

Query  1    MRYASRISSEAHRSVMRKVSAGMYEYQAEAIFKHYILYVGGSRHVAYTCICASGGNGAVL  60
            +RY +++SS+AH  VMR +  G  E++ E++F H+   VGG RH +YTCIC SG N ++L
Sbjct  198  LRYVAKVSSDAHIKVMRFMRPGRMEFEGESLFLHHAYSVGGCRHASYTCICGSGTNSSIL  257

Query  61   HYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKFTEKQAYIYNAVLSANR  120
            HYGHA APN K V DGD+ +FDMG++YCGYA+DITC++P NGKFT+ Q +IYNAVL A  
Sbjct  258  HYGHAGAPNSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFIYNAVLDARN  317

Query  121  AVMEAAKPGVSWVDMHLLANKVVLSKLLDIGLLRGTIDELME  162
            AV E+A+ GVSWVDMH LA +V+L +L + G+L+G ++E++E
Sbjct  318  AVTESARDGVSWVDMHKLAGRVLLQRLKEGGMLKGDVEEMLE  359


>Q38D78_TRYB2 unnamed protein product
Length=489

 Score = 185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 119/181 (66%), Gaps = 5/181 (3%)

Query  1    MRYASRISSEAHRSVMRKVSAGMYEYQAEAIFKHYILYVGGSRHVAYTCICASGGNGAVL  60
            +RY  R+SS+AH  VM++   GM ++Q E+ F H++ Y GG R VAYTCICA+G  GAVL
Sbjct  189  LRYVCRVSSDAHIHVMQQCKPGMSQHQLESTFLHHVYYHGGCRKVAYTCICATGHYGAVL  248

Query  61   HYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKFTEKQAYIYNAVLSANR  120
            HY +    ND  + DG M + DMG  Y GYASDITCS+PVNGKFT  Q  IYNAVL A+ 
Sbjct  249  HYPN----NDAPIEDGSMALLDMGGHYMGYASDITCSFPVNGKFTSDQVMIYNAVLDAHD  304

Query  121  AVMEAAKPGVSWVDMHLLANKVVLSKLLDIGLLRGTIDELMEI-LEKAFKDEKIAFLFNQ  179
            +VM++ +PG +WVDMH LA +V+   LL  GLL G +D +M+  +   F+   +  L   
Sbjct  305  SVMKSLRPGTNWVDMHKLALRVMCKHLLRAGLLMGDVDTIMQKRIMGLFQPHGLGHLLGM  364

Query  180  D  180
            D
Sbjct  365  D  365


 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)

Query  163  ILEKAFKDEKIAFLFNQDKIREYFNTGGVRIEDVVVVKANGIENLVNVPRTVEEIEKWM  221
            +L  AF + ++    +++ +R+ +N GGVRIE  VV+   G+ NL  VPRTVEEIE+ M
Sbjct  412  LLTDAFVNPEMKPHLHEEGLRKLWNFGGVRIESDVVITETGVVNLTVVPRTVEEIERTM  470


>XPP_DROME unnamed protein product
Length=613

 Score = 48.5 bits (114),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 7/109 (6%)

Query  45   VAYTCICASGGNGAVLHYGHASAPNDKRVNDGDMLVFDMGSSYCGYASDITCSYPVNGKF  104
            +++T I ASG NG+V+HY H     ++++ND ++ + D G+ Y    +D+T +    G+ 
Sbjct  372  LSFTTISASGPNGSVIHY-HPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEP  429

Query  105  TEKQAYIYNAVLSANRAVMEAAKPG-VSWVDMHLLANKVVLSKLLDIGL  152
            TE Q   Y  VL    +      P  V    +  LA K     L D+GL
Sbjct  430  TEFQKEAYTRVLKGQLSFGSTVFPAKVKGQVLDTLARKA----LWDVGL  474



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02320.1.1 Xaa-Pro

Length=99
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VG79_DROME  unnamed protein product                                 44.3    3e-06
BARD1_CAEEL  unnamed protein product                                  31.6    0.078
WAPL_DROME  unnamed protein product                                   28.5    1.0  


>Q9VG79_DROME unnamed protein product
Length=491

 Score = 44.3 bits (103),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)

Query  51   LQSKSPSVLLTLAGVNTDSDLHAIEATFKGIEKFKVDNQILFPVIAE  97
            L+  SP ++LTL+G N+DS L      F G EK+  D  +L+P+++E
Sbjct  139  LEGASPKLILTLSGTNSDSGLTLQPPDFAGKEKYVTDCNLLYPILSE  185


>BARD1_CAEEL unnamed protein product
Length=702

 Score = 31.6 bits (70),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 1/56 (2%)

Query  42   RGNKKIVQVLQSKSPSV-LLTLAGVNTDSDLHAIEATFKGIEKFKVDNQILFPVIA  96
            R N +IV+ L SK  S+ +  +AG   +    +     K IEKFK + ++L PV+A
Sbjct  424  RQNTQIVEYLLSKGASIKIRNIAGKTVEEMAKSDPKIRKIIEKFKTEQRVLQPVVA  479


>WAPL_DROME unnamed protein product
Length=1741

 Score = 28.5 bits (62),  Expect = 1.0, Method: Composition-based stats.
 Identities = 21/81 (26%), Positives = 33/81 (41%), Gaps = 0/81 (0%)

Query  2     NAPFTSCLIDYFLIHKCRLSDQRFSILRARVVLVSVQIFDRGNKKIVQVLQSKSPSVLLT  61
             N P T CL    L  KC +   R  +    VV    +     NK +   L + +   +L+
Sbjct  1183  NPPATRCLSALQLAAKCMMPAFRMHVRAHGVVTKFFKALSDANKDLSLGLCTSAIMYILS  1242

Query  62    LAGVNTDSDLHAIEATFKGIE  82
               G+N D D  ++E     +E
Sbjct  1243  QEGLNMDLDRDSLELMINLLE  1263



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02330.1.1 histone

Length=196
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCB8_DROME  unnamed protein product                                 31.2    0.61 
CYAD_DICDI  unnamed protein product                                   30.8    0.91 
A1Z951_DROME  unnamed protein product                                 30.4    0.92 


>Q9VCB8_DROME unnamed protein product
Length=1122

 Score = 31.2 bits (69),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 56/111 (50%), Gaps = 23/111 (21%)

Query  85   GQDVGKMLKEMAK--KWDGFEKKVSKKLDDFEANLNFYGEKVEQSCTTLKNLEQKLIAME  142
            GQ   +  K M K  +   F+ +   + D  +++L   GEK+E+     + L++KL++++
Sbjct  765  GQHQSRNQKAMQKIMELQNFDYQELPEYDRLKSHLADSGEKIEKCRLEREMLQEKLLSIQ  824

Query  143  KR---IDKTETENR------------------ELKTRLRTLEIQIQENTQK  172
             R   ++ TE E R                  E+++++R+L++  +ENT++
Sbjct  825  HRQTELESTEAEERRALEGINKKLTALDTEAGEVESKMRSLDLHYEENTRR  875


>CYAD_DICDI unnamed protein product
Length=2123

 Score = 30.8 bits (68),  Expect = 0.91, Method: Composition-based stats.
 Identities = 22/80 (28%), Positives = 42/80 (53%), Gaps = 6/80 (8%)

Query  89   GKMLKEMAKKWDGFEKKVSKKLDDFEANLNFYGEKVEQSCTTLKNLEQKLIAMEKRIDKT  148
            G+  K + K+ + + +++S ++++  A +N    K+  S T    L QK+  M+K +DK 
Sbjct  599  GEKYKRLKKRGEKYHRRLSTQINEQNAFVN----KIYASGTA--QLLQKVEFMQKFVDKI  652

Query  149  ETENRELKTRLRTLEIQIQE  168
                 E+  RL+ LE   Q+
Sbjct  653  LFSTLEISNRLQRLESSDQD  672


>A1Z951_DROME unnamed protein product
Length=639

 Score = 30.4 bits (67),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 0/62 (0%)

Query  102  FEKKVSKKLDDFEANLNFYGEKVEQSCTTLKNLEQKLIAMEKRIDKTETENRELKTRLRT  161
            FEK++ +++++    +     K  Q+C   K L+ +    E  +   + ENR L TR+R 
Sbjct  86   FEKELREQIENMNRIMKSKERKQMQTCRDHKALQTRFARQESLLQSMQQENRSLLTRIRQ  145

Query  162  LE  163
             E
Sbjct  146  YE  147



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02340.1.1 Unknown

Length=178


***** No hits found *****



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02350.1.1 E3

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RNF5_CAEEL  unnamed protein product                                   142     3e-42
Q582V4_TRYB2  unnamed protein product                                 59.7    1e-10
Q9W0D7_DROME  unnamed protein product                                 56.6    1e-09


>RNF5_CAEEL unnamed protein product
Length=235

 Score = 142 bits (358),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)

Query  21   DQKKTDGGNDKSQIYDCNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAA  80
            ++  +    D+S  ++CNIC D AKDAV+S+CGHLFCWPCL QWL+T PN Q CPVCK+A
Sbjct  10   EEPTSSSNKDESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQVCPVCKSA  69

Query  81   IDKDKVIPVYGRGGSEIDPRDEVPPRPQGQRTE  113
            ID +KV+P+YGRGG   DPR +VPPRP+GQR+E
Sbjct  70   IDGNKVVPIYGRGGDSSDPRKKVPPRPKGQRSE  102


>Q582V4_TRYB2 unnamed protein product
Length=298

 Score = 59.7 bits (143),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 12/87 (14%)

Query  16   DEGSGDQKKTDG----GNDKSQIYD--------CNICFDTAKDAVISMCGHLFCWPCLHQ  63
            + G+G+Q +  G    G D S   D        C +C    K    ++CGH+FCW CL +
Sbjct  195  NRGAGEQNEQGGAAGRGEDDSDTADEHASVSGKCMLCLGNRKQPTATLCGHIFCWRCLSE  254

Query  64   WLETCPNRQTCPVCKAAIDKDKVIPVY  90
            W+++      CP C+  I  + ++P+Y
Sbjct  255  WIKSNTQGAICPFCRRRITVNSLVPLY  281


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 56.6 bits (135),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 3/51 (6%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVI  87
            C +C +   D+ ++ CGH+FCW CL +WLE    R  CP+C+ ++ K +VI
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVI  293



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02350.1.2 E3

Length=247
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RNF5_CAEEL  unnamed protein product                                   141     2e-41
Q582V4_TRYB2  unnamed protein product                                 58.5    6e-10
Q9W0D7_DROME  unnamed protein product                                 55.5    7e-09


>RNF5_CAEEL unnamed protein product
Length=235

 Score = 141 bits (356),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)

Query  21   DQKKTDGGNDKSQIYDCNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAA  80
            ++  +    D+S  ++CNIC D AKDAV+S+CGHLFCWPCL QWL+T PN Q CPVCK+A
Sbjct  10   EEPTSSSNKDESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQVCPVCKSA  69

Query  81   IDKDKVIPVYGRGGSEIDPRDEVPPRPQGQRTE  113
            ID +KV+P+YGRGG   DPR +VPPRP+GQR+E
Sbjct  70   IDGNKVVPIYGRGGDSSDPRKKVPPRPKGQRSE  102


>Q582V4_TRYB2 unnamed protein product
Length=298

 Score = 58.5 bits (140),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 12/87 (14%)

Query  16   DEGSGDQKKTDG----GNDKSQIYD--------CNICFDTAKDAVISMCGHLFCWPCLHQ  63
            + G+G+Q +  G    G D S   D        C +C    K    ++CGH+FCW CL +
Sbjct  195  NRGAGEQNEQGGAAGRGEDDSDTADEHASVSGKCMLCLGNRKQPTATLCGHIFCWRCLSE  254

Query  64   WLETCPNRQTCPVCKAAIDKDKVIPVY  90
            W+++      CP C+  I  + ++P+Y
Sbjct  255  WIKSNTQGAICPFCRRRITVNSLVPLY  281


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 55.5 bits (132),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 3/51 (6%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVI  87
            C +C +   D+ ++ CGH+FCW CL +WLE    R  CP+C+ ++ K +VI
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVI  293



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02360.1.1 dentin

Length=261
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38D82_TRYB2  unnamed protein product                                 28.9    6.2  


>Q38D82_TRYB2 unnamed protein product
Length=1578

 Score = 28.9 bits (63),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 38/89 (43%), Gaps = 12/89 (13%)

Query  50   CPKGQVCCTATVQEV--QDTKIHNIGVKEDRKAQDTKIPTISAKEDRGVKEDRKAPL---  104
            CP   +CC A V+E   Q+ ++    V E     +  IP  +A+ DR    D +  L   
Sbjct  458  CPSQLICCDAAVKEKKWQEHQVFKQYVVEGADTPELVIPDYNAEFDR-CGADGQVHLKHL  516

Query  105  ------VLQNITRSFTVHRPKIRERKTTF  127
                  V + I R  + H P ++E   ++
Sbjct  517  EEFCQAVYERIQRVMSAHFPPVKEGHPSY  545



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02370.1.1 Unknown

Length=193
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JW07_DROME  unnamed protein product                                 28.9    2.6  


>Q7JW07_DROME unnamed protein product
Length=231

 Score = 28.9 bits (63),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  15   GGQKASLHTFGPASGRRSIPVIVPCIMGEE  44
            GGQ  S  T+GP +  R + V + C+  EE
Sbjct  158  GGQSVSFVTYGPFNRNRIMTVPLKCVSAEE  187



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02380.1.1 E3

Length=239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RNF5_CAEEL  unnamed protein product                                   143     4e-42
Q582V4_TRYB2  unnamed protein product                                 59.3    3e-10
Q9W0D7_DROME  unnamed protein product                                 57.4    2e-09


>RNF5_CAEEL unnamed protein product
Length=235

 Score = 143 bits (360),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 6/107 (6%)

Query  17   EGSGDQKKTDGGNDKSQIYDCNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPV  76
            +   ++  +    D+S  ++CNIC D AKDAV+S+CGHLFCWPCL QWL+T PN Q CPV
Sbjct  6    KAPSEEPTSSSNKDESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQVCPV  65

Query  77   CKAAIDKDKVIPVYGRGGSEIDPRDEVPPRPQGQRTERENSSIPPEQ  123
            CK+AID +KV+P+YGRGG   DPR +VPPRP+GQR+E      PP Q
Sbjct  66   CKSAIDGNKVVPIYGRGGDSSDPRKKVPPRPKGQRSE------PPPQ  106


>Q582V4_TRYB2 unnamed protein product
Length=298

 Score = 59.3 bits (142),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 12/87 (14%)

Query  16   DEGSGDQKKTDG----GNDKSQIYD--------CNICFDTAKDAVISMCGHLFCWPCLHQ  63
            + G+G+Q +  G    G D S   D        C +C    K    ++CGH+FCW CL +
Sbjct  195  NRGAGEQNEQGGAAGRGEDDSDTADEHASVSGKCMLCLGNRKQPTATLCGHIFCWRCLSE  254

Query  64   WLETCPNRQTCPVCKAAIDKDKVIPVY  90
            W+++      CP C+  I  + ++P+Y
Sbjct  255  WIKSNTQGAICPFCRRRITVNSLVPLY  281


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 57.4 bits (137),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 3/51 (6%)

Query  37   CNICFDTAKDAVISMCGHLFCWPCLHQWLETCPNRQTCPVCKAAIDKDKVI  87
            C +C +   D+ ++ CGH+FCW CL +WLE    R  CP+C+ ++ K +VI
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVI  293



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02390.1.1 Nephrin

Length=101
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KIB0_DROME  unnamed protein product                                 77.0    8e-18
Q59DZ1_DROME  unnamed protein product                                 71.2    1e-15
Q9VFU7_DROME  unnamed protein product                                 55.5    3e-10


>Q0KIB0_DROME unnamed protein product
Length=1689

 Score = 77.0 bits (188),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 0/95 (0%)

Query  2    SVQIVNKPIRLVANQEHTFICHVAGSRPSPQVTWWSDSKSFNRGKIDEHSNETLTVSKLR  61
            SV + NK     +N ++   C VAGS P  ++ W  +++ F RG +    +    +S L 
Sbjct  278  SVNLTNKLKVFASNTQYNLTCIVAGSVPDTEIKWTQNNRPFKRGLLSTSQSNGRVISTLT  337

Query  62   FMPTPDDDSRSLKCRGENPVLQDASLEDTVSLNVV  96
            F P P+DD   LKC G NP LQ++++ED++ +NV+
Sbjct  338  FYPQPEDDGTMLKCEGSNPRLQNSAIEDSLMMNVI  372


 Score = 30.0 bits (66),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (54%), Gaps = 0/26 (0%)

Query  20   FICHVAGSRPSPQVTWWSDSKSFNRG  45
              C V G RP P VTW + +++   G
Sbjct  198  LTCEVRGGRPEPTVTWMNGTRTLEAG  223


>Q59DZ1_DROME unnamed protein product
Length=1064

 Score = 71.2 bits (173),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 2/96 (2%)

Query  1    LSVQIVNKPIRLVANQEHTFICHVAGSRPSPQVTWWSDSKSFNRGKIDEHSNETLTVSKL  60
            L V+I+  P  ++A++ +   C  +GSRP+  +TW+   +   R K D   N T   S+L
Sbjct  271  LVVKILEPPSSMIADRRYEVSCESSGSRPNAIITWYKGKRQLRRTKDDISKNSTR--SEL  328

Query  61   RFMPTPDDDSRSLKCRGENPVLQDASLEDTVSLNVV  96
             F+PT DDD +S+ CR ENP +    LE    LNVV
Sbjct  329  SFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVV  364


 Score = 26.6 bits (57),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 9/14 (64%), Gaps = 0/14 (0%)

Query  22   CHVAGSRPSPQVTW  35
            C V G RP PQV W
Sbjct  195  CRVVGGRPQPQVRW  208


>Q9VFU7_DROME unnamed protein product
Length=1001

 Score = 55.5 bits (132),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 50/91 (55%), Gaps = 4/91 (4%)

Query  1    LSVQIVNKPIRLVANQEHTFICHVAGSRPSPQVTWWSDSKSFNR--GKIDEHSNETLTVS  58
            ++V I+ K   + A++ +   C  +GS+P   +TWW  SK   +     +E  N++L++ 
Sbjct  298  IAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSLSI-  356

Query  59   KLRFMPTPDDDSRSLKCRGENPVLQDASLED  89
             L F P  +DD + L CR EN  +  +++ED
Sbjct  357  -LTFTPGREDDGKYLTCRAENQFIDGSAIED  386


 Score = 30.4 bits (67),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  22   CHVAGSRPSPQVTWWSDSKSFN  43
            C V+G RP P VTW+ D+ + +
Sbjct  222  CEVSGGRPRPNVTWYLDNTAID  243



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02400.1.1 RNA-directed

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RTXE_DROME  unnamed protein product                                   92.0    2e-21
RTBS_DROME  unnamed protein product                                   80.1    2e-17
Q54DH4_DICDI  unnamed protein product                                 36.6    0.013


>RTXE_DROME unnamed protein product
Length=908

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 87/162 (54%), Gaps = 5/162 (3%)

Query  28   VPPFTLEDLVEVSAKMKSKKAPGPDSILPEIVKSAVMAVPEWVLAVMNKILLNGDFPSMW  87
            + PF   ++ EV  +  + KAPG D I    +K+       ++  V N I+    FP  W
Sbjct  433  ITPFEPCEVAEVIVRQSNNKAPGHDVICNATLKALPRQAILYITLVFNAIVRLQYFPYQW  492

Query  88   KRAKVVLLPKPGKPAFQPSSYRPLCLLDTFSKLLEGLLIRRMMEELGERGLS-ESQFGFR  146
            K   + ++ KPGKP  +P+SYRP+ LL + SK+ E L+  R++  +  +G++ E QFGFR
Sbjct  493  KLGIISMIHKPGKPEREPASYRPISLLPSISKVFERLIAVRIVSIMEAQGITPEHQFGFR  552

Query  147  PQRSTVDAIQRVFSIADEERKKSRRRRGFCLLVTLDVRNAFN  188
                TV+ + RV     E+   +   + +C  + LD+R AF+
Sbjct  553  AGHCTVEQLHRVV----EQILTAYDSKEYCNSLFLDIREAFD  590


>RTBS_DROME unnamed protein product
Length=906

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 55/169 (33%), Positives = 92/169 (54%), Gaps = 5/169 (3%)

Query  21   PDVTSDSVPPFTLEDLVEVSAKMKSKKAPGPDSILPEIVKSAVMAVPEWVLAVMNKILLN  80
            P   S  + P  +E++VE    +  KK+PG D++    +K+  +    ++  + N IL  
Sbjct  427  PLQMSLPIKPIRVEEIVEAIKSLPLKKSPGIDNVCNATLKALPVRAILYLALIYNAILRV  486

Query  81   GDFPSMWKRAKVVLLPKPGKPAFQPSSYRPLCLLDTFSKLLEGLLIRRMMEELGERG-LS  139
              FP  WK A ++++ KPGKP   P SYRP+ LL + SKL E L+  R+ + + ER  L 
Sbjct  487  QFFPKQWKMAAILMIHKPGKPEESPESYRPISLLSSLSKLWERLIANRLNDIMTERRILP  546

Query  140  ESQFGFRPQRSTVDAIQRVFSIADEERKKSRRRRGFCLLVTLDVRNAFN  188
            + QFGFR   STV+ + R+     +   ++   + +C  V +D++ AF+
Sbjct  547  DHQFGFRQGHSTVEQVHRL----TKHILQAFDDKEYCNAVFIDMQQAFD  591


>Q54DH4_DICDI unnamed protein product
Length=1264

 Score = 36.6 bits (83),  Expect = 0.013, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 58/122 (48%), Gaps = 5/122 (4%)

Query  30   PFTLEDLVEVSAKM-KSKKAPGPDSILPEIVKSAVMAVPEWVLAVMNKILLN-GDFPSMW  87
            PF ++D VE + K     K+PGPD +      + +  V   +  + N IL N     + +
Sbjct  786  PF-IQDEVEAAIKTCNPNKSPGPDGVTNAFYINHLNQVKPILTTLFNDILENPHHITTEF  844

Query  88   KRAKVVLLPKPGKPAFQPSSYRPLCLLDTFSKLLEGLLIRRMMEELGERGLSESQFGFRP  147
                +  + K G P    S+ RP+ LL+T  K+L  ++  R++  L    ++ +Q GF P
Sbjct  845  TEGLIHTIYKKGNPLL-ISNRRPITLLNTDYKILSKVINARLLRIL-PFIINNNQTGFVP  902

Query  148  QR  149
             R
Sbjct  903  HR  904



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


Query= Dcitr00g02410.1.1 Organic

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CART_DROME  unnamed protein product                                   332     5e-103
BALAT_DROME  unnamed protein product                                  271     3e-81 
OCTL_DROME  unnamed protein product                                   270     6e-81 


>CART_DROME unnamed protein product
Length=674

 Score = 332 bits (850),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 201/611 (33%), Positives = 317/611 (52%), Gaps = 28/611 (5%)

Query  177  IETDLDFDDILPHLGEFGRYQKILFFAM-IPFAFSVAFVYFAQIFITVIPERYWCQVPEL  235
            ++   D DD+LP +GEFG+YQK+L F + +P      F  F Q+F+   P+ YWC++PEL
Sbjct  30   VDEAFDLDDLLPTIGEFGKYQKLLVFGICLPACIPCGFCAFNQLFMADTPDDYWCRIPEL  89

Query  236  SHLDPEQRRLLSIPRKGS----TFDSCSMYAVNFTSLIAAG------ITEADPSWPISEC  285
              L  EQR+ LSIP++       +  C  Y VN+T L+ +G        E + SWP+ +C
Sbjct  90   LDLPLEQRKSLSIPKELDNDELVYSKCYTYGVNWTQLLESGEEDDLTTMEPNASWPLIKC  149

Query  286  QHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPA  345
              GWEY  T V ++SI  + + VC QD  PT+  A    G  VG  +FG + D  GR  +
Sbjct  150  PQGWEYN-TSVVWSSIVIDFDLVCDQDIYPTIGLAALNTGGPVGVYLFGLLNDRGGRRLS  208

Query  346  LVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVAN  405
                  T     + T+ +  FW +A  R  VGL     + + +I+ LE VG ++R+FV  
Sbjct  209  YFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTIPAVYQIPFIISLELVGENYRSFVTV  268

Query  406  MSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDE  465
            M+   F+T    LL  + Y   +W  L  ITSLP     +  +++PES RWL+ +GR++E
Sbjct  269  MT-CTFYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEE  327

Query  466  AVVIMKRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSV--LDLFRTPRLRNITCL  523
            A+ I++R  K+N ++    ++ +L+   +R   ++   K  +V   DL RTP +R  T L
Sbjct  328  ALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRTPNMRLKTIL  387

Query  524  LIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGT  583
            + + W A   V+ G       LG + +++F L++  ELP+     + +D WGRRW    +
Sbjct  388  ITLSWFANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSLS  447

Query  584  MVFSGVFSLLSSSVETGKLSAGLAI--IGRFLVNISYNTGLQYAAEVLPTVVRAQGVALI  641
            M+  GV  +++  +    +   L +  + + L++ S+     +A E+ PT VR  G+   
Sbjct  448  MILGGVACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPTQVRGIGIGAS  507

Query  642  HIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGEN  701
              +G +  I  PFI YL   N KLPL+I+G + +LGG   L LPETL   LPQT+++GE 
Sbjct  508  SYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGMTGLRLPETLHHRLPQTIEEGEE  567

Query  702  FGRDQKFLDFPCCGKKSDKEEEEKPESYFKRGHKTRGANSSTRSSMRASLRGEQFRSSLI  761
            FG++ +F D  CC      E   +P SY          +S+  S +   LR         
Sbjct  568  FGKNWQFKD--CCRCAQKPEILSQPASY--ENLDVLAGSSTNASEVELELRDS-------  616

Query  762  QRTQRPFQKTD  772
            +R + P  + D
Sbjct  617  RRVREPAPRID  627


>BALAT_DROME unnamed protein product
Length=604

 Score = 271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 186/576 (32%), Positives = 299/576 (52%), Gaps = 33/576 (6%)

Query  181  LDFDDILPHLGEFGRYQKILFFA-MIPFAFSVAFVYFAQIFITVIPERYWCQVPELSHLD  239
            +DFD++L  +G FG YQK++  + ++P A   AF  ++Q+FI   P+ + C+VPEL    
Sbjct  1    MDFDEVLREVGSFGLYQKVIICSVLLPAALPCAFHAYSQLFIAATPQHF-CRVPELEPWT  59

Query  240  PEQRRL---LSIPR-KGSTFDSCSMYAVNFTSLI---------------AAGITEADP-S  279
             +  +L   LSIPR +   +  CSMY+ N+T ++               A  + +  P +
Sbjct  60   QDYVQLVKNLSIPRNRNGAYAECSMYSRNYTDIVRYLEYRPPPDLLRQQAEDLLKLQPDT  119

Query  280  WPISECQHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADH  339
              +  CQHGW Y+   +  +++  E N VC +  L TLA  +F  G ++G  VFG++ D 
Sbjct  120  TQVVPCQHGWHYD-KSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLVDL  178

Query  340  FGRIPALVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSW  399
            +GR P+     L   +A  A+AFA  ++ +   RF VGL         Y+L +E VGP  
Sbjct  179  WGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGPER  238

Query  400  RTFVANMSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVS  459
            R F   +S  I ++L   +L  + Y V +W+ L +  S+PLL+     +++PES RWL++
Sbjct  239  RVFCTIVS-NIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWLMA  297

Query  460  QGRVDEAVVIMKRFEKINNKKVDPKLYQQL--KETCQRQAKQEID-GKRYSVLDLFRTPR  516
             G+   A+ I+K   ++N  +V+    ++L  K    R A+ +      Y +LDLFR P 
Sbjct  298  VGKTRRAIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRGPN  357

Query  517  LRNITCLLIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGR  576
            +R  T ++ +IW A + V+ G       LG D    F LA A ELP   +L   L  +GR
Sbjct  358  MRRKTLIITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLSYFGR  417

Query  577  RWYACGTMVFSGVFSLLSSSVETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQ  636
            RW    +M+  GV  +  ++     ++  L  +G+  ++ S+      A+E+ PTVVR  
Sbjct  418  RWILFISMLVGGVACV--ATFLYPDITLLLYCVGKMGISSSFVVLPLMASELYPTVVRGL  475

Query  637  GVALIHIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTL  696
            G++   ++  V  IV P I ++      LPLI++G + ILGG   L LPET  ++LPQTL
Sbjct  476  GMSFSSVISMVGPIVIPMINHMGQQMLVLPLIVMGALLILGGFASLLLPETRNRNLPQTL  535

Query  697  QDGENFGRDQKFLDFPCCGKKSDKEEEEKPESYFKR  732
            ++GE       FL   CC  +S+++      S  KR
Sbjct  536  EEGE--AVPLSFLL--CCCVESERKPNNIRASPKKR  567


>OCTL_DROME unnamed protein product
Length=567

 Score = 270 bits (690),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 174/545 (32%), Positives = 287/545 (53%), Gaps = 31/545 (6%)

Query  181  LDFDDILPHLGEFGRYQKILFFAMIPFAFSVAFVYFAQIFITVIPERYWCQVP---ELSH  237
            + +D+ + HLG+FGRYQKI++F +   +  VAF   A +F+   P+ + C +P     S+
Sbjct  1    MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPD-FRCALPFENGSSY  59

Query  238  LDPEQRRLLSIPRKGSTFDSCSMYAVNFTSLIAAGITEADPSWPIS--ECQHGWEYEFTD  295
              P     LS P      + CS Y V++T     G      S P S  E +    Y +  
Sbjct  60   DLPTHLWNLSYPEN----ERCSYYDVDYTEEYLNG------SIPRSSNETKTCSSYVYDR  109

Query  296  VPY-TSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPALVGTNLTGF  354
              Y  S  TE N VC +D +   + ++F  G ++G +VFG ++D +GR P L  + +   
Sbjct  110  SKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQV  169

Query  355  VAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVANMSIAIFFTL  414
            + GV    A  ++ +   R  VG      F + Y++ +E VGP  R + A + + +FF++
Sbjct  170  LFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLY-AGIFVMMFFSV  228

Query  415  AASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIMKRFE  474
               L    AY+V +W++L +  +LP L+ +   WI+PESARWL+ +GR D A+  M++  
Sbjct  229  GFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAA  288

Query  475  KINNKKVDPKLYQQL---KETCQRQAKQEID------GKRYSVLDLFRTPRLRNITCLLI  525
            + N  ++  +   +L    E  + +AKQ+++      G   SV DLF  P LR  T L+ 
Sbjct  289  RFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIF  348

Query  526  VIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMV  585
            + W+  S V+ G      NLG ++ + F ++ A E+PA   L  TL+ WGRR   CG +V
Sbjct  349  LDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLV  408

Query  586  FSGVFSLLSSSV---ETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIH  642
             +G+ SLL++ +       L    A++G+  +  SY T   ++AE  PTVVR   +    
Sbjct  409  MAGL-SLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFSAEQFPTVVRNVALGAAS  467

Query  643  IMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENF  702
            ++  ++ +++PF+ +LA I   LPL+I G + ++ G L L LPET  + + +T+ DGE F
Sbjct  468  MVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLETIADGERF  527

Query  703  GRDQK  707
            G+  K
Sbjct  528  GKKTK  532



Lambda      K        H
   0.334    0.143    0.471 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 597058000


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Apr 30, 2020  2:49 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g02420.1.1 Organic

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CART_DROME  unnamed protein product                                   180     7e-51
OCTL_DROME  unnamed protein product                                   178     1e-50
OCT1_CAEEL  unnamed protein product                                   169     3e-47


>CART_DROME unnamed protein product
Length=674

 Score = 180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 187/366 (51%), Gaps = 15/366 (4%)

Query  6    FFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIM  65
            F+T    LL  + Y   +W  L  ITSLP     +  +++PES RWL+ +GR++EA+ I+
Sbjct  273  FYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEEALKIL  332

Query  66   KRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSV--LDLFRTPRLRNITCLLIVIW  123
            +R  K+N ++    ++ +L+   +R   ++   K  +V   DL RTP +R  T L+ + W
Sbjct  333  ERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRTPNMRLKTILITLSW  392

Query  124  MAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMVFSG  183
             A   V+ G       LG + +++F L++  ELP+     + +D WGRRW    +M+  G
Sbjct  393  FANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSLSMILGG  452

Query  184  VFSLLSSSVETGKLSAGLAI--IGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIHIMGY  241
            V  +++  +    +   L +  + + L++ S+     +A E+ PT VR  G+     +G 
Sbjct  453  VACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPTQVRGIGIGASSYIGG  512

Query  242  VASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENFGRNQ  301
            +  I  PFI YL   N KLPL+I+G + +LGG   L LPETL   LPQT+++GE FG+N 
Sbjct  513  LGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGMTGLRLPETLHHRLPQTIEEGEEFGKNW  572

Query  302  KFLDFPCCGKKSDKEEEEKPESYFKRGHKTRGANSSTRSSMRASLRGEQFRSSLIQRTQR  361
            +F D  CC      E   +P SY          +S+  S +   LR         +R + 
Sbjct  573  QFKD--CCRCAQKPEILSQPASY--ENLDVLAGSSTNASEVELELRDS-------RRVRE  621

Query  362  PFQKTD  367
            P  + D
Sbjct  622  PAPRID  627


>OCTL_DROME unnamed protein product
Length=567

 Score = 178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/312 (34%), Positives = 175/312 (56%), Gaps = 13/312 (4%)

Query  3    IAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAV  62
            + +FF++   L    AY+V +W++L +  +LP L+ +   WI+PESARWL+ +GR D A+
Sbjct  222  VMMFFSVGFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAI  281

Query  63   VIMKRFEKINNKKVDPKLYQQL---KETCQRQAKQEID------GKRYSVLDLFRTPRLR  113
              M++  + N  ++  +   +L    E  + +AKQ+++      G   SV DLF  P LR
Sbjct  282  ANMQKAARFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLR  341

Query  114  NITCLLIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRW  173
              T L+ + W+  S V+ G      NLG ++ + F ++ A E+PA   L  TL+ WGRR 
Sbjct  342  RKTLLIFLDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRS  401

Query  174  YACGTMVFSGVFSLLSSSV---ETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRA  230
              CG +V +G+ SLL++ +       L    A++G+  +  SY T   ++AE  PTVVR 
Sbjct  402  ILCGCLVMAGL-SLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFSAEQFPTVVRN  460

Query  231  QGVALIHIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQT  290
              +    ++  ++ +++PF+ +LA I   LPL+I G + ++ G L L LPET  + + +T
Sbjct  461  VALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLET  520

Query  291  LQDGENFGRNQK  302
            + DGE FG+  K
Sbjct  521  IADGERFGKKTK  532


>OCT1_CAEEL unnamed protein product
Length=585

 Score = 169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/323 (32%), Positives = 172/323 (53%), Gaps = 9/323 (3%)

Query  4    AIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVV  63
            ++FF  A +LL  +A ++  W+ L    + P    +I  + +PES RW VS G+  +A  
Sbjct  247  SLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKK  306

Query  64   IMKRFEKINNK-KVDPKLYQQLKETCQRQAKQEIDGKRYSVLDLFRTPRLRNITCLLIVI  122
             +K+  K+N K  VD        +  Q  A+++   + ++V DLF+TP LR  T ++  I
Sbjct  307  QLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYI  366

Query  123  WMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMVFS  182
            W+  +++++G    V NL +D + +F +  A ELP   ++   L   GRRW    TM+  
Sbjct  367  WVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVC  426

Query  183  GVFSLLSSSVETGK--LSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIHIMG  240
            G+  + +  +  G   L A  + IG+F V   +     +A E+ PTVVRA G+ +  ++ 
Sbjct  427  GIGCVSAMFMPDGYPWLVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVA  486

Query  241  YVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENFGRN  300
                +++P IV L  I   LPL+I+G++ +  G L  FLPETLG  LP T++D ENFG+ 
Sbjct  487  GSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGAPLPMTIEDAENFGKK  546

Query  301  QKFLDFPCCG--KKSDKEEEEKP  321
             +    P  G   ++ K+ E +P
Sbjct  547  PE----PDSGMFTQAAKKRESQP  565



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02430.1.1 Organic

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CART_DROME  unnamed protein product                                   322     1e-99
OCTL_DROME  unnamed protein product                                   269     2e-80
BALAT_DROME  unnamed protein product                                  266     3e-79


>CART_DROME unnamed protein product
Length=674

 Score = 322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 198/611 (32%), Positives = 313/611 (51%), Gaps = 27/611 (4%)

Query  177  IETDLDFDDILPHLGEFGRYQKILFFAM-IPFAFSVAFVYFAQIFITVIPERYWCQVPEL  235
            ++   D DD+LP +GEFG+YQK+L F + +P      F  F Q+F+   P+ YWC++PEL
Sbjct  30   VDEAFDLDDLLPTIGEFGKYQKLLVFGICLPACIPCGFCAFNQLFMADTPDDYWCRIPEL  89

Query  236  SHLDPEQRLATPIYSRKGS---TFDSCSMYAVNFTSLIAAG------ITEADPSWPISEC  286
              L  EQR +  I     +    +  C  Y VN+T L+ +G        E + SWP+ +C
Sbjct  90   LDLPLEQRKSLSIPKELDNDELVYSKCYTYGVNWTQLLESGEEDDLTTMEPNASWPLIKC  149

Query  287  QHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPA  346
              GWEY  T V ++SI  + + VC QD  PT+  A    G  VG  +FG + D  GR  +
Sbjct  150  PQGWEYN-TSVVWSSIVIDFDLVCDQDIYPTIGLAALNTGGPVGVYLFGLLNDRGGRRLS  208

Query  347  LVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVAN  406
                  T     + T+ +  FW +A  R  VGL     + + +I+ LE VG ++R+FV  
Sbjct  209  YFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTIPAVYQIPFIISLELVGENYRSFVTV  268

Query  407  MSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDE  466
            M+   F+T    LL  + Y   +W  L  ITSLP     +  +++PES RWL+ +GR++E
Sbjct  269  MT-CTFYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEE  327

Query  467  AVVIMKRFEKINNKKVDPKLYQQLKETCQRQAKQEIDGKRYSV--LDLFRTPRLRNITCL  524
            A+ I++R  K+N ++    ++ +L+   +R   ++   K  +V   DL RTP +R  T L
Sbjct  328  ALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRTPNMRLKTIL  387

Query  525  LIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGT  584
            + + W A   V+ G       LG + +++F L++  ELP+     + +D WGRRW    +
Sbjct  388  ITLSWFANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSLS  447

Query  585  MVFSGVFSLLSSSVETGKLSAGLAI--IGRFLVNISYNTGLQYAAEVLPTVVRAQGVALI  642
            M+  GV  +++  +    +   L +  + + L++ S+     +A E+ PT VR  G+   
Sbjct  448  MILGGVACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPTQVRGIGIGAS  507

Query  643  HIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGEN  702
              +G +  I  PFI YL   N KLPL+I+G + +LGG   L LPETL   LPQT+++GE 
Sbjct  508  SYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGMTGLRLPETLHHRLPQTIEEGEE  567

Query  703  FGRDQKFLDFPCCGKKSDKEEEEKPESYFKRGHKTRGANSSTRSSMRASLRGEQFRSSLI  762
            FG++ +F D  CC      E   +P SY          +S+  S +   LR         
Sbjct  568  FGKNWQFKD--CCRCAQKPEILSQPASY--ENLDVLAGSSTNASEVELELRDS-------  616

Query  763  QRTQRPFQKTD  773
            +R + P  + D
Sbjct  617  RRVREPAPRID  627


>OCTL_DROME unnamed protein product
Length=567

 Score = 269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 171/543 (31%), Positives = 287/543 (53%), Gaps = 26/543 (5%)

Query  181  LDFDDILPHLGEFGRYQKILFFAMIPFAFSVAFVYFAQIFITVIPERYWCQVPELSHLDP  240
            + +D+ + HLG+FGRYQKI++F +   +  VAF   A +F+   P+ + C +P  +    
Sbjct  1    MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPD-FRCALPFEN--GS  57

Query  241  EQRLATPIYSRKGSTFDSCSMYAVNFTSLIAAGITEADPSWPIS--ECQHGWEYEFTDVP  298
               L T +++      + CS Y V++T     G      S P S  E +    Y +    
Sbjct  58   SYDLPTHLWNLSYPENERCSYYDVDYTEEYLNG------SIPRSSNETKTCSSYVYDRSK  111

Query  299  Y-TSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVADHFGRIPALVGTNLTGFVA  357
            Y  S  TE N VC +D +   + ++F  G ++G +VFG ++D +GR P L  + +   + 
Sbjct  112  YLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQVLF  171

Query  358  GVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGPSWRTFVANMSIAIFFTLAA  417
            GV    A  ++ +   R  VG      F + Y++ +E VGP  R + A + + +FF++  
Sbjct  172  GVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLY-AGIFVMMFFSVGF  230

Query  418  SLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWLVSQGRVDEAVVIMKRFEKI  477
             L    AY+V +W++L +  +LP L+ +   WI+PESARWL+ +GR D A+  M++  + 
Sbjct  231  MLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARF  290

Query  478  NNKKVDPKLYQQL---KETCQRQAKQEID------GKRYSVLDLFRTPRLRNITCLLIVI  528
            N  ++  +   +L    E  + +AKQ+++      G   SV DLF  P LR  T L+ + 
Sbjct  291  NKVEISDEALSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFLD  350

Query  529  WMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVWGRRWYACGTMVFS  588
            W+  S V+ G      NLG ++ + F ++ A E+PA   L  TL+ WGRR   CG +V +
Sbjct  351  WLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMA  410

Query  589  GVFSLLSSSV---ETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVRAQGVALIHIM  645
            G+ SLL++ +       L    A++G+  +  SY T   ++AE  PTVVR   +    ++
Sbjct  411  GL-SLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFSAEQFPTVVRNVALGAASMV  469

Query  646  GYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQTLQDGENFGR  705
              ++ +++PF+ +LA I   LPL+I G + ++ G L L LPET  + + +T+ DGE FG+
Sbjct  470  ARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLETIADGERFGK  529

Query  706  DQK  708
              K
Sbjct  530  KTK  532


>BALAT_DROME unnamed protein product
Length=604

 Score = 266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 182/578 (31%), Positives = 297/578 (51%), Gaps = 36/578 (6%)

Query  181  LDFDDILPHLGEFGRYQKILFFA-MIPFAFSVAFVYFAQIFITVIPERYWCQVPELS---  236
            +DFD++L  +G FG YQK++  + ++P A   AF  ++Q+FI   P+ + C+VPEL    
Sbjct  1    MDFDEVLREVGSFGLYQKVIICSVLLPAALPCAFHAYSQLFIAATPQHF-CRVPELEPWT  59

Query  237  --HLDPEQRLATPIYSRKGSTFDSCSMYAVNFTSLI---------------AAGITEADP  279
              ++   + L+ P    +   +  CSMY+ N+T ++               A  + +  P
Sbjct  60   QDYVQLVKNLSIP--RNRNGAYAECSMYSRNYTDIVRYLEYRPPPDLLRQQAEDLLKLQP  117

Query  280  -SWPISECQHGWEYEFTDVPYTSIATELNWVCAQDTLPTLAQAIFFCGAIVGGLVFGWVA  338
             +  +  CQHGW Y+   +  +++  E N VC +  L TLA  +F  G ++G  VFG++ 
Sbjct  118  DTTQVVPCQHGWHYD-KSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLV  176

Query  339  DHFGRIPALVGTNLTGFVAGVATAFASTFWQFAICRFFVGLAFDNCFTMMYILVLEYVGP  398
            D +GR P+     L   +A  A+AFA  ++ +   RF VGL         Y+L +E VGP
Sbjct  177  DLWGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGP  236

Query  399  SWRTFVANMSIAIFFTLAASLLPWIAYYVANWQYLCVITSLPLLVAVITPWIVPESARWL  458
              R F   +S  I ++L   +L  + Y V +W+ L +  S+PLL+     +++PES RWL
Sbjct  237  ERRVFCTIVS-NIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWL  295

Query  459  VSQGRVDEAVVIMKRFEKINNKKVDPKLYQQL--KETCQRQAKQEID-GKRYSVLDLFRT  515
            ++ G+   A+ I+K   ++N  +V+    ++L  K    R A+ +      Y +LDLFR 
Sbjct  296  MAVGKTRRAIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRG  355

Query  516  PRLRNITCLLIVIWMAISLVFDGHVRQVGNLGLDLFITFTLASATELPADTMLTFTLDVW  575
            P +R  T ++ +IW A + V+ G       LG D    F LA A ELP   +L   L  +
Sbjct  356  PNMRRKTLIITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLSYF  415

Query  576  GRRWYACGTMVFSGVFSLLSSSVETGKLSAGLAIIGRFLVNISYNTGLQYAAEVLPTVVR  635
            GRRW    +M+  GV  +  ++     ++  L  +G+  ++ S+      A+E+ PTVVR
Sbjct  416  GRRWILFISMLVGGVACV--ATFLYPDITLLLYCVGKMGISSSFVVLPLMASELYPTVVR  473

Query  636  AQGVALIHIMGYVASIVSPFIVYLAVINPKLPLIILGMIGILGGALCLFLPETLGQDLPQ  695
              G++   ++  V  IV P I ++      LPLI++G + ILGG   L LPET  ++LPQ
Sbjct  474  GLGMSFSSVISMVGPIVIPMINHMGQQMLVLPLIVMGALLILGGFASLLLPETRNRNLPQ  533

Query  696  TLQDGENFGRDQKFLDFPCCGKKSDKEEEEKPESYFKR  733
            TL++GE       FL   CC  +S+++      S  KR
Sbjct  534  TLEEGE--AVPLSFLL--CCCVESERKPNNIRASPKKR  567



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02440.1.1 Tyrosine-protein

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PTP10_DROME  unnamed protein product                                  338     3e-106
Q9W4F5_DROME  unnamed protein product                                 305     7e-95 
Q8IRS0_DROME  unnamed protein product                                 305     8e-95 


>PTP10_DROME unnamed protein product
Length=1990

 Score = 338 bits (867),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 188/232 (81%), Gaps = 1/232 (0%)

Query  29   TNRSFSPLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPP  88
            T+  +   T  +  APDPP+NLSV VRSGK A I WSPP  G Y+ FK+KV+ LSE +  
Sbjct  108  THHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVLGLSEASSS  167

Query  89   RIIGFTENPPA-GYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWF  147
                F  N     +S+K+LTPG +YQVQ +++YD KESVAYTSRNFTTKPNTPGKFIVWF
Sbjct  168  YNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPNTPGKFIVWF  227

Query  148  RNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRA  207
            RNETTLLVLWQP YPA IYTHYKVSI+PPDA +SVLYVEKEGEPPGPAQAAFKGLVPGRA
Sbjct  228  RNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQAAFKGLVPGRA  287

Query  208  YNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKG  259
            YNISVQT+SEDEIS PTTAQYRT+PLRPL+ T+D+  ITSNS RV+WE PKG
Sbjct  288  YNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLWEAPKG  339


 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 84/196 (43%), Gaps = 14/196 (7%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRI--IGFTENPPAGY  101
            P+PP N+++      +  + WSPP SG+++ + ++  + SE+   R+  +  TE      
Sbjct  583  PNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQQWVRLPSVRSTE-----A  637

Query  102  SLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSY  161
             + D+T G  Y +Q+ +V    ES      N T  PN P   I+   +   + + W    
Sbjct  638  DITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPN-PVSNIIQLVDSRNITLEWPK--  694

Query  162  PASIYTHYKVSIDPPDAPESV----LYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSE  217
            P      Y +   P D P  V    +   K  +     +     L+PG  Y   +QT S 
Sbjct  695  PEGRVESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELMPGVQYKFDIQTTSY  754

Query  218  DEISTPTTAQYRTIPL  233
              +S  T+   RT+PL
Sbjct  755  GILSGITSLYPRTMPL  770


 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  196  QAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWE  255
            +  F GLVPGR YNI+V TVS    S P   Q R  P  P++  +   +IT   + + W+
Sbjct  828  KVTFTGLVPGRLYNITVWTVSGGVASLPIQRQDRLYP-EPITQLH-ATNITDTEISLRWD  885

Query  256  PPKG  259
             PKG
Sbjct  886  LPKG  889


 Score = 30.4 bits (67),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 46/212 (22%), Positives = 94/212 (44%), Gaps = 24/212 (11%)

Query  35   PLTSILEKAPDPPTNLSVNVR--SGKTAQIFWSPPIS-GKYSGFKLKVISLSEK-TPPRI  90
            P T+     P  P N++ +    +  + ++ W  P    ++  +++ V +   + T PR 
Sbjct  303  PTTAQYRTVPLRPLNVTFDRDFITSNSFRVLWEAPKGISEFDKYQVSVATTRRQSTVPR-  361

Query  91   IGFTENPPAGYSLKDLT-PGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRN  149
               +  P A +  +D+  PG ++ V + +V     S   T  + T +P  P + +    +
Sbjct  362  ---SNEPVAFFDFRDIAEPGKTFNVIVKTVSGKVTSWPATG-DVTLRP-LPVRNLRSIND  416

Query  150  E--TTLLVLWQPSYPASIYTHYKV---SIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVP  204
            +   T+++ W+   PAS    Y++    ++  +   S L  ++        +   + L+P
Sbjct  417  DKTNTMIITWEAD-PASTQDEYRIVYHELETFNGDTSTLTTDR-------TRFTLESLLP  468

Query  205  GRAYNISVQTVSEDEISTPTTAQYRTIPLRPL  236
            GR Y++SVQ VS+   S  T+    T P  P+
Sbjct  469  GRNYSLSVQAVSKKMESNETSIFVVTRPSSPI  500


>Q9W4F5_DROME unnamed protein product
Length=1767

 Score = 305 bits (782),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 180/233 (77%), Gaps = 1/233 (0%)

Query  29   TNRSFSPLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPP  88
            T+R     T  +  APDPP NLSV +RS K+A I W PP SG+YSGF+++V+ L++    
Sbjct  136  THREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRPPGSGRYSGFRIRVLGLTDLPFE  195

Query  89   RIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFR  148
            R      N     S K+LTPGGSYQVQ +SVY  KESVAYTSRNFTTKPNTPGKFIVWFR
Sbjct  196  RSYSLEGNETLQLSAKELTPGGSYQVQAYSVYQGKESVAYTSRNFTTKPNTPGKFIVWFR  255

Query  149  NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAY  208
            NETTLLVLWQP +PA IYTHY+VSI P DA +SVLYVE+EGEPPGPAQAAFKGLVPGR Y
Sbjct  256  NETTLLVLWQPPFPAGIYTHYRVSITPDDAIQSVLYVEREGEPPGPAQAAFKGLVPGREY  315

Query  209  NISVQTVSEDEIST-PTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGF  260
            NISVQTVSEDE S+ PTTA+Y T+P R L+ T+D+A  TS+S RV WEPP+ +
Sbjct  316  NISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRVRWEPPRTY  368


 Score = 47.8 bits (112),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 95/228 (42%), Gaps = 19/228 (8%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPI-SGKYSGFKLKVISLSEKTPPRIIGFTENP-----  97
            P+ P    V  R+  T  + W PP  +G Y+ ++   +S++     + + + E       
Sbjct  244  PNTPGKFIVWFRNETTLLVLWQPPFPAGIYTHYR---VSITPDDAIQSVLYVEREGEPPG  300

Query  98   PAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGK--FIVWFRNETTLLV  155
            PA  + K L PG  Y + + +V + + S   T+  + T P       F   +   ++  V
Sbjct  301  PAQAAFKGLVPGREYNISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRV  360

Query  156  LWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTV  215
             W+P    S +  Y+V +        +  V +              L PGR Y + V+T+
Sbjct  361  RWEPPRTYSEFDAYQVMLS---TSRRIFNVPRAANGDSVYFDYPDILEPGRTYEVVVKTI  417

Query  216  SEDEISTPTTAQ--YRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFR  261
            +++  S P + +   R  P+R L    D     SN+L + WEP +  R
Sbjct  418  ADNVNSWPASGEVTLRPRPVRSLGGFLDD---RSNALHISWEPAETGR  462


 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 73/192 (38%), Gaps = 8/192 (4%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTP-PRIIGFTENPPAGYS  102
            P PP NL++         + W  P    +S + ++    ++ +P  RI G  EN      
Sbjct  620  PKPPQNLTLQTVHTNLVVLHWQAPEGSDFSEYVVRY--RTDASPWQRISGLHENEA---R  674

Query  103  LKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLW-QPSY  161
            +KD+  G  Y VQ+ +V    ES      N T  P  P   +V   +   L + W +P  
Sbjct  675  IKDMHYGERYLVQVNTVSFGVESPHPLELNVTMPPQ-PVSNVVPLVDSRNLTLEWPRPDG  733

Query  162  PASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEIS  221
                YT      D  D  E     + E       +   + L PGR Y   VQ  S    S
Sbjct  734  HVDFYTLKWWPTDEEDRVEFKNVTQLEDLSSPSVRIPIEDLSPGRQYRFEVQASSNGIRS  793

Query  222  TPTTAQYRTIPL  233
              T    RT+PL
Sbjct  794  GTTHLSTRTMPL  805


 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 79/200 (40%), Gaps = 23/200 (12%)

Query  35    PLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFT  94
             P+  +    P P ++L     + +   + W+ P +G+Y+ F+L+ +S  E+ P  +   T
Sbjct  891   PVQRLYRLHPLPISDLKAIQVAAREITLHWTAP-AGEYTDFELQYLSADEEAPQLLQNVT  949

Query  95    EN---------PPAGYSLKDLTPGGSYQVQLF---SVYDSKESVAYTSRNFTTKPNTPGK  142
             +N         P   Y+   +   GS Q   F   SV     S A  S ++ T    PGK
Sbjct  950   KNTEITLQGLRPYHNYTFTVVVRSGSIQGTDFADVSVSTLMRSSAPISASYQTLTAPPGK  1009

Query  143   FIVWFR------NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQ  196
              + +F+       E T     +P+       +++++    D    V   E    P    Q
Sbjct  1010  -VDYFQPSDVQPGEVTFEWSLEPAEQHGPIDYFRITCQNADDAADVSSYEF---PVNATQ  1065

Query  197   AAFKGLVPGRAYNISVQTVS  216
                 GLVPG  Y   +Q  S
Sbjct  1066  GKIDGLVPGNHYIFRIQAKS  1085


 Score = 36.6 bits (83),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 4/63 (6%)

Query  198  AFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKA-SITSNSLRVVWEP  256
            +F GL PG+ YN++V TVS    S P    YR   L PL  +  KA  + +  + + W  
Sbjct  866  SFSGLTPGKLYNVTVWTVSGGVASLPVQRLYR---LHPLPISDLKAIQVAAREITLHWTA  922

Query  257  PKG  259
            P G
Sbjct  923  PAG  925


 Score = 34.7 bits (78),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 10/153 (7%)

Query  108  PGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPAS-IY  166
            PG  Y   L+    +       + N TT P+ P    V  R+  +  + W+P  P S  Y
Sbjct  122  PGTEYNFWLYYTNSTHREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRP--PGSGRY  179

Query  167  THYKVSI-DPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTP-T  224
            + +++ +    D P    Y  +  E     Q + K L PG +Y +   +V + + S   T
Sbjct  180  SGFRIRVLGLTDLPFERSYSLEGNE---TLQLSAKELTPGGSYQVQAYSVYQGKESVAYT  236

Query  225  TAQYRTIPLRPLSFTYDKASITSNSLRVVWEPP  257
            +  + T P  P  F     + T  +L V+W+PP
Sbjct  237  SRNFTTKPNTPGKFIVWFRNET--TLLVLWQPP  267


>Q8IRS0_DROME unnamed protein product
Length=1607

 Score = 305 bits (781),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 180/233 (77%), Gaps = 1/233 (0%)

Query  29   TNRSFSPLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPP  88
            T+R     T  +  APDPP NLSV +RS K+A I W PP SG+YSGF+++V+ L++    
Sbjct  136  THREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRPPGSGRYSGFRIRVLGLTDLPFE  195

Query  89   RIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFR  148
            R      N     S K+LTPGGSYQVQ +SVY  KESVAYTSRNFTTKPNTPGKFIVWFR
Sbjct  196  RSYSLEGNETLQLSAKELTPGGSYQVQAYSVYQGKESVAYTSRNFTTKPNTPGKFIVWFR  255

Query  149  NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAY  208
            NETTLLVLWQP +PA IYTHY+VSI P DA +SVLYVE+EGEPPGPAQAAFKGLVPGR Y
Sbjct  256  NETTLLVLWQPPFPAGIYTHYRVSITPDDAIQSVLYVEREGEPPGPAQAAFKGLVPGREY  315

Query  209  NISVQTVSEDEIST-PTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGF  260
            NISVQTVSEDE S+ PTTA+Y T+P R L+ T+D+A  TS+S RV WEPP+ +
Sbjct  316  NISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRVRWEPPRTY  368


 Score = 48.1 bits (113),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 95/228 (42%), Gaps = 19/228 (8%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPI-SGKYSGFKLKVISLSEKTPPRIIGFTENP-----  97
            P+ P    V  R+  T  + W PP  +G Y+ ++   +S++     + + + E       
Sbjct  244  PNTPGKFIVWFRNETTLLVLWQPPFPAGIYTHYR---VSITPDDAIQSVLYVEREGEPPG  300

Query  98   PAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGK--FIVWFRNETTLLV  155
            PA  + K L PG  Y + + +V + + S   T+  + T P       F   +   ++  V
Sbjct  301  PAQAAFKGLVPGREYNISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRV  360

Query  156  LWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTV  215
             W+P    S +  Y+V +        +  V +              L PGR Y + V+T+
Sbjct  361  RWEPPRTYSEFDAYQVMLS---TSRRIFNVPRAANGDSVYFDYPDILEPGRTYEVVVKTI  417

Query  216  SEDEISTPTTAQ--YRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFR  261
            +++  S P + +   R  P+R L    D     SN+L + WEP +  R
Sbjct  418  ADNVNSWPASGEVTLRPRPVRSLGGFLDD---RSNALHISWEPAETGR  462


 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 73/192 (38%), Gaps = 8/192 (4%)

Query  44   PDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTP-PRIIGFTENPPAGYS  102
            P PP NL++         + W  P    +S + ++    ++ +P  RI G  EN      
Sbjct  620  PKPPQNLTLQTVHTNLVVLHWQAPEGSDFSEYVVRY--RTDASPWQRISGLHENEA---R  674

Query  103  LKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLW-QPSY  161
            +KD+  G  Y VQ+ +V    ES      N T  P  P   +V   +   L + W +P  
Sbjct  675  IKDMHYGERYLVQVNTVSFGVESPHPLELNVTMPPQ-PVSNVVPLVDSRNLTLEWPRPDG  733

Query  162  PASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEIS  221
                YT      D  D  E     + E       +   + L PGR Y   VQ  S    S
Sbjct  734  HVDFYTLKWWPTDEEDRVEFKNVTQLEDLSSPSVRIPIEDLSPGRQYRFEVQASSNGIRS  793

Query  222  TPTTAQYRTIPL  233
              T    RT+PL
Sbjct  794  GTTHLSTRTMPL  805


 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 79/200 (40%), Gaps = 23/200 (12%)

Query  35    PLTSILEKAPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFT  94
             P+  +    P P ++L     + +   + W+ P +G+Y+ F+L+ +S  E+ P  +   T
Sbjct  891   PVQRLYRLHPLPISDLKAIQVAAREITLHWTAP-AGEYTDFELQYLSADEEAPQLLQNVT  949

Query  95    EN---------PPAGYSLKDLTPGGSYQVQLF---SVYDSKESVAYTSRNFTTKPNTPGK  142
             +N         P   Y+   +   GS Q   F   SV     S A  S ++ T    PGK
Sbjct  950   KNTEITLQGLRPYHNYTFTVVVRSGSIQGTDFADVSVSTLMRSSAPISASYQTLTAPPGK  1009

Query  143   FIVWFR------NETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQ  196
              + +F+       E T     +P+       +++++    D    V   E    P    Q
Sbjct  1010  -VDYFQPSDVQPGEVTFEWSLEPAEQHGPIDYFRITCQNADDAADVSSYEF---PVNATQ  1065

Query  197   AAFKGLVPGRAYNISVQTVS  216
                 GLVPG  Y   +Q  S
Sbjct  1066  GKIDGLVPGNHYIFRIQAKS  1085


 Score = 36.6 bits (83),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 4/63 (6%)

Query  198  AFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKA-SITSNSLRVVWEP  256
            +F GL PG+ YN++V TVS    S P    YR   L PL  +  KA  + +  + + W  
Sbjct  866  SFSGLTPGKLYNVTVWTVSGGVASLPVQRLYR---LHPLPISDLKAIQVAAREITLHWTA  922

Query  257  PKG  259
            P G
Sbjct  923  PAG  925


 Score = 34.7 bits (78),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 10/153 (7%)

Query  108  PGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPAS-IY  166
            PG  Y   L+    +       + N TT P+ P    V  R+  +  + W+P  P S  Y
Sbjct  122  PGTEYNFWLYYTNSTHREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRP--PGSGRY  179

Query  167  THYKVSI-DPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTP-T  224
            + +++ +    D P    Y  +  E     Q + K L PG +Y +   +V + + S   T
Sbjct  180  SGFRIRVLGLTDLPFERSYSLEGNE---TLQLSAKELTPGGSYQVQAYSVYQGKESVAYT  236

Query  225  TAQYRTIPLRPLSFTYDKASITSNSLRVVWEPP  257
            +  + T P  P  F     + T  +L V+W+PP
Sbjct  237  SRNFTTKPNTPGKFIVWFRNET--TLLVLWQPP  267



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02450.1.1 Methyl-accepting

Length=91
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLB26_CAEEL  unnamed protein product                                  38.1    2e-04
Q4Q8R1_LEIMA  unnamed protein product                                 33.9    0.010
FHBA_DICDI  unnamed protein product                                   29.3    0.36 


>GLB26_CAEEL unnamed protein product
Length=183

 Score = 38.1 bits (87),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  1    MAFVQKAIARLHEPDKLDTLLRDLGKKHYTY----GAKAKYVDLIGPQFISAIQ  50
            + F+QK +  L EPDK+  L +++G+KH  Y    G K  Y D +G      I+
Sbjct  82   VEFLQKVMQSLDEPDKISKLCQEIGQKHAKYRRSKGMKIDYWDKLGEAITETIR  135


>Q4Q8R1_LEIMA unnamed protein product
Length=616

 Score = 33.9 bits (76),  Expect = 0.010, Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 0/76 (0%)

Query  8    IARLHEPDKLDTLLRDLGKKHYTYGAKAKYVDLIGPQFISAIQPSLESRWSPELNNAWIH  67
            I  +H+   LD  +R+LG +H  Y    + +      F+   +   E  W+    + ++ 
Sbjct  291  INNIHDKKLLDEYMRELGGRHTAYNVTVENLQAFTEPFLFTCRHFFEEEWNIAAESRFLW  350

Query  68   LFGYMAHIMKESMTAE  83
            LF YM   +   M ++
Sbjct  351  LFEYMIDGISAGMVSD  366


>FHBA_DICDI unnamed protein product
Length=397

 Score = 29.3 bits (64),  Expect = 0.36, Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 33/69 (48%), Gaps = 1/69 (1%)

Query  15   DKLDTL-LRDLGKKHYTYGAKAKYVDLIGPQFISAIQPSLESRWSPELNNAWIHLFGYMA  73
            DKL+ L L  +  KH   G   ++  ++G   + AI+  L+   + E+  AW   +G +A
Sbjct  70   DKLNELNLAPIVHKHVALGVLPEHYPIVGTNLLGAIKEVLQDAATDEILGAWGEAYGVIA  129

Query  74   HIMKESMTA  82
                ++  A
Sbjct  130  QAFIDAEAA  138



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02460.1.1 Cytochrome

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  189     1e-53
G5EGT6_CAEEL  unnamed protein product                                 186     8e-53
O17851_CAEEL  unnamed protein product                                 186     2e-52


>CP4G1_DROME unnamed protein product
Length=556

 Score = 189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 147/528 (28%), Positives = 247/528 (47%), Gaps = 68/528 (13%)

Query  29   WRRR-KLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIG  87
            WRR  + Y +   +P P  LPI+G          + +  +    + KYG     ++ W+G
Sbjct  44   WRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGET---MKAWLG  100

Query  88   PELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQV  145
              L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  RK++   
Sbjct  101  NVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHRKMIAPT  158

Query  146  LHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQ  205
             H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +GV    +
Sbjct  159  FHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMGVKKLPE  216

Query  206  NNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILQFTQTLL  262
             N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL  T  ++
Sbjct  217  GNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRM--MNIILGMTSKVV  273

Query  263  DNAKH---------VRDDST--------------------------SKERITLNQVLVQ-  286
             + K          V + ST                          +K R+ L   +V+ 
Sbjct  274  KDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEM  333

Query  287  --SPGMTKEEQK--AQIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETVQILGED  342
              +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E   I G++
Sbjct  334  AKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDN  393

Query  343  TSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLPTGVTVF  402
                 T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P G TV 
Sbjct  394  MLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVPKGTTVI  450

Query  403  VLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLF  462
            VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+L+LK+ 
Sbjct  451  VLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVL  510

Query  463  SVAIIREFEILPTENFTTLRDVEKAIRMNAT--MDLEEKCHIRLRNRR  508
               I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  511  LSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551


>G5EGT6_CAEEL unnamed protein product
Length=495

 Score = 186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 135/500 (27%), Positives = 235/500 (47%), Gaps = 41/500 (8%)

Query  25   LSWL-WRRRKLYYISWCLPGPTALPIIGNLLYVLR---------FGASNVYPISKILVAK  74
            ++WL ++  ++  +   L  P + PI+G+ L              G   +YP  ++ +  
Sbjct  16   IAWLLYKHLRMRQVLKHLNQPRSYPIVGHGLITKPDPEGFMNQVIGMGYLYPDPRMCL--  73

Query  75   YGGVNGLIRFWIGPELAILVTDASVASQV-NALALTKAEFYQHLAPPYMKTGIFVDEDID  133
                      WIGP   +++  A +   + ++       F   L  P++   I   +  +
Sbjct  74   ---------LWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQK-E  123

Query  134  HWRASRKIVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTI  193
             WR  RK++T   H+ +LK ++PIF+++S ILV K      + +       + L T   I
Sbjct  124  QWRPKRKLLTPTFHYDILKDFLPIFNEQSKILVQKLCCLGAD-EEVDVLSVITLCTLDII  182

Query  194  MRTMLGVNINAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRY  253
              T +G  I AQ  E   ++ AVH   +L+  R   P + + F+  +    +    C+R 
Sbjct  183  CETSMGKAIGAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLRI  242

Query  254  ILQFTQTLLDNAKHV--RDDSTSKERITLNQVL---VQSPGMTKEEQKAQIITVLGAGLD  308
            +  FT+ ++   K     +D   + R+    +L   V+S  M + + +A++ T +  G D
Sbjct  243  LHDFTKKVIVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEGHD  302

Query  309  TSMYQNSLLLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRL  368
            T+       +  L  HP +Q KV  E  +++G+D  V  T E L ++ YLE  +KE LRL
Sbjct  303  TTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDEDV--TIEHLSRMKYLECALKEALRL  360

Query  369  FPAALGSARKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLP  428
            FP+     R++++D  +   N     +P GVT  + L+ + +    +  PD FDPDR+LP
Sbjct  361  FPSVPIITRELSDDQVIGGVN-----IPKGVTFLLNLYLVHRDPAQWKDPDVFDPDRFLP  415

Query  429  ERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAI  488
            E S GR   ++ PFS+G RNCIG ++AL++ K+    ++R F I   E    +R   + I
Sbjct  416  ENSIGRKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNIKAVELMHEVRPKMEII  475

Query  489  RMNATMDLEEKCHIRLRNRR  508
                T       H++L  RR
Sbjct  476  VRPVT-----PIHMKLTRRR  490


>O17851_CAEEL unnamed protein product
Length=509

 Score = 186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/490 (27%), Positives = 232/490 (47%), Gaps = 22/490 (4%)

Query  31   RRKLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVN-GLIRFWIGPE  89
            R ++Y       GP + PIIG L  V  F  S     S  L   Y     G I  W+GP 
Sbjct  29   RLRIYKYMRKFDGPYSFPIIGTLYMVNIFDISKFTTQSMELAQYYCQKGCGTIGLWLGPV  88

Query  90   LAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQVLH  147
              I V +   A ++  +   +TKAE Y  L P ++ TG+        WR  RK++T   H
Sbjct  89   PLIAVINPQHAKEILESNEVITKAEEYDILFP-WLGTGLLTSTG-SKWRQRRKMLTPAFH  146

Query  148  FKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQNN  207
            FK+L  ++ +   ++ + +++ K YA +G+      ++       I  T +GV I+AQNN
Sbjct  147  FKVLNDFLSVHDYQAKVFLEQIKPYADSGKEVDLFPYIKRLALDVICDTSMGVTIDAQNN  206

Query  208  EKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILQFTQTLLDNAKH  267
                ++E+V    E     I  P+LR   +  + G   E    ++ +  FT+T++     
Sbjct  207  HDHQYVESVRLLSEYAFEWILRPWLRLKPLWYLTGPGHEYDRHLKIVTDFTKTVIKEKWE  266

Query  268  ----------VRDDSTSKERITLNQVLVQSPGMTKEEQKAQIITVLGAGLDTSMYQNSLL  317
                      V+ D  S   + L   L     M +++ + ++ T +  G DT+       
Sbjct  267  EFQKFHVDPVVKTDKRSMAFLDLLLELRNEGLMNEDDIREEVDTFMFEGHDTTSASMGWT  326

Query  318  LICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSAR  377
            L CLA +P  Q KV +E   I G     C T +DL ++ YLE+ +KE LR++P+     R
Sbjct  327  LWCLAHNPEFQEKVIQEVDGIFGTSDRDC-TNDDLKQMKYLEKCLKESLRMYPSVPFFGR  385

Query  378  KITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPL  437
             + +D+ +   NG+    P GV + V+   +Q++   +D+P++++P+ +  ++   R   
Sbjct  386  TVEQDVVI---NGD--FFPKGVRIIVMPLLLQRNPLIFDNPNQYNPENFSEDKIGSRHAY  440

Query  438  SYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNATMDLE  497
            S  PFS+GPRNCIG K+A+++ K       R++ +  ++ F   + + + I + +++   
Sbjct  441  SDIPFSAGPRNCIGQKFAMMEEKAVISWFFRKYRVTASQPFGMNKILPELI-LKSSLGFP  499

Query  498  EKCHIRLRNR  507
               H R  N+
Sbjct  500  LTVHHRTDNK  509



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02460.1.2 Cytochrome

Length=437
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGT6_CAEEL  unnamed protein product                                 186     1e-53
Q9N574_CAEEL  unnamed protein product                                 184     1e-52
CP4G1_DROME  unnamed protein product                                  176     2e-49


>G5EGT6_CAEEL unnamed protein product
Length=495

 Score = 186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/432 (29%), Positives = 211/432 (49%), Gaps = 22/432 (5%)

Query  8    FWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKI  65
             WIGP   +++  A +   +  +   L K  F   L  P++   I   +  + WR  RK+
Sbjct  74   LWIGPFPCLMLYSADLVEPIFSSTKHLNKG-FAYVLLEPWLGISILTSQK-EQWRPKRKL  131

Query  66   VTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVN  125
            +T   H+ +LK ++PIF+++S ILV K      + +       + L T   I  T +G  
Sbjct  132  LTPTFHYDILKDFLPIFNEQSKILVQKLCCLGAD-EEVDVLSVITLCTLDIICETSMGKA  190

Query  126  INAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILQFTQTL  185
            I AQ  E   ++ AVH   +L+  R   P + + F+  +    +    C+R +  FT+ +
Sbjct  191  IGAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLRILHDFTKKV  250

Query  186  LDNAKHV--RDDSTSKERITLNQVL---VQSPGMTKEEQKAQIITVLGAGLDTSMYQNSL  240
            +   K     +D   + R+    +L   V+S  M + + +A++ T +  G DT+      
Sbjct  251  IVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEGHDTTSTGLMW  310

Query  241  LLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSA  300
             +  L  HP +Q KV  E  +++G+D  V  T E L ++ YLE  +KE LRLFP+     
Sbjct  311  AIHLLGNHPEVQRKVQAELDEVMGDDEDV--TIEHLSRMKYLECALKEALRLFPSVPIIT  368

Query  301  RKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDP  360
            R++++D  +   N     +P GVT  + L+ + +    +  PD FDPDR+LPE S GR  
Sbjct  369  RELSDDQVIGGVN-----IPKGVTFLLNLYLVHRDPAQWKDPDVFDPDRFLPENSIGRKS  423

Query  361  LSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNATMDL  420
             ++ PFS+G RNCIG ++AL++ K+    ++R F I   E    +R   + I    T   
Sbjct  424  FAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNIKAVELMHEVRPKMEIIVRPVT---  480

Query  421  EEKCHIRLRNRR  432
                H++L  RR
Sbjct  481  --PIHMKLTRRR  490


>Q9N574_CAEEL unnamed protein product
Length=495

 Score = 184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/431 (28%), Positives = 208/431 (48%), Gaps = 20/431 (5%)

Query  8    FWIGPELAILVTDASVASQV-NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIV  66
             WIGP   +++  A +   + ++       F   L  P++   I   +  + WR  RK++
Sbjct  74   LWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQK-EQWRPKRKLL  132

Query  67   TQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNI  126
            T   H+ +LK ++PIF+++S ILV K        +       + L T   I  T +G  I
Sbjct  133  TPTFHYDILKDFLPIFNEQSKILVQKMCSLGAE-EEVDVLSVITLCTLDIICETSMGKAI  191

Query  127  NAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILQFTQTLL  186
             AQ  E   ++ AVH   +L+  R   P + + F+  +    +    C+R +  FT+ ++
Sbjct  192  GAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLRILHDFTKKVI  251

Query  187  DNAKHV--RDDSTSKERITLNQVL---VQSPGMTKEEQKAQIITVLGAGLDTSMYQNSLL  241
               K     +D   + R+    +L   V+S  M + + +A++ T +  G DT+       
Sbjct  252  VERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEGHDTTSTGLMWA  311

Query  242  LICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSAR  301
            +  L  HP +Q KV  E  +++G+D  V  T E L ++ YLE  +KE LRLFP+     R
Sbjct  312  IHLLGNHPEVQRKVQAELDEVMGDDEDV--TIEHLSRMKYLECALKEALRLFPSVPIITR  369

Query  302  KITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPL  361
            ++++D  +   N     +P GVT  + L+ + +    +  PD FDPDR+LPE S  R   
Sbjct  370  ELSDDQVIGGVN-----IPKGVTFLLNLYLVHRDPSQWKDPDVFDPDRFLPENSIARKSF  424

Query  362  SYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNATMDLE  421
            ++ PFS+G RNCIG ++AL++ K+    ++R F +   E    +R   + I    T    
Sbjct  425  AFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNVKAVELMHEVRPKMEIIVRPVT----  480

Query  422  EKCHIRLRNRR  432
               H++L  RR
Sbjct  481  -PIHMKLTRRR  490


>CP4G1_DROME unnamed protein product
Length=556

 Score = 176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 226/474 (48%), Gaps = 64/474 (14%)

Query  6    IRFWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASR  63
            ++ W+G  L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  R
Sbjct  95   MKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHR  152

Query  64   KIVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLG  123
            K++    H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +G
Sbjct  153  KMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMG  210

Query  124  VNINAQNNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILQ  180
            V    + N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL 
Sbjct  211  VKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRMMNI--ILG  267

Query  181  FTQTLLDNAKH---------VRDDST--------------------------SKERITLN  205
             T  ++ + K          V + ST                          +K R+ L 
Sbjct  268  MTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALL  327

Query  206  QVLVQ---SPGMTKEEQKA--QIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETV  260
              +V+   +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E  
Sbjct  328  DAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQK  387

Query  261  QILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLP  320
             I G++     T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P
Sbjct  388  AIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVP  444

Query  321  TGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYAL  380
             G TV VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+
Sbjct  445  KGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAM  504

Query  381  LQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNA--TMDLEEKCHIRLRNRR  432
            L+LK+    I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  505  LKLKVLLSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02470.1.1 Cytochrome

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  189     1e-53
G5EGT6_CAEEL  unnamed protein product                                 186     1e-52
O17851_CAEEL  unnamed protein product                                 186     2e-52


>CP4G1_DROME unnamed protein product
Length=556

 Score = 189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 147/528 (28%), Positives = 247/528 (47%), Gaps = 68/528 (13%)

Query  29   WRRR-KLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVNGLIRFWIG  87
            WRR  + Y +   +P P  LPI+G          + +  +    + KYG     ++ W+G
Sbjct  44   WRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGET---MKAWLG  100

Query  88   PELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQV  145
              L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  RK++   
Sbjct  101  NVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHRKMIAPT  158

Query  146  LHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQ  205
             H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +GV    +
Sbjct  159  FHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMGVKKLPE  216

Query  206  NNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILKFTQTLL  262
             N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL  T  ++
Sbjct  217  GNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRM--MNIILGMTSKVV  273

Query  263  DNAKH---------VRDDST--------------------------SKERITLNQVLVQ-  286
             + K          V + ST                          +K R+ L   +V+ 
Sbjct  274  KDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEM  333

Query  287  --SPGMTKEEQK--AQIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETVQILGED  342
              +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E   I G++
Sbjct  334  AKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDN  393

Query  343  TSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLPTGVTVF  402
                 T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P G TV 
Sbjct  394  MLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVPKGTTVI  450

Query  403  VLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLF  462
            VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+L+LK+ 
Sbjct  451  VLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVL  510

Query  463  SVAIIREFEILPTENFTTLRDVEKAIRMNAT--MDLEEKCHIRLRNRR  508
               I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  511  LSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551


>G5EGT6_CAEEL unnamed protein product
Length=495

 Score = 186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 135/500 (27%), Positives = 235/500 (47%), Gaps = 41/500 (8%)

Query  25   LSWL-WRRRKLYYISWCLPGPTALPIIGNLLYVLR---------FGASNVYPISKILVAK  74
            ++WL ++  ++  +   L  P + PI+G+ L              G   +YP  ++ +  
Sbjct  16   IAWLLYKHLRMRQVLKHLNQPRSYPIVGHGLITKPDPEGFMNQVIGMGYLYPDPRMCL--  73

Query  75   YGGVNGLIRFWIGPELAILVTDASVASQV-NALALTKAEFYQHLAPPYMKTGIFVDEDID  133
                      WIGP   +++  A +   + ++       F   L  P++   I   +  +
Sbjct  74   ---------LWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQK-E  123

Query  134  HWRASRKIVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTI  193
             WR  RK++T   H+ +LK ++PIF+++S ILV K      + +       + L T   I
Sbjct  124  QWRPKRKLLTPTFHYDILKDFLPIFNEQSKILVQKLCCLGAD-EEVDVLSVITLCTLDII  182

Query  194  MRTMLGVNINAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRY  253
              T +G  I AQ  E   ++ AVH   +L+  R   P + + F+  +    +    C+R 
Sbjct  183  CETSMGKAIGAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLRI  242

Query  254  ILKFTQTLLDNAKHV--RDDSTSKERITLNQVL---VQSPGMTKEEQKAQIITVLGAGLD  308
            +  FT+ ++   K     +D   + R+    +L   V+S  M + + +A++ T +  G D
Sbjct  243  LHDFTKKVIVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEGHD  302

Query  309  TSMYQNSLLLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRL  368
            T+       +  L  HP +Q KV  E  +++G+D  V  T E L ++ YLE  +KE LRL
Sbjct  303  TTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDEDV--TIEHLSRMKYLECALKEALRL  360

Query  369  FPAALGSARKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLP  428
            FP+     R++++D  +   N     +P GVT  + L+ + +    +  PD FDPDR+LP
Sbjct  361  FPSVPIITRELSDDQVIGGVN-----IPKGVTFLLNLYLVHRDPAQWKDPDVFDPDRFLP  415

Query  429  ERSEGRDPLSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAI  488
            E S GR   ++ PFS+G RNCIG ++AL++ K+    ++R F I   E    +R   + I
Sbjct  416  ENSIGRKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNIKAVELMHEVRPKMEII  475

Query  489  RMNATMDLEEKCHIRLRNRR  508
                T       H++L  RR
Sbjct  476  VRPVT-----PIHMKLTRRR  490


>O17851_CAEEL unnamed protein product
Length=509

 Score = 186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/490 (27%), Positives = 232/490 (47%), Gaps = 22/490 (4%)

Query  31   RRKLYYISWCLPGPTALPIIGNLLYVLRFGASNVYPISKILVAKYGGVN-GLIRFWIGPE  89
            R ++Y       GP + PIIG L  V  F  S     S  L   Y     G I  W+GP 
Sbjct  29   RLRIYKYMRKFDGPYSFPIIGTLYMVNIFDISKFTTQSMELAQYYCQKGCGTIGLWLGPV  88

Query  90   LAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKIVTQVLH  147
              I V +   A ++  +   +TKAE Y  L P ++ TG+        WR  RK++T   H
Sbjct  89   PLIAVINPQHAKEILESNEVITKAEEYDILFP-WLGTGLLTSTG-SKWRQRRKMLTPAFH  146

Query  148  FKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVNINAQNN  207
            FK+L  ++ +   ++ + +++ K YA +G+      ++       I  T +GV I+AQNN
Sbjct  147  FKVLNDFLSVHDYQAKVFLEQIKPYADSGKEVDLFPYIKRLALDVICDTSMGVTIDAQNN  206

Query  208  EKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILKFTQTLLDNAKH  267
                ++E+V    E     I  P+LR   +  + G   E    ++ +  FT+T++     
Sbjct  207  HDHQYVESVRLLSEYAFEWILRPWLRLKPLWYLTGPGHEYDRHLKIVTDFTKTVIKEKWE  266

Query  268  ----------VRDDSTSKERITLNQVLVQSPGMTKEEQKAQIITVLGAGLDTSMYQNSLL  317
                      V+ D  S   + L   L     M +++ + ++ T +  G DT+       
Sbjct  267  EFQKFHVDPVVKTDKRSMAFLDLLLELRNEGLMNEDDIREEVDTFMFEGHDTTSASMGWT  326

Query  318  LICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSAR  377
            L CLA +P  Q KV +E   I G     C T +DL ++ YLE+ +KE LR++P+     R
Sbjct  327  LWCLAHNPEFQEKVIQEVDGIFGTSDRDC-TNDDLKQMKYLEKCLKESLRMYPSVPFFGR  385

Query  378  KITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPL  437
             + +D+ +   NG+    P GV + V+   +Q++   +D+P++++P+ +  ++   R   
Sbjct  386  TVEQDVVI---NGD--FFPKGVRIIVMPLLLQRNPLIFDNPNQYNPENFSEDKIGSRHAY  440

Query  438  SYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNATMDLE  497
            S  PFS+GPRNCIG K+A+++ K       R++ +  ++ F   + + + I + +++   
Sbjct  441  SDIPFSAGPRNCIGQKFAMMEEKAVISWFFRKYRVTASQPFGMNKILPELI-LKSSLGFP  499

Query  498  EKCHIRLRNR  507
               H R  N+
Sbjct  500  LTVHHRTDNK  509



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02470.1.2 Cytochrome

Length=437
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGT6_CAEEL  unnamed protein product                                 186     1e-53
Q9N574_CAEEL  unnamed protein product                                 184     1e-52
CP4G1_DROME  unnamed protein product                                  176     2e-49


>G5EGT6_CAEEL unnamed protein product
Length=495

 Score = 186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/432 (29%), Positives = 211/432 (49%), Gaps = 22/432 (5%)

Query  8    FWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKI  65
             WIGP   +++  A +   +  +   L K  F   L  P++   I   +  + WR  RK+
Sbjct  74   LWIGPFPCLMLYSADLVEPIFSSTKHLNKG-FAYVLLEPWLGISILTSQK-EQWRPKRKL  131

Query  66   VTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVN  125
            +T   H+ +LK ++PIF+++S ILV K      + +       + L T   I  T +G  
Sbjct  132  LTPTFHYDILKDFLPIFNEQSKILVQKLCCLGAD-EEVDVLSVITLCTLDIICETSMGKA  190

Query  126  INAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILKFTQTL  185
            I AQ  E   ++ AVH   +L+  R   P + + F+  +    +    C+R +  FT+ +
Sbjct  191  IGAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLRILHDFTKKV  250

Query  186  LDNAKHV--RDDSTSKERITLNQVL---VQSPGMTKEEQKAQIITVLGAGLDTSMYQNSL  240
            +   K     +D   + R+    +L   V+S  M + + +A++ T +  G DT+      
Sbjct  251  IVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEGHDTTSTGLMW  310

Query  241  LLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSA  300
             +  L  HP +Q KV  E  +++G+D  V  T E L ++ YLE  +KE LRLFP+     
Sbjct  311  AIHLLGNHPEVQRKVQAELDEVMGDDEDV--TIEHLSRMKYLECALKEALRLFPSVPIIT  368

Query  301  RKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDP  360
            R++++D  +   N     +P GVT  + L+ + +    +  PD FDPDR+LPE S GR  
Sbjct  369  RELSDDQVIGGVN-----IPKGVTFLLNLYLVHRDPAQWKDPDVFDPDRFLPENSIGRKS  423

Query  361  LSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNATMDL  420
             ++ PFS+G RNCIG ++AL++ K+    ++R F I   E    +R   + I    T   
Sbjct  424  FAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNIKAVELMHEVRPKMEIIVRPVT---  480

Query  421  EEKCHIRLRNRR  432
                H++L  RR
Sbjct  481  --PIHMKLTRRR  490


>Q9N574_CAEEL unnamed protein product
Length=495

 Score = 184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/432 (29%), Positives = 209/432 (48%), Gaps = 22/432 (5%)

Query  8    FWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASRKI  65
             WIGP   +++  A +   +  +   L K  F   L  P++   I   +  + WR  RK+
Sbjct  74   LWIGPFPCLMLYSADLVEPIFSSTKHLNKG-FAYVLLEPWLGISILTSQK-EQWRPKRKL  131

Query  66   VTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLGVN  125
            +T   H+ +LK ++PIF+++S ILV K        +       + L T   I  T +G  
Sbjct  132  LTPTFHYDILKDFLPIFNEQSKILVQKMCSLGAE-EEVDVLSVITLCTLDIICETSMGKA  190

Query  126  INAQNNEKQPFIEAVHYCFELMQARIFYPFLRSIFVSTILGYRKEEMNCVRYILKFTQTL  185
            I AQ  E   ++ AVH   +L+  R   P + + F+  +    +    C+R +  FT+ +
Sbjct  191  IGAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLRILHDFTKKV  250

Query  186  LDNAKHV--RDDSTSKERITLNQVL---VQSPGMTKEEQKAQIITVLGAGLDTSMYQNSL  240
            +   K     +D   + R+    +L   V+S  M + + +A++ T +  G DT+      
Sbjct  251  IVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEGHDTTSTGLMW  310

Query  241  LLICLALHPHIQNKVYEETVQILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSA  300
             +  L  HP +Q KV  E  +++G+D  V  T E L ++ YLE  +KE LRLFP+     
Sbjct  311  AIHLLGNHPEVQRKVQAELDEVMGDDEDV--TIEHLSRMKYLECALKEALRLFPSVPIIT  368

Query  301  RKITEDIKVTCSNGEEYVLPTGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDP  360
            R++++D  +   N     +P GVT  + L+ + +    +  PD FDPDR+LPE S  R  
Sbjct  369  RELSDDQVIGGVN-----IPKGVTFLLNLYLVHRDPSQWKDPDVFDPDRFLPENSIARKS  423

Query  361  LSYAPFSSGPRNCIGGKYALLQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNATMDL  420
             ++ PFS+G RNCIG ++AL++ K+    ++R F +   E    +R   + I    T   
Sbjct  424  FAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNVKAVELMHEVRPKMEIIVRPVT---  480

Query  421  EEKCHIRLRNRR  432
                H++L  RR
Sbjct  481  --PIHMKLTRRR  490


>CP4G1_DROME unnamed protein product
Length=556

 Score = 176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 226/474 (48%), Gaps = 64/474 (14%)

Query  6    IRFWIGPELAILVTDASVASQV--NALALTKAEFYQHLAPPYMKTGIFVDEDIDHWRASR  63
            ++ W+G  L + +T+ S    +      LTKAE Y++  P +   G+ +     HWR  R
Sbjct  95   MKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP-WFGDGLLISNG-HHWRHHR  152

Query  64   KIVTQVLHFKLLKTYIPIFHDESLILVDKFKKYAKNGQSFHPPKFLVLATFSTIMRTMLG  123
            K++    H  +LK+++P F D S  +V +    A  G+SF    ++   T   ++ T +G
Sbjct  153  KMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEA--GKSFDVHDYMSQTTVDILLSTAMG  210

Query  124  VNINAQNNEKQPFIEAVHYCFELM---QARIFYPFLRSIFVSTILGYRKEEMNCVRYILK  180
            V    + N+   + +AV    +++   Q ++ Y  L SI+  T L  + + M  +  IL 
Sbjct  211  VKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYR-LDSIYKFTKLREKGDRMMNI--ILG  267

Query  181  FTQTLLDNAKH---------VRDDST--------------------------SKERITLN  205
             T  ++ + K          V + ST                          +K R+ L 
Sbjct  268  MTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALL  327

Query  206  QVLVQ---SPGMTKEEQKA--QIITVLGAGLDTSMYQNSLLLICLALHPHIQNKVYEETV  260
              +V+   +P +   E+    ++ T++  G DT+   +S  L  + +H  IQ KV+ E  
Sbjct  328  DAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQK  387

Query  261  QILGEDTSVCPTYEDLMKLDYLERVIKECLRLFPAALGSARKITEDIKVTCSNGEEYVLP  320
             I G++     T+ D M++ YLERVI E LRL+P     AR++  D+K+       Y +P
Sbjct  388  AIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG---PYTVP  444

Query  321  TGVTVFVLLFCIQKSSQYYDHPDEFDPDRWLPERSEGRDPLSYAPFSSGPRNCIGGKYAL  380
             G TV VL +C+ +    Y +P +FDPD +LPER   R   S+ PFS+GPR+C+G KYA+
Sbjct  445  KGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAM  504

Query  381  LQLKLFSVAIIREFEILPTENFTTLRDVEKAIRMNA--TMDLEEKCHIRLRNRR  432
            L+LK+    I+R + +  T       D E   ++ A   + LE   ++ L  R+
Sbjct  505  LKLKVLLSTIVRNYIVHST-------DTEADFKLQADIILKLENGFNVSLEKRQ  551



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02480.1.1 Methyl-accepting

Length=91
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLB26_CAEEL  unnamed protein product                                  38.1    2e-04
Q4Q8R1_LEIMA  unnamed protein product                                 33.9    0.010
FHBA_DICDI  unnamed protein product                                   29.3    0.36 


>GLB26_CAEEL unnamed protein product
Length=183

 Score = 38.1 bits (87),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  1    MAFVQKAIARLHEPDKLDTLLRDLGKKHYTY----GAKAKYVDLIGPQFISAIQ  50
            + F+QK +  L EPDK+  L +++G+KH  Y    G K  Y D +G      I+
Sbjct  82   VEFLQKVMQSLDEPDKISKLCQEIGQKHAKYRRSKGMKIDYWDKLGEAITETIR  135


>Q4Q8R1_LEIMA unnamed protein product
Length=616

 Score = 33.9 bits (76),  Expect = 0.010, Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 0/76 (0%)

Query  8    IARLHEPDKLDTLLRDLGKKHYTYGAKAKYVDLIGPQFISAIQPSLESRWSPELNNAWIH  67
            I  +H+   LD  +R+LG +H  Y    + +      F+   +   E  W+    + ++ 
Sbjct  291  INNIHDKKLLDEYMRELGGRHTAYNVTVENLQAFTEPFLFTCRHFFEEEWNIAAESRFLW  350

Query  68   LFGYMAHIMKESMTAE  83
            LF YM   +   M ++
Sbjct  351  LFEYMIDGISAGMVSD  366


>FHBA_DICDI unnamed protein product
Length=397

 Score = 29.3 bits (64),  Expect = 0.36, Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 33/69 (48%), Gaps = 1/69 (1%)

Query  15   DKLDTL-LRDLGKKHYTYGAKAKYVDLIGPQFISAIQPSLESRWSPELNNAWIHLFGYMA  73
            DKL+ L L  +  KH   G   ++  ++G   + AI+  L+   + E+  AW   +G +A
Sbjct  70   DKLNELNLAPIVHKHVALGVLPEHYPIVGTNLLGAIKEVLQDAATDEILGAWGEAYGVIA  129

Query  74   HIMKESMTA  82
                ++  A
Sbjct  130  QAFIDAEAA  138



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02490.1.1 Kelch-like

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KLHDB_DROME  unnamed protein product                                  359     5e-116
KELC_DROME  unnamed protein product                                   363     1e-110
Q9VGE5_DROME  unnamed protein product                                 322     3e-102


>KLHDB_DROME unnamed protein product
Length=623

 Score = 359 bits (922),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 212/544 (39%), Positives = 310/544 (57%), Gaps = 13/544 (2%)

Query  56   EHPNQVLTGFNEARKNNEFCDVTLCVDGTKFPAHRVVLAASSPYFKAMFHSRCLEAKQNN  115
            +HP   LT  N  R++ E CDV L V G K  AHRV+L+A S YF AMF     E++Q  
Sbjct  53   KHPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTE  112

Query  116  IQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDAS  175
            + ++ ID   M LL+++CY++ I +  +N Q LL AA LLQ++ ++   C FL++ +D +
Sbjct  113  VTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPT  172

Query  176  NCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKE  235
            NCLGI  FA+ H+C EL   A  F   NF  V ++EEFL LP  +L+++  SD L +  E
Sbjct  173  NCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSE  232

Query  236  EMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVE  295
            E +F AV  WL+Y+V  R      VL+ +RLP LSP FL   V    +++++  C  LV+
Sbjct  233  EQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVD  292

Query  296  EAKLFHLLPDRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTKVWKTL  355
            EAK + LLP  R     PRT+PRK      V+ AVGG      + SVE F  +T  WK +
Sbjct  293  EAKNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMV  352

Query  356  SCLPFAISKHGLVVSGRN-TIYLVGGEFPDGNASA-SVWKYDPVLDHWQ-EVAPLLNPRS  412
            +  P +  + G+ V+  N  +Y VGG   DG +   S+ +YDP  + W  +VAP  + R+
Sbjct  353  A--PMSKRRCGVGVAVLNDLLYAVGGH--DGQSYLNSIERYDPQTNQWSCDVAPTTSCRT  408

Query  413  ELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYV  472
             +G+A+LDGF+YAVGG DG   L+ VERYDP +N+WS + PM       AV    G LY 
Sbjct  409  SVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYA  468

Query  473  TGGAILEDGD-GIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTEN  531
             GG+   DG   +  V+RY+P+ N+W  ++PM   R        ++ IY +GG     E 
Sbjct  469  IGGS---DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMEL  525

Query  532  TNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDND  591
            ++  E Y+   NTW     M  +R   G+AV++G++Y +GG +G   Y  +IE YD + +
Sbjct  526  SS-AERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDG-SAYLKTIEVYDPETN  583

Query  592  SWEI  595
             W +
Sbjct  584  QWRL  587


 Score = 114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 96/188 (51%), Gaps = 7/188 (4%)

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            ++AVGGW     + SVER+DP  N+W  + PM        V     +LY  GG    DG 
Sbjct  324  LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGG---HDGQ  380

Query  483  G-IEQVQRYNPKVNQWQ-DLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYHI  540
              +  ++RY+P+ NQW  D+AP    R+   +  LD  +Y +GG     +  N VE Y  
Sbjct  381  SYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGG-QDGVQCLNHVERYDP  439

Query  541  AENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLP  600
             EN W   +PM  +R    +AV+ G +Y +GG +G     +++E YD  ++ W  +S + 
Sbjct  440  KENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPL-NTVERYDPRHNKWVAVSPMS  498

Query  601  SARSWLGC  608
            + R  LGC
Sbjct  499  TRRKHLGC  506


 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 98/211 (46%), Gaps = 13/211 (6%)

Query  308  SAHITPRTKPRKSAGSI---NVIIAVGGEDDKVVLRSVEGFCVKTKVWKTLSCLPFAISK  364
            S  + P T  R S G       + AVGG+D    L  VE +  K   W  ++  P    +
Sbjct  397  SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVA--PMTTRR  454

Query  365  HGLVVSGRNT-IYLVGGEFPDGNASA-SVWKYDPVLDHWQEVAPLLNPRSELGIAMLDGF  422
             G+ V+     +Y +GG   DG     +V +YDP  + W  V+P+   R  LG A+ + +
Sbjct  455  LGVAVAVLGGFLYAIGGS--DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNY  512

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            +YAVGG D    L S ERY+P  N WS I  M    +   +    G LY  GG    DG 
Sbjct  513  IYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGF---DGS  569

Query  483  G-IEQVQRYNPKVNQWQDLAPMLIPRSGAAI  512
              ++ ++ Y+P+ NQW+    M   R G  +
Sbjct  570  AYLKTIEVYDPETNQWRLCGCMNYRRLGGGV  600


>KELC_DROME unnamed protein product
Length=1477

 Score = 363 bits (931),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 207/558 (37%), Positives = 313/558 (56%), Gaps = 12/558 (2%)

Query  52   FAETEHPNQVLTGFNEARKNNEFCDVTLCVDGTKFPAHRVVLAASSPYFKAMFHSRCLEA  111
            ++  +H  +     NE RK  + CDV L  D  +  AHR+VLA+ SPYF AMF S   E+
Sbjct  134  YSNEQHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTS-FEES  192

Query  112  KQNNIQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQH  171
            +Q  I ++ +D   + LL++Y Y++ + +  +N Q LL+AANLLQ+  V+ A C FLQ  
Sbjct  193  RQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQ  252

Query  172  MDASNCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLE  231
            +DASNCLGI  FA+ HAC EL N A+ ++  +F+ V Q +EFL+L   ++I L  +D + 
Sbjct  253  LDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLSHEQVISLIGNDRIS  312

Query  232  IDKEEMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCA  291
            +  EE +++ V  WL+YDV  R     L++E +RLP LS  ++   V++  +++ N  C 
Sbjct  313  VPNEERVYECVIAWLRYDVPMREQFTSLLMEHVRLPFLSKEYITQRVDKEILLEGNIVCK  372

Query  292  QLVEEAKLFHLLP-DRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTK  350
             L+ EA  +HLLP + +SA    RT PRK  G   +++ +GG+  K + RSVE + ++ +
Sbjct  373  NLIIEALTYHLLPTETKSA----RTVPRKPVGMPKILLVIGGQAPKAI-RSVEWYDLREE  427

Query  351  VWKTLSCLPFAISKHGLVVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNP  410
             W   + +P    + GL V G + +Y VGG F       +V  YDP  D W   + +   
Sbjct  428  KWYQAAEMPNRRCRSGLSVLG-DKVYAVGG-FNGSLRVRTVDVYDPATDQWANCSNMEAR  485

Query  411  RSELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGML  470
            RS LG+A+L+G +YAVGG+DG+  L S E YDP  + W +I  M    +S  V    G+L
Sbjct  486  RSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVVHGLL  545

Query  471  YVTGGAILEDGDGIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTE  530
            Y  GG        +  V+RYNP  + W ++A M   RSGA +  L++ +Y +GG H    
Sbjct  546  YAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGAGVGVLNNILYAVGG-HDGPM  604

Query  531  NTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDN  590
                VE Y    N+W   + M   R   G+   DG +YV+GG++G      S+E Y  D+
Sbjct  605  VRRSVEAYDCETNSWRSVADMSYCRRNAGVVAHDGLLYVVGGDDGTSNLA-SVEVYCPDS  663

Query  591  DSWEIMSHLPS-ARSWLG  607
            DSW I+  L +  RS+ G
Sbjct  664  DSWRILPALMTIGRSYAG  681


 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 47/98 (48%), Gaps = 3/98 (3%)

Query  514  ALDSCIYVLGGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGE  573
             +   + V+GG   + +    VE Y + E  W   + M  +R R G++V+  K+Y +GG 
Sbjct  400  GMPKILLVIGGQ--APKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVLGDKVYAVGGF  457

Query  574  EGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPL  611
             G      +++ YD   D W   S++ + RS LG   L
Sbjct  458  NGSLRVR-TVDVYDPATDQWANCSNMEARRSTLGVAVL  494


>Q9VGE5_DROME unnamed protein product
Length=575

 Score = 322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 197/555 (35%), Positives = 295/555 (53%), Gaps = 13/555 (2%)

Query  65   FNEARKNNEFCDVTLCVDGTKFPAHRVVLAASSPYFKAMFHSRCLEAKQNNIQMKGIDVE  124
            F E R+  + CDVTL V+   F AHRVVLAA+ PYF AMF +   E++   I MK   +E
Sbjct  29   FKEIRRMGKLCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIE  88

Query  125  MMTL--LLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDASNCLGIHC  182
               L  L+ Y YS ++ I   N Q L+  A+ LQ+  V+ A  +FL       N LGI  
Sbjct  89   PSALESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLISRFHPHNVLGIRT  148

Query  183  FAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKEEMLFQAV  242
            FA+   C +L + A  ++  NF+ V Q+EEFL+L   +L+EL   D L +  EE++F+A 
Sbjct  149  FADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEAC  208

Query  243  QRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVEEAKLFHL  302
             +W++Y    RS  FP VL  +RLP LSP FL D V +  +I+++ QC  L++EAK FHL
Sbjct  209  MKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHL  268

Query  303  LPDRRSAHITPRTKPRKSAGSINVIIAVGG-EDDKVVLRSVEGFCVKTKVWKTLSCLPFA  361
            +P+RR    + RT+ R        I AVGG       + +VE +   TK WK    +   
Sbjct  269  MPERRGLLQSFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMM  328

Query  362  ISKHGL-VVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNPRSELGIAMLD  420
             S+ G+ V++G+  +Y  GG F      ++V  YDP  + W +   +L  RS +G+A LD
Sbjct  329  RSRVGVAVLNGK--LYAFGG-FNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALD  385

Query  421  GFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILED  480
              +Y  GG+DG   L++VE Y P  N W  +  M    ++  V    G +Y  GG    D
Sbjct  386  DCIYVCGGYDGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGG---HD  442

Query  481  GDGI-EQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYH  539
            G  I + V+RY+   + W  ++PML  R    +  L+  IYV GG+  ++     VECY 
Sbjct  443  GLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNS-FLRSVECYD  501

Query  540  IAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHL  599
               +TW+  +PM  KR R  +A   GK++ +GG +G +    ++E YD + D W  M  +
Sbjct  502  PQTDTWKLVTPMNCKRSRVALAANMGKLWAIGGYDG-ESNLSTVEVYDPETDKWTFMPPM  560

Query  600  PSARSWLGCVPLQIH  614
             +    +G   ++I 
Sbjct  561  CAHSGGVGAGVIRIE  575



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02500.1.1 O-acyltransferase

Length=183
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960U8_DROME  unnamed protein product                                 280     1e-92
Q8ST50_DROME  unnamed protein product                                 280     1e-92
DGAT1_DICDI  unnamed protein product                                  170     4e-50


>Q960U8_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>DGAT1_DICDI unnamed protein product
Length=617

 Score = 170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 113/170 (66%), Gaps = 2/170 (1%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            +D+V   ER++KLS+PN  +WL+ FY+FFH  LN+  E+  F DR FY DWWN+   D F
Sbjct  431  IDIVLIVERIMKLSLPNLYVWLLGFYVFFHLYLNIVAEITRFGDREFYRDWWNSTGLDYF  490

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H W V  +Y P+  +G+S+     + FF+SA  HE ++S+P  + K+W F G
Sbjct  491  WRTWNMPVHHWMVVLIYTPMRRRGFSKNMGYFMCFFVSAIFHELVISIPFHSLKLWGFFG  550

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITH  170
            +M Q+ L  L++++    G   GN+I W S++LGQPL +++YY +FV+ +
Sbjct  551  IMSQMVLIALTKNLMN--GRNLGNVIFWISIVLGQPLVVLLYYRNFVLEN  598



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02510.1.1 O-acyltransferase

Length=183
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960U8_DROME  unnamed protein product                                 280     1e-92
Q8ST50_DROME  unnamed protein product                                 280     1e-92
DGAT1_DICDI  unnamed protein product                                  170     4e-50


>Q960U8_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            MDV  ATERLLKL++PNHL WL FFYL FHS LN  GE+L+FADRNFY DWWNA+N DTF
Sbjct  384  MDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTF  443

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H+W VRHLY P+V+ GYS   AS++VF  SA  HEYLVSVPL+ YKIWAFMG
Sbjct  444  WRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQIYKIWAFMG  503

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITHFGEAL  175
            MMGQIPLS +S+ +EKK GPR GNIIVW+S+ILGQPLCIM YYHD+V+ HF  +L
Sbjct  504  MMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFKNSL  558


>DGAT1_DICDI unnamed protein product
Length=617

 Score = 170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 113/170 (66%), Gaps = 2/170 (1%)

Query  1    MDVVKATERLLKLSIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTF  60
            +D+V   ER++KLS+PN  +WL+ FY+FFH  LN+  E+  F DR FY DWWN+   D F
Sbjct  431  IDIVLIVERIMKLSLPNLYVWLLGFYVFFHLYLNIVAEITRFGDREFYRDWWNSTGLDYF  490

Query  61   WRNWNMPIHQWAVRHLYKPLVEQGYSRLTASSLVFFISAFMHEYLVSVPLRTYKIWAFMG  120
            WR WNMP+H W V  +Y P+  +G+S+     + FF+SA  HE ++S+P  + K+W F G
Sbjct  491  WRTWNMPVHHWMVVLIYTPMRRRGFSKNMGYFMCFFVSAIFHELVISIPFHSLKLWGFFG  550

Query  121  MMGQIPLSMLSRHVEKKYGPRWGNIIVWSSLILGQPLCIMMYYHDFVITH  170
            +M Q+ L  L++++    G   GN+I W S++LGQPL +++YY +FV+ +
Sbjct  551  IMSQMVLIALTKNLMN--GRNLGNVIFWISIVLGQPLVVLLYYRNFVLEN  598



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02520.1.1 Kelch-like

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KLHDB_DROME  unnamed protein product                                  359     5e-116
KELC_DROME  unnamed protein product                                   362     3e-110
Q9VGE5_DROME  unnamed protein product                                 322     2e-102


>KLHDB_DROME unnamed protein product
Length=623

 Score = 359 bits (922),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 212/544 (39%), Positives = 310/544 (57%), Gaps = 13/544 (2%)

Query  56   EHPNQVLTGFNEARKNNEFCDVTLCVDGSKFPAHRVVLAASSPYFKAMFHSRCLEAKQNN  115
            +HP   LT  N  R++ E CDV L V G K  AHRV+L+A S YF AMF     E++Q  
Sbjct  53   KHPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTE  112

Query  116  IQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDAS  175
            + ++ ID   M LL+++CY++ I +  +N Q LL AA LLQ++ ++   C FL++ +D +
Sbjct  113  VTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPT  172

Query  176  NCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKE  235
            NCLGI  FA+ H+C EL   A  F   NF  V ++EEFL LP  +L+++  SD L +  E
Sbjct  173  NCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSE  232

Query  236  EMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVE  295
            E +F AV  WL+Y+V  R      VL+ +RLP LSP FL   V    +++++  C  LV+
Sbjct  233  EQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVD  292

Query  296  EAKLFHLLPDRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTKVWKTL  355
            EAK + LLP  R     PRT+PRK      V+ AVGG      + SVE F  +T  WK +
Sbjct  293  EAKNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMV  352

Query  356  SCLPFAISKHGLVVSGRN-TIYLVGGEFPDGNASA-SVWKYDPVLDHWQ-EVAPLLNPRS  412
            +  P +  + G+ V+  N  +Y VGG   DG +   S+ +YDP  + W  +VAP  + R+
Sbjct  353  A--PMSKRRCGVGVAVLNDLLYAVGGH--DGQSYLNSIERYDPQTNQWSCDVAPTTSCRT  408

Query  413  ELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYV  472
             +G+A+LDGF+YAVGG DG   L+ VERYDP +N+WS + PM       AV    G LY 
Sbjct  409  SVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYA  468

Query  473  TGGAILEDGD-GIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTEN  531
             GG+   DG   +  V+RY+P+ N+W  ++PM   R        ++ IY +GG     E 
Sbjct  469  IGGS---DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMEL  525

Query  532  TNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDND  591
            ++  E Y+   NTW     M  +R   G+AV++G++Y +GG +G   Y  +IE YD + +
Sbjct  526  SS-AERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDG-SAYLKTIEVYDPETN  583

Query  592  SWEI  595
             W +
Sbjct  584  QWRL  587


 Score = 114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 96/188 (51%), Gaps = 7/188 (4%)

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            ++AVGGW     + SVER+DP  N+W  + PM        V     +LY  GG    DG 
Sbjct  324  LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGG---HDGQ  380

Query  483  G-IEQVQRYNPKVNQWQ-DLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYHI  540
              +  ++RY+P+ NQW  D+AP    R+   +  LD  +Y +GG     +  N VE Y  
Sbjct  381  SYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGG-QDGVQCLNHVERYDP  439

Query  541  AENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLP  600
             EN W   +PM  +R    +AV+ G +Y +GG +G     +++E YD  ++ W  +S + 
Sbjct  440  KENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPL-NTVERYDPRHNKWVAVSPMS  498

Query  601  SARSWLGC  608
            + R  LGC
Sbjct  499  TRRKHLGC  506


 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 98/211 (46%), Gaps = 13/211 (6%)

Query  308  SAHITPRTKPRKSAGSI---NVIIAVGGEDDKVVLRSVEGFCVKTKVWKTLSCLPFAISK  364
            S  + P T  R S G       + AVGG+D    L  VE +  K   W  ++  P    +
Sbjct  397  SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVA--PMTTRR  454

Query  365  HGLVVSGRNT-IYLVGGEFPDGNASA-SVWKYDPVLDHWQEVAPLLNPRSELGIAMLDGF  422
             G+ V+     +Y +GG   DG     +V +YDP  + W  V+P+   R  LG A+ + +
Sbjct  455  LGVAVAVLGGFLYAIGGS--DGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNY  512

Query  423  VYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILEDGD  482
            +YAVGG D    L S ERY+P  N WS I  M    +   +    G LY  GG    DG 
Sbjct  513  IYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGF---DGS  569

Query  483  G-IEQVQRYNPKVNQWQDLAPMLIPRSGAAI  512
              ++ ++ Y+P+ NQW+    M   R G  +
Sbjct  570  AYLKTIEVYDPETNQWRLCGCMNYRRLGGGV  600


>KELC_DROME unnamed protein product
Length=1477

 Score = 362 bits (928),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 207/558 (37%), Positives = 313/558 (56%), Gaps = 12/558 (2%)

Query  52   FAETEHPNQVLTGFNEARKNNEFCDVTLCVDGSKFPAHRVVLAASSPYFKAMFHSRCLEA  111
            ++  +H  +     NE RK  + CDV L  D  +  AHR+VLA+ SPYF AMF S   E+
Sbjct  134  YSNEQHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTS-FEES  192

Query  112  KQNNIQMKGIDVEMMTLLLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQH  171
            +Q  I ++ +D   + LL++Y Y++ + +  +N Q LL+AANLLQ+  V+ A C FLQ  
Sbjct  193  RQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQ  252

Query  172  MDASNCLGIHCFAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLE  231
            +DASNCLGI  FA+ HAC EL N A+ ++  +F+ V Q +EFL+L   ++I L  +D + 
Sbjct  253  LDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLSHEQVISLIGNDRIS  312

Query  232  IDKEEMLFQAVQRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCA  291
            +  EE +++ V  WL+YDV  R     L++E +RLP LS  ++   V++  +++ N  C 
Sbjct  313  VPNEERVYECVIAWLRYDVPMREQFTSLLMEHVRLPFLSKEYITQRVDKEILLEGNIVCK  372

Query  292  QLVEEAKLFHLLP-DRRSAHITPRTKPRKSAGSINVIIAVGGEDDKVVLRSVEGFCVKTK  350
             L+ EA  +HLLP + +SA    RT PRK  G   +++ +GG+  K + RSVE + ++ +
Sbjct  373  NLIIEALTYHLLPTETKSA----RTVPRKPVGMPKILLVIGGQAPKAI-RSVEWYDLREE  427

Query  351  VWKTLSCLPFAISKHGLVVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNP  410
             W   + +P    + GL V G + +Y VGG F       +V  YDP  D W   + +   
Sbjct  428  KWYQAAEMPNRRCRSGLSVLG-DKVYAVGG-FNGSLRVRTVDVYDPATDQWANCSNMEAR  485

Query  411  RSELGIAMLDGFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGML  470
            RS LG+A+L+G +YAVGG+DG+  L S E YDP  + W +I  M    +S  V    G+L
Sbjct  486  RSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVVHGLL  545

Query  471  YVTGGAILEDGDGIEQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTE  530
            Y  GG        +  V+RYNP  + W ++A M   RSGA +  L++ +Y +GG H    
Sbjct  546  YAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGAGVGVLNNILYAVGG-HDGPM  604

Query  531  NTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDN  590
                VE Y    N+W   + M   R   G+   DG +YV+GG++G      S+E Y  D+
Sbjct  605  VRRSVEAYDCETNSWRSVADMSYCRRNAGVVAHDGLLYVVGGDDGTSNLA-SVEVYCPDS  663

Query  591  DSWEIMSHLPS-ARSWLG  607
            DSW I+  L +  RS+ G
Sbjct  664  DSWRILPALMTIGRSYAG  681


 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 47/98 (48%), Gaps = 3/98 (3%)

Query  514  ALDSCIYVLGGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGE  573
             +   + V+GG   + +    VE Y + E  W   + M  +R R G++V+  K+Y +GG 
Sbjct  400  GMPKILLVIGGQ--APKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVLGDKVYAVGGF  457

Query  574  EGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPL  611
             G      +++ YD   D W   S++ + RS LG   L
Sbjct  458  NGSLRVR-TVDVYDPATDQWANCSNMEARRSTLGVAVL  494


>Q9VGE5_DROME unnamed protein product
Length=575

 Score = 322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 197/555 (35%), Positives = 295/555 (53%), Gaps = 13/555 (2%)

Query  65   FNEARKNNEFCDVTLCVDGSKFPAHRVVLAASSPYFKAMFHSRCLEAKQNNIQMKGIDVE  124
            F E R+  + CDVTL V+   F AHRVVLAA+ PYF AMF +   E++   I MK   +E
Sbjct  29   FKEIRRMGKLCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIE  88

Query  125  MMTL--LLEYCYSSRITITRNNCQALLSAANLLQILPVKAAACTFLQQHMDASNCLGIHC  182
               L  L+ Y YS ++ I   N Q L+  A+ LQ+  V+ A  +FL       N LGI  
Sbjct  89   PSALESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLISRFHPHNVLGIRT  148

Query  183  FAEQHACTELQNEAKDFVLANFSAVCQNEEFLSLPASKLIELTSSDNLEIDKEEMLFQAV  242
            FA+   C +L + A  ++  NF+ V Q+EEFL+L   +L+EL   D L +  EE++F+A 
Sbjct  149  FADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEAC  208

Query  243  QRWLQYDVLARSVDFPLVLETIRLPQLSPYFLHDCVEQCAIIKNNPQCAQLVEEAKLFHL  302
             +W++Y    RS  FP VL  +RLP LSP FL D V +  +I+++ QC  L++EAK FHL
Sbjct  209  MKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHL  268

Query  303  LPDRRSAHITPRTKPRKSAGSINVIIAVGG-EDDKVVLRSVEGFCVKTKVWKTLSCLPFA  361
            +P+RR    + RT+ R        I AVGG       + +VE +   TK WK    +   
Sbjct  269  MPERRGLLQSFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMM  328

Query  362  ISKHGL-VVSGRNTIYLVGGEFPDGNASASVWKYDPVLDHWQEVAPLLNPRSELGIAMLD  420
             S+ G+ V++G+  +Y  GG F      ++V  YDP  + W +   +L  RS +G+A LD
Sbjct  329  RSRVGVAVLNGK--LYAFGG-FNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALD  385

Query  421  GFVYAVGGWDGSCRLDSVERYDPTKNEWSYIEPMKLAVTSPAVVAHEGMLYVTGGAILED  480
              +Y  GG+DG   L++VE Y P  N W  +  M    ++  V    G +Y  GG    D
Sbjct  386  DCIYVCGGYDGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGG---HD  442

Query  481  GDGI-EQVQRYNPKVNQWQDLAPMLIPRSGAAICALDSCIYVLGGWHASTENTNRVECYH  539
            G  I + V+RY+   + W  ++PML  R    +  L+  IYV GG+  ++     VECY 
Sbjct  443  GLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNS-FLRSVECYD  501

Query  540  IAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHL  599
               +TW+  +PM  KR R  +A   GK++ +GG +G +    ++E YD + D W  M  +
Sbjct  502  PQTDTWKLVTPMNCKRSRVALAANMGKLWAIGGYDG-ESNLSTVEVYDPETDKWTFMPPM  560

Query  600  PSARSWLGCVPLQIH  614
             +    +G   ++I 
Sbjct  561  CAHSGGVGAGVIRIE  575



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02530.1.1 Interferon-inducible

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9MRT5_DROME  unnamed protein product                                 73.6    6e-14
Q4TZM6_DROME  unnamed protein product                                 73.6    7e-14
X2JAB1_DROME  unnamed protein product                                 73.2    1e-13


>M9MRT5_DROME unnamed protein product
Length=359

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  74   VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  131
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  132  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  178
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  179  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  238
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  239  AKMLVRLQE  247
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


>Q4TZM6_DROME unnamed protein product
Length=383

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  74   VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  131
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  132  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  178
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  179  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  238
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  239  AKMLVRLQE  247
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


>X2JAB1_DROME unnamed protein product
Length=418

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  74   VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  131
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  132  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  178
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  179  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  238
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  239  AKMLVRLQE  247
             +M +RLQE
Sbjct  310  HRMWMRLQE  318



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02540.1.1 Anoctamin

Length=984
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97132_DROME  unnamed protein product                                 207     2e-56
A0A0B4JCY1_DROME  unnamed protein product                             169     1e-42
Q9VDV4_DROME  unnamed protein product                                 169     2e-42


>O97132_DROME unnamed protein product
Length=646

 Score = 207 bits (526),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 147/509 (29%), Positives = 232/509 (46%), Gaps = 94/509 (18%)

Query  216  IPKCLSEGLISQMYPLHELDGLEQLRQNWVRTFVKKQPLDSVCKYFGVKIAMYFAWLGHY  275
            I   + +G I  M+PLH++  LE+   N  RT   K P++ +  YFG  I +YF ++  Y
Sbjct  164  IKSYVQKGYIEDMFPLHDILYLERFNWNLKRT---KLPIEDIRNYFGSSIGLYFGFIEFY  220

Query  276  TYMLIIPAFVGFIFWIGFGRGDQSSEDIGYVLFSLFNVVWFSIYLEAWKRYSSELAYKWG  335
            T  LI P+  G +         Q   D+   L   F VVW +I+LE WKR  +  +Y+WG
Sbjct  221  TKALIFPSLFGIL---------QYVFDLNISLVCSFYVVWTTIFLELWKRKCAGYSYRWG  271

Query  336  TLDQRHELLMEPRPLYSGNLVVSPVTGRLEPTYPSWKRHVFRYFVSVPIIALCLLVVLSV  395
            T++     L +PR  Y+G L   P+TG++   YP    ++  Y +S P++  C++     
Sbjct  272  TIEMSS--LDKPRSAYTGQLKPDPITGKMTLHYPMRYTYLQMYCISYPVVLGCVVAAGWF  329

Query  396  MIASLKVQDWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWLNDMGKC----  451
             +   +++    + + + G   WL YVP ++ +V+I +   AY K+A +L ++       
Sbjct  330  ALYQFQIE---AEVLADFGPDSWLLYVPVIVQSVLIAIFSWAYEKLATFLTNLENHRTRS  386

Query  452  ---------VGTFQFVNSFSSLFYIAFYLQDQERLKEQLATLLITRQLIGNIKESALPYV  502
                     +  F+ VN+F S FYIAF L D  +LK QL   L+  QL+   +E  +P  
Sbjct  387  QYDRHRVNKLMLFEIVNNFFSQFYIAFVLHDLRQLKYQLMMQLLVFQLLCIAQEIGIP--  444

Query  503  QEQFRLAKLSFDLYGALSPSEAKKSDGTTNDFDSASNGKSSSGGGNRNVSQAELESTLLK  562
                        L   L    A+            +  K  S        Q+  ES L +
Sbjct  445  ------------LLAVLRQKYAEFRH------REVAEEKLRSISDLPRYEQSFYESGLDE  486

Query  563  YEGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIP  622
            Y  T+ D+L++ IQ G+VVLF+   P AA+ ALLNN+  +  D +KLC IF+RPF +R  
Sbjct  487  YHSTYEDYLQVCIQFGFVVLFAAVAPFAAIGALLNNVFAVHIDMWKLCNIFKRPFARRAK  546

Query  623  NIGMWQ--------------------------------------------HIMFAVRFII  638
            NIG WQ                                            H++  ++F+I
Sbjct  547  NIGAWQLAFELLSVMSLLSNCGLLFLQPNVKDFFSHWLPSVPDLSFVIFEHLLLGLKFLI  606

Query  639  SCVIPDLPDWVATEMAKVEFARREALSRI  667
              VI + P WV   + K +F   +AL ++
Sbjct  607  HKVIHERPRWVRIGLLKADFETSQALKQL  635


>A0A0B4JCY1_DROME unnamed protein product
Length=1099

 Score = 169 bits (428),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 154/559 (28%), Positives = 235/559 (42%), Gaps = 141/559 (25%)

Query  179  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  234
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  351  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  400

Query  235  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  286
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  401  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  460

Query  287  FI------------------------------------FW-----IGFGRGDQSSEDIGY  305
             I                                    FW       + +     ++   
Sbjct  461  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  520

Query  306  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  359
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  521  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  577

Query  360  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV----Q  403
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV     
Sbjct  578  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPM  637

Query  404  DWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWL------NDMGKCVGTFQF  457
                  +       +++     +L  +   L E   ++ +W       + +   +   QF
Sbjct  638  TTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQF  697

Query  458  VNSFSSLFYIAF-----------------YLQDQ-------ERLKEQLATLLITRQLIGN  493
            VN ++S+FYIAF                 Y Q++         L  QLA +++ +Q    
Sbjct  698  VNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNT  757

Query  494  IKESALPYVQEQFRLAKLSFDLYGALSPSEAKKSDGT-TNDFDSASNGKSSSGGGNRNVS  552
            I E  LP    +    ++        +P+  K  D     DF     G            
Sbjct  758  ILEVYLPMFWRKVLAIQVGLSRLFNNTPNPDKAKDERWMRDFKLLDWGA-----------  806

Query  553  QAELESTLLKYEGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFI  612
                        G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL   
Sbjct  807  -----------RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTH  855

Query  613  FQRPFGQRIPNIGMWQHIM  631
             +RP  QR+ +IG+W  I+
Sbjct  856  HKRPVSQRVRDIGVWYRIL  874


>Q9VDV4_DROME unnamed protein product
Length=1075

 Score = 169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 154/559 (28%), Positives = 235/559 (42%), Gaps = 141/559 (25%)

Query  179  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  234
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  327  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  376

Query  235  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  286
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  377  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  436

Query  287  FI------------------------------------FW-----IGFGRGDQSSEDIGY  305
             I                                    FW       + +     ++   
Sbjct  437  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  496

Query  306  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  359
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  497  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  553

Query  360  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV----Q  403
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV     
Sbjct  554  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPM  613

Query  404  DWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWL------NDMGKCVGTFQF  457
                  +       +++     +L  +   L E   ++ +W       + +   +   QF
Sbjct  614  TTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQF  673

Query  458  VNSFSSLFYIAF-----------------YLQDQ-------ERLKEQLATLLITRQLIGN  493
            VN ++S+FYIAF                 Y Q++         L  QLA +++ +Q    
Sbjct  674  VNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNT  733

Query  494  IKESALPYVQEQFRLAKLSFDLYGALSPSEAKKSDGT-TNDFDSASNGKSSSGGGNRNVS  552
            I E  LP    +    ++        +P+  K  D     DF     G            
Sbjct  734  ILEVYLPMFWRKVLAIQVGLSRLFNNTPNPDKAKDERWMRDFKLLDWGA-----------  782

Query  553  QAELESTLLKYEGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFI  612
                        G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL   
Sbjct  783  -----------RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTH  831

Query  613  FQRPFGQRIPNIGMWQHIM  631
             +RP  QR+ +IG+W  I+
Sbjct  832  HKRPVSQRVRDIGVWYRIL  850



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02550.1.1 interferon-inducible

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q27IS7_DROME  unnamed protein product                                 38.9    0.007
Q27IS6_DROME  unnamed protein product                                 38.5    0.008
M9MRT5_DROME  unnamed protein product                                 38.5    0.008


>Q27IS7_DROME unnamed protein product
Length=407

 Score = 38.9 bits (89),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 38/72 (53%), Gaps = 4/72 (6%)

Query  293  KTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKKQA  349
            KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK+A
Sbjct  101  KTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKKEA  159

Query  350  KHKTAKNMLIEL  361
            KH  A+ ++ +L
Sbjct  160  KHAAARALIDKL  171


>Q27IS6_DROME unnamed protein product
Length=407

 Score = 38.5 bits (88),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 38/72 (53%), Gaps = 4/72 (6%)

Query  293  KTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKKQA  349
            KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK+A
Sbjct  101  KTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKKEA  159

Query  350  KHKTAKNMLIEL  361
            KH  A+ ++ +L
Sbjct  160  KHAAARALIDKL  171


>M9MRT5_DROME unnamed protein product
Length=359

 Score = 38.5 bits (88),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  291  STKTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKK  347
            + KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKK  190

Query  348  QAKHKTAKNMLIEL  361
            +AKH  A+ ++ +L
Sbjct  191  EAKHAAARALIDKL  204


 Score = 29.6 bits (65),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query  45   VFSYELNLFNGAYIAHGSGPNKKIAKQETAKNMLMQLSRDKSNVKALLDKNKIQEPSLCK  104
            +F+   ++ N  Y   G G +KKIAK+  A  M M+L          +D  KI + S+C 
Sbjct  282  LFTIACSILN--YREMGKGKSKKIAKRLAAHRMWMRLQETP------IDSGKISD-SICG  332

Query  105  SIDVEANDLGDLNK  118
             ++ E + + D+++
Sbjct  333  ELEGEVSIIQDIDR  346



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02560.1.1 Protein

Length=911
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MELT_DROME  unnamed protein product                                   632     0.0  


>MELT_DROME unnamed protein product
Length=994

 Score = 632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/880 (44%), Positives = 532/880 (60%), Gaps = 86/880 (10%)

Query  1    MHELFTQVLSNKDLSKAGDLFSVPDSSIINDLTEVVTKISEITSLPDYVNNNNDQSVVEI  60
            MHELF +VL+ +DLS+AGDLFSVPD+ I++D+TEV+++IS I S  DYV NNNDQSVVEI
Sbjct  1    MHELFNKVLAKRDLSRAGDLFSVPDADIVDDITEVLSEISPIISHADYVKNNNDQSVVEI  60

Query  61   CITRVTSAIRETDSIEQHAEALVGLLESCLNHNLKPS-PKDEDPPHAKISSDIISCIFLN  119
            C+TRV S IRET + E++  ALV LL +CL  NL+PS    E+PPHAKI++DIIS IFLN
Sbjct  61   CVTRVLSCIRETKTAERYCAALVDLLRTCLLWNLQPSGTTKEEPPHAKIAADIISSIFLN  120

Query  120  YNKKDVMKRALPVAVKLLHKGNRELSRNMASYLSLAVIHNAPLLSQHIQLIIDSVISGNY  179
            Y+KK++MK ALPVAV+ L KGNRELSRN+ASYLSLA I +A LLS H + +++S++SGNY
Sbjct  121  YDKKELMKIALPVAVQFLPKGNRELSRNLASYLSLAAIDHAGLLSPHTESVMESILSGNY  180

Query  180  PLCRVLPQIYAVTKDPIHEHAMALVSLLPQCDLSEKLALLQLFALVAHNKPLLLEASLPQ  239
             L RVL Q+Y V  + +  HA  L+ LLPQCD  E++A+ QL+ L+    P +LE+ +PQ
Sbjct  181  GLLRVLSQVYEVAPEAVTPHAPLLMPLLPQCDPQERMAVFQLYLLIVQKSPEVLESCVPQ  240

Query  240  LCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCITVQVVAAVGRL  299
            LC  L  + T   TMQI L L++  P LLVD+  +L+ A + N  T+ +  Q++   G  
Sbjct  241  LCGSLLDSDTSSITMQILLKLSQHSPSLLVDHFEQLRLAAKTNPGTIPLCAQIMTTAGIG  300

Query  300  NKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNSAQV  359
            +K+ AQ AL+F+L HLP     +Q++L +EAT LCS YPVL TDK+LA V Q  +N+A  
Sbjct  301  SKETAQQALDFVLEHLP-----TQALLQQEATRLCSAYPVLFTDKVLACVRQ--KNAALS  353

Query  360  NQSSNNNGVTIVTVGGC-----------------ESATPTTKSSSVESTNNIPPSSGGGG  402
            +Q    NG+   T GG                      P   ++ V+  + +  +     
Sbjct  354  SQQDVGNGLANKTSGGVTIVSLNSSSPSPPLKPVPVGAPAINTTIVQPASVVSATPTPPP  413

Query  403  GIYKTKNSTVISTHSTNTYTPNSKNQDSNNNSRIRPRIGADSRSTSRLN-SSAAHRSMTR  461
                   ++     S  T TP    Q +    R+  ++G DSRST RL+ +S  HRS+TR
Sbjct  414  SSASAPIASSTPV-SAATPTP----QHAGYTRRV--KLG-DSRSTGRLHPASNTHRSVTR  465

Query  462  LNIASSSRLGSVGGLHKSMTRLSTSSHINQPPSQSQPQPPGQQQASSQQPHSL-------  514
            LN+AS    GSVGGLHKSMTRLS S    QP   S      Q  A+ + P  L       
Sbjct  466  LNVAS----GSVGGLHKSMTRLSNSQINQQPGGSSNGNVVVQSGATPKTPTGLSNPPVTP  521

Query  515  --PYNRSVTSIHGTRHYNVAGNKVTSGGVTVTTSTRSPSPTKTITGSGGSGSALRDDSVI  572
              P + +V      RH    G  VTSGGVTVTT     SP+K    S G  + L   +V+
Sbjct  522  VPPLSNNVVITGHNRH----GIPVTSGGVTVTT-----SPSKVRPHSQGPSTLLNSSTVL  572

Query  573  VTPRYIQHTHTRPVSTLGGGSPLSQSIISQALSQS-SAANLH--SIARPFNSSSVTPRRH  629
            +  +Y      + V ++    P S ++ +   +Q+ +A ++H  S A P ++S+      
Sbjct  573  M--KYSTDALNQSVGSI--SIPQSAAVATLPSTQTQNAVSVHHASPALPQSASN-----G  623

Query  630  NANTSVTIINNSNSNV----PAANNSAIAAASQVSIINNSNSNVPAASQRISVFEPYP-M  684
            +A + + +  N NS V    P  N +   + +    + N+NS      QR+S FEPY  M
Sbjct  624  HAKSVMKLPVNGNSEVIVSGPTTNVAPRRSDNTSRTLLNANS---VMDQRMSTFEPYQIM  680

Query  685  RDTIQHFCEKHLDKIKSYMEKVSVRIPSPAKCTIE------ERRAKKMAKLHFACQGRGE  738
            RD +Q FCEK+ + IKSYM++VS  +P P +C+IE      ERR KK+AKLHFACQ RG 
Sbjct  681  RDPVQQFCEKNFNSIKSYMDEVSQHLPPPTRCSIEVSNEFAERRTKKVAKLHFACQIRGP  740

Query  739  HCLYSRALFTTRTRHPRAWIHLMFLSLQAR----SDSALSSRDSSVSSLKHCWDILKCEN  794
            HCLYS+  FT RTR+P+ WIH+MFL  Q R        LS+R+S +S+LK+ W ILKCEN
Sbjct  741  HCLYSKTCFTMRTRNPKTWIHMMFLDFQVRHFVKEKCVLSTRESGISNLKNIWQILKCEN  800

Query  795  KTFLTLVTSAFPCAKDQEAVLNELRHSGFCDVFEYGKEDK  834
            ++F  LVTS FP  KD+E ++NELRHSGF DVFE  K DK
Sbjct  801  RSFTELVTSQFPQVKDREILVNELRHSGFLDVFEVSKTDK  840


 Score = 114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)

Query  839  IDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEM  898
            IDV++IRSVKVSRGARNIPKAFEIFT D +LILKPK+GKNAE+WVQCLS+VVAHSQA++ 
Sbjct  915  IDVNQIRSVKVSRGARNIPKAFEIFTADQTLILKPKDGKNAEEWVQCLSIVVAHSQARDN  974

Query  899  PT  900
            PT
Sbjct  975  PT  976



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02570.1.1 Guanine

Length=1100
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPI9_DROME  unnamed protein product                                 801     0.0  
Q86I66_DICDI  unnamed protein product                                 132     8e-31
Q54CA8_DICDI  unnamed protein product                                 120     3e-27


>Q9VPI9_DROME unnamed protein product
Length=2064

 Score = 801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/922 (46%), Positives = 616/922 (67%), Gaps = 50/922 (5%)

Query  173   SSRDSRVSSSGGDTPRGSWASFDLLNSKIQWGAFDQLRKRASD-SSTLTRRGSLERRSNS  231
             + RDS  ++ G     G+  S + L+ K    +FDQLR++A+D S TLTRRGSLER+   
Sbjct  419   AERDSFGNACGSSL--GTAPSSNSLDRKSSTSSFDQLRRKANDMSGTLTRRGSLERK---  473

Query  232   SDKRVSWNLDD----LDSFRPVTLTVSSFFKQESDKLRDEDLYKFLQDLKKPCSLLKKLK  287
              +K  SW+ DD    +++FRP+T+TV SFFKQE+DK++DEDLYK L +LK+P S++KK K
Sbjct  474   -EKHRSWSPDDFANVVENFRPITITVPSFFKQEADKMKDEDLYKILPELKRPSSVMKKYK  532

Query  288   SIPGCLKLDISPCPDEVKWCLTPELAEIVPRIGDKGRPIKEILEFPLRETNLPHYLYRNL  347
              IPG +KL+ISPC +E K  LTPELA I P+  D  RP+KEILEFP      PHY YRNL
Sbjct  533   CIPGSIKLEISPCVEEAKNALTPELAPINPQSADNVRPVKEILEFPQSAIYNPHYSYRNL  592

Query  348   LFVYPKEINFTGRTGSARNLTVKVQLMYGETPESALPAIFGKSSCPEFTTEAYTSVIYHN  407
             LFV PKE+NF+ R GSARN+ V+VQLM GETP+ A+ AI+GKSSCP+F+TEA+T+V YHN
Sbjct  593   LFVSPKELNFSSRAGSARNIAVRVQLMAGETPKDAVNAIYGKSSCPKFSTEAFTAVNYHN  652

Query  408   KCPYVSDEIKIQLPPTLEDKHHLLFTFYHISCQKKLE--QNTVETPVGYTWLPLLKDGQL  465
             KCP   DEIKI LP +++  HHLLFT YH+SCQKK +  Q +VETP+GYTWLPLL+DG+L
Sbjct  653   KCPSFYDEIKIALPASIKQHHHLLFTIYHVSCQKKPQDLQPSVETPIGYTWLPLLEDGKL  712

Query  466   QLNDFCLPVTLEAPPPNYSYITPDVLLPGLKWVDNHKSIFNVVLSAASSIHPQDTHIHEF  525
             +  +F LPV +E+PP NYS+I P+V LPG+KW+DNH+++F++ + A ++IH  D+ +  F
Sbjct  713   KFGEFNLPVMVESPPENYSFIPPNVHLPGIKWLDNHRAVFSINVEAVTAIHTLDSFLDRF  772

Query  526   LSICDKLETGGVVSNRLPEINFEAELRQKILNLVNCKLEPLIKFLTIILNKLIYLMTQPL  585
               IC+ L+T  + S+ + E N E EL++ +L++     EPL++ L ++L+KLI L+    
Sbjct  773   FLICEYLDTRNIPSH-IGENNIETELKKCLLDIEYANREPLVRHLPLVLDKLIELLVVTH  831

Query  586   CMNGQSLCISQTVFEVIGLIIKFVSAFSEDESDACGRHPLLTSYVTYQCCIPHPDLEQKR  645
              + GQ++ +  TVFEV+ L+   +S  ++D+ D  GR  LL++YV +QC IPHP   ++R
Sbjct  832   KVGGQAMSLGSTVFEVLCLVSSLLSILNDDQYDQYGRQSLLSTYVHFQCKIPHPFQSKQR  891

Query  646   SNMQRQKSSSNPDLQLDIEVQAYN-----ARGLDRTCSMKAGQCADNFASGSKLNL-CKI  699
                 R   S+  DLQL      Y+      R LDR          D   S +  ++  ++
Sbjct  892   LTCSR---STTEDLQLSESYTIYDNVLASGRSLDR-----KELSIDVLHSMAARDVQVRL  943

Query  700   LHEEIGLQWVVSSSTARENAMSHAWFFFDLMAKSMVEHLSITETMDSPRKMRFSDQYMED  759
             LHEE+ L WVV+S  A + AMS++WF F+L+ KSM+EHL  + T++ PRK RF  Q+ +D
Sbjct  944   LHEELALHWVVASGKAADLAMSNSWFLFELIVKSMIEHLHCSNTLNGPRKHRFPHQFNDD  1003

Query  760   IATLVTSFTSDIIAYCHKDYKLTRSMNTSLAFFLFDLFSFADRSFVFLLIKTYYKHVTAK  819
             ++TLV   T+ ++ Y   + KL +S+N SL FF+FD+ S  DR FVF LIKTY K + +K
Sbjct  1004  LSTLVHLVTTKVVGYHSNEPKLAQSLNASLGFFIFDILSIMDRGFVFGLIKTYTKVLISK  1063

Query  820   ISSLPDSIALSNLKLEFLRVVCSHEHFVPLNLPFGTVFTANSSSTSPSPSTNSSTSQSSY  879
              +S+PD   L N K++FLR+VCSHEHFV LNLPFGT +T     T+P  S   ST+ S+ 
Sbjct  1064  NASIPD---LMNYKIDFLRIVCSHEHFVALNLPFGTSYTM---VTAPC-SPTPSTTSSNS  1116

Query  880   MSSLISKDKSPFAELSLEFKQQHYLVGLILSEFAAMIEVQNHNFHNRIVTLITDLMASHD  939
              +S  S +++  A+LS EF QQH+LVGL+LS+ AA++EV N   H + +  I +LM SHD
Sbjct  1117  QTSCGSLERALHADLSQEFLQQHFLVGLVLSDLAAVMEVPNPQLHGKAIRCIRNLMTSHD  1176

Query  940   CDARFVEPEAKARVAALYLPYIALTMDMLPNLHS-GNDVSRIINPTSEESVE--------  990
              DAR+ E +A+ARVAALY+P +++ MD +P LH  G +  R+      E  +        
Sbjct  1177  LDARYSETDARARVAALYIPLLSIVMDCIPQLHQHGLEQDRLQQIGQLEDYQGPHQTITA  1236

Query  991   SGLNQSVAMAIAGTSMFGIKTDNYKLFQQTRKVNLSMDNTKNILICFLWILKNMDKDILK  1050
             S +N  VA AI+G+  +    +  K      K+ LS +NT+++L+CFLW+LKN+++++L 
Sbjct  1237  STINPEVAFAISGSRPYSYLNEQVK-----NKLPLSSENTRHLLVCFLWVLKNLERNVLY  1291

Query  1051  QWWAEMPVSRLNQLLQVLGSVC  1072
             +W  ++   R++Q+LQ + +VC
Sbjct  1292  RWLMDLSPHRVHQMLQGV-NVC  1312


 Score = 156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 132/212 (62%), Gaps = 20/212 (9%)

Query  1    MASFQRAFAQKLSGQNAADVRRQVSSVSGELPKSESRMSFIFTSITDVVDPIDYEDFILQ  60
            M+S QR+F QK+S Q+AADVR+ VS     L K+    S   +SI+   +P+DYE+F+ Q
Sbjct  1    MSSAQRSFVQKVSKQSAADVRKNVSGC--HLSKAMDP-SLCGSSISPT-EPLDYEEFLSQ  56

Query  61   QSLLIDRDPLKHLLEFPVDDIQVCVLPRKIRTVKPLLPKEPLSELEPHVRECIECYTRNW  120
               +I+RDPLKH+L+FP  D+ V ++PRKIRTV  ++P E LS+L  HV+EC+ CYTR W
Sbjct  57   HMNIINRDPLKHILDFPQGDVTVKIIPRKIRTVDHVVPNENLSDLPHHVQECVNCYTRPW  116

Query  121  IYVDYRYRHFSTSSWF---IDRTTLASNLPRQEFEVDMTPLPNGRVSPQPSYKSQ----S  173
              V+Y  RH S+S +    IDR T++ +  +QEFE+D             +YKS+    S
Sbjct  117  KVVEYAQRHLSSSCYIRERIDRGTISPSAYQQEFEIDKD---FSSFEEAFAYKSESCTPS  173

Query  174  SRDSRVS----SSGGD--TPRGSWASFDLLNS  199
            SR S  S    SS  D  TPRGSWASFDL  S
Sbjct  174  SRQSIASLASVSSCTDTLTPRGSWASFDLRRS  205


>Q86I66_DICDI unnamed protein product
Length=2284

 Score = 132 bits (332),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 121/211 (57%), Gaps = 15/211 (7%)

Query  326  IKEILEFPLRETNLPHYLYRNLLFVYPKEINFTGRTGS--ARNLTVKVQLMYGETPES--  381
            IKE  EF   +    +  + N L++YP+ +N + R+GS  ARNLT K+QL+  ET E+  
Sbjct  654  IKECHEFSSNQRFEINTEFVNNLYLYPETLNLSNRSGSFAARNLTCKIQLL--ETDENPL  711

Query  382  ---ALPAIFGKSSCPEFTTEAYTSVIYHNKCPYVSDEIKIQLPPTLEDKHHLLFTFYHIS  438
                L AI+GKS    F ++AYT V YH+K P  +DEIKI+LP +     H+LFTFYHI+
Sbjct  712  CPEGLKAIYGKSKTQSFNSKAYTQVTYHSKTPVFNDEIKIRLPLSPSPSLHILFTFYHIA  771

Query  439  CQKKL-EQNTVETPVGYTWLPLLKDGQLQLND-FCLPVTLEAPPPNYSYITPDVLLPGLK  496
            CQK     + V+ PV Y  LP+++ G++   + F LP+  E P    S  T       +K
Sbjct  772  CQKSSGGGDLVDQPVAYGVLPIIQYGKMIGEEVFNLPLAYEFP----SRYTRRDQEATIK  827

Query  497  WVDNHKSIFNVVLSAASSIHPQDTHIHEFLS  527
            ++DN K IF V     SSIH  D +++ F +
Sbjct  828  YIDNKKPIFQVRSKLVSSIHSTDDYLNSFFN  858


 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/364 (22%), Positives = 144/364 (40%), Gaps = 89/364 (24%)

Query  717   ENAMSHAWFFFDLMAKSMVEHLSITE----TMDSPRKMRFSDQYMEDIATLVTSFTSDII  772
             EN +  + FFF ++ KSM   LS+ E      +  RK RF       +A L++    +  
Sbjct  1042  ENILRFSRFFFQVIHKSMA--LSLIERNKREENKTRKGRFVG-VRPQLAKLISILRWESS  1098

Query  773   AYCHKDYKLTRSMNTSLAFFLFDLFSFADRSFVFLLIKTYYKHVTAKIS-SLPDSIALSN  831
                   +KL + +  SLA F+  L S ADR +VF +I       T        + + +  
Sbjct  1099  TRAKHTFKLAKELIRSLAGFISCLVSIADRGYVFKIIDRAVNDFTHNNQIGGENEMEIYE  1158

Query  832   LKLEFLRVVCSHEHFVPLNLPFGTVFTANSSSTSPSPSTNSSTSQSSYMSSLISKDKSPF  891
             LK EFLR++C +++FV LN+P               P    STS+   ++++++  K   
Sbjct  1159  LKFEFLRIICQNDYFVQLNIPL--------------PFRIDSTSK---LTNILTSSK---  1198

Query  892   AELSLEFKQQHYLVGLILSEFAAMIEVQNHNFHNRIVTLITDLMASHDCDARFVEPEAKA  951
                       H+L  L+L+  +A I  +           + D +   + D R+ +   K 
Sbjct  1199  ----------HFLSDLLLNNISAGIGSKIPLIRMDAANSLRDTLTRLEMDTRWFDQSNKQ  1248

Query  952   RVAALYLPYIALTMDMLPNLHSGNDVSRIINPTSEESVESGLNQSVAMAIAGTSMFGIKT  1011
             R+  ++ PY+ + ++   N                                      IK 
Sbjct  1249  RIVGVFTPYLTIVVNNWDN--------------------------------------IKD  1270

Query  1012  DNYKLFQQTRKVNLSMDNTKNILICFLWILKNMDKDILKQWWAEMPVSRLNQLLQVLGSV  1071
             D++ +              +NIL+ F+++LK +  +++K WW E P ++   L  +L   
Sbjct  1271  DSFIM-------------KRNILVSFIYLLKTIHINLIKIWWREEPKAKYVTLFDILNQC  1317

Query  1072  CPVL  1075
               + 
Sbjct  1318  LEIF  1321


>Q54CA8_DICDI unnamed protein product
Length=2147

 Score = 120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 105/192 (55%), Gaps = 12/192 (6%)

Query  340  PHYLYRNLLFVYPKEIN---FTGRTGSARNLTVKVQLMYGETPESA--LPAIFGKSSCPE  394
            PH  + N+L+ YPK +N   F    GSARN+ ++V+LM  ++  +A  +    G S+ P 
Sbjct  633  PHLTFSNVLYFYPKSVNLTNFKSDRGSARNIFLEVKLMEDDSSVTAIGMKNTHGTSTTPL  692

Query  395  FTTEAYTSVIYHNKCPYVSDEIKIQLPPTLEDKHHLLFTFYHISCQK-KLEQNTVETPVG  453
             T    TSV+YHNK P  SDEIKI LP  L   HHLL TFYH+ C+K K  +N + TP+G
Sbjct  693  LTCSFLTSVVYHNKKPKFSDEIKINLPSNLTANHHLLVTFYHLGCKKSKKSENPMHTPLG  752

Query  454  YTWLPLLKDGQLQLND-FCLPVTLEAPPPNYSYITPDV-----LLPGLKWVDNHKSIFNV  507
            Y+ + L +  ++  +  +  PV    PP   +    D+      +    WVDN K +F+ 
Sbjct  753  YSVVRLFEQDRIICDGKYKRPVGTVFPPRYLAQEAKDIKDSKDTINHKIWVDNKKPVFSF  812

Query  508  VLSAASSIHPQD  519
                 SS++PQD
Sbjct  813  KTRVISSLYPQD  824


 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 112/249 (45%), Gaps = 39/249 (16%)

Query  719   AMSHAWFFFDLMAKSMVEHLSITETMDSPRKM--RFSDQYMEDIATLVTSFTSDIIAYCH  776
             ++ ++WF F ++ KSM+  +   + + S R    RFS++ +   + L   F   ++    
Sbjct  1009  SIQYSWFLFGIIKKSMIADIQNRDQLKSGRNRTNRFSEEILNRFSFL---FDQLLVQLKG  1065

Query  777   KDYKLTRSMNTSLAFFLFDLFSFADRSFVFLLIKTYYKHVTAKISSLPDSIALSNLKLEF  836
                 + + +  ++  F+ DL     R FVF +I+ Y     A +      + L+ LK   
Sbjct  1066  AKQLVAKVLIVNIGHFINDLLDIMSRGFVFRIIRNY----IAGLDCSNTVMELTELKSRL  1121

Query  837   LRVVCSHEHFVPLNLPFGTVFTANSSSTSPSPSTNSSTSQSSYMSSLISKDKSPFAELSL  896
              RV+ S++ F+ LN P         +  SP PS                       +L  
Sbjct  1122  FRVLASNDSFIALNSP---------APISPFPS---------------------IQDLFQ  1151

Query  897   EFKQQHYLVGLILSEFAAMIEVQNHNFHNRIVTLITDLMASHDCDARFVEPEAKARVAAL  956
              F ++H+++GL+L E +A+I  ++     +++  + ++++  D +  +  P  + R+AAL
Sbjct  1152  VFYRKHFIIGLMLQEVSAVIPARDKEMRLKVINTLREIISKIDTNPLYNSPAMRERIAAL  1211

Query  957   YLPYIALTM  965
             + P + + +
Sbjct  1212  FFPLLPIIV  1220



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02580.1.1 anoctamin-8

Length=72
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UN104_CAEEL  unnamed protein product                                  27.7    0.84 
Q57XU1_TRYB2  unnamed protein product                                 26.6    1.6  
Q387Z4_TRYB2  unnamed protein product                                 26.6    1.7  


>UN104_CAEEL unnamed protein product
Length=1584

 Score = 27.7 bits (60),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 34/68 (50%), Gaps = 4/68 (6%)

Query  4    AKSIAVFSLKLKEKRAQEAELQRTERKEKIASKQM---EELNLTTGGELSPLSPNLQTND  60
            ++S AVF++ L +KR        TE+  KI+   +   E  N +TG E   L      N 
Sbjct  212  SRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERAN-STGAEGQRLKEGANINK  270

Query  61   SITSLGLA  68
            S+T+LGL 
Sbjct  271  SLTTLGLV  278


>Q57XU1_TRYB2 unnamed protein product
Length=696

 Score = 26.6 bits (57),  Expect = 1.6, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  15   KEKRAQEAELQRTERKEKIASKQMEELN  42
            K+ R  EA+L+R  RK  +   Q EELN
Sbjct  184  KDLRTMEAKLERVVRKRAVNKLQQEELN  211


>Q387Z4_TRYB2 unnamed protein product
Length=695

 Score = 26.6 bits (57),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 23/43 (53%), Gaps = 0/43 (0%)

Query  14  LKEKRAQEAELQRTERKEKIASKQMEELNLTTGGELSPLSPNL  56
           LK KRA++      +R++K     + E + T   E++PL P L
Sbjct  25  LKRKRAEDVAPALHQREKKRTCGHVCEADTTQDTEMTPLCPEL  67



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02590.1.1 Anoctamin

Length=872
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97132_DROME  unnamed protein product                                 218     8e-61
A0A0B4JCY1_DROME  unnamed protein product                             110     2e-24
Q9VDV4_DROME  unnamed protein product                                 110     2e-24


>O97132_DROME unnamed protein product
Length=646

 Score = 218 bits (556),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 149/494 (30%), Positives = 243/494 (49%), Gaps = 39/494 (8%)

Query  210  IPKCLSEGLISQMYPLHELDGLEQLRQNWVRTFVKKQPLDSVCKYFGVKIAMYFAWLGHY  269
            I   + +G I  M+PLH++  LE+   N  RT   K P++ +  YFG  I +YF ++  Y
Sbjct  164  IKSYVQKGYIEDMFPLHDILYLERFNWNLKRT---KLPIEDIRNYFGSSIGLYFGFIEFY  220

Query  270  TYMLIIPAFVGFIFWIGFGRGDQSSEDIGYVLFSLFNVVWFSIYLEAWKRYSSELAYKWG  329
            T  LI P+  G +         Q   D+   L   F VVW +I+LE WKR  +  +Y+WG
Sbjct  221  TKALIFPSLFGIL---------QYVFDLNISLVCSFYVVWTTIFLELWKRKCAGYSYRWG  271

Query  330  TLDQRHELLMEPRPLYSGNLVVSPVTGRLEPTYPSWKRHVFRYFVSVPIIALCLLVVLSV  389
            T++     L +PR  Y+G L   P+TG++   YP    ++  Y +S P++  C++     
Sbjct  272  TIEMSS--LDKPRSAYTGQLKPDPITGKMTLHYPMRYTYLQMYCISYPVVLGCVVAAGWF  329

Query  390  MIASLKVQDWWDKYIQNGGYYFWLSYVPKVLLAVIITLLDEAYYKVALWLNDMGIHVFVS  449
             +   +++    + + + G   WL YVP ++ +V+I +   AY K+A +L ++  H   S
Sbjct  330  ALYQFQIE---AEVLADFGPDSWLLYVPVIVQSVLIAIFSWAYEKLATFLTNLENHRTRS  386

Query  450  Q---QLATLLITRQLIGN-IKESALPYVQEQFRLAK-------LSFDLYGA--------L  490
            Q        L+  +++ N   +  + +V    R  K       L F L           L
Sbjct  387  QYDRHRVNKLMLFEIVNNFFSQFYIAFVLHDLRQLKYQLMMQLLVFQLLCIAQEIGIPLL  446

Query  491  SPSEAKKSDGTTNDFDSASNGKPSSGGGNRNVSQAELESTLLKYEGTFADHLEMFIQLGY  550
            +    K ++    +    +  K  S        Q+  ES L +Y  T+ D+L++ IQ G+
Sbjct  447  AVLRQKYAEFRHRE---VAEEKLRSISDLPRYEQSFYESGLDEYHSTYEDYLQVCIQFGF  503

Query  551  VVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIPNIGMWQNGMEVMSLVSV  610
            VVLF+   P AA+ ALLNN+  +  D +KLC IF+RPF +R  NIG WQ   E++S++S+
Sbjct  504  VVLFAAVAPFAAIGALLNNVFAVHIDMWKLCNIFKRPFARRAKNIGAWQLAFELLSVMSL  563

Query  611  LVNCALIGLSGQVHRMFPEMSRTQTILLIVALEHIMFAVRFIISCVIPDLPDWVATEMAK  670
            L NC L+ L   V   F     +   L  V  EH++  ++F+I  VI + P WV   + K
Sbjct  564  LSNCGLLFLQPNVKDFFSHWLPSVPDLSFVIFEHLLLGLKFLIHKVIHERPRWVRIGLLK  623

Query  671  VEFARREALSRISS  684
             +F   +AL ++  
Sbjct  624  ADFETSQALKQLKK  637


>A0A0B4JCY1_DROME unnamed protein product
Length=1099

 Score = 110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/295 (31%), Positives = 132/295 (45%), Gaps = 84/295 (28%)

Query  173  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  228
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  351  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  400

Query  229  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  280
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  401  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  460

Query  281  FI------------------------------------FW-----IGFGRGDQSSEDIGY  299
             I                                    FW       + +     ++   
Sbjct  461  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  520

Query  300  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  353
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  521  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  577

Query  354  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV  396
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV
Sbjct  578  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKV  632


 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 0/89 (0%)

Query  535  EGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIPN  594
             G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL    +RP  QR+ +
Sbjct  807  RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRD  866

Query  595  IGMWQNGMEVMSLVSVLVNCALIGLSGQV  623
            IG+W   ++ +  +SV+ N  +I  +  +
Sbjct  867  IGVWYRILDCIGKLSVITNGFIIAFTSDM  895


>Q9VDV4_DROME unnamed protein product
Length=1075

 Score = 110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/295 (31%), Positives = 132/295 (45%), Gaps = 84/295 (28%)

Query  173  FFTTQERQWMVYHLLHTLRATTNDQ----FGSFKFIEGQAIIPKCLSEGLISQMYPLHEL  228
            FFTT  R  +V  +L   R    +Q    FG          I + ++EG+ S  YPLH+ 
Sbjct  327  FFTTAVRSRIVEFILDRQRFPAKNQHDMAFG----------IERLIAEGVYSAAYPLHDG  376

Query  229  DGLEQ------LRQNW--VRTFVKKQPLDSVCKYFGVKIAMYFAWLGHYTYMLIIPAFVG  280
            +  E       L ++W  V  + + QPLD + +YFGVKI +YFAWLG+YTYML++ + VG
Sbjct  377  EITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVG  436

Query  281  FI------------------------------------FW-----IGFGRGDQSSEDIGY  299
             I                                    FW       + +     ++   
Sbjct  437  VICFLYSWFSLKNYVPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPST  496

Query  300  VLFSLFNVVWFSIYLEAWKRYSSELAYKWGT--LDQRHELLMEPRPLYSGNLVVSP----  353
            V F++F   W +++LE WKRYS+E+ ++W     D   E    PRP Y   L   P    
Sbjct  497  VFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEE---HPRPQYLARLEHIPPTRV  553

Query  354  --VTGRLEPTYPSWKRH----VFRYFVSVPIIALCLLVVLSV------MIASLKV  396
              VT   EPT P W+      VF + V + +IAL  + +L+V      M+A+LKV
Sbjct  554  DYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKV  608


 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 0/89 (0%)

Query  535  EGTFADHLEMFIQLGYVVLFSCAFPLAALCALLNNLIEIRSDAFKLCFIFQRPFGQRIPN  594
             G F ++LEM +Q G+V +F  AFPLA   ALLNN++E+R DA KL    +RP  QR+ +
Sbjct  783  RGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRD  842

Query  595  IGMWQNGMEVMSLVSVLVNCALIGLSGQV  623
            IG+W   ++ +  +SV+ N  +I  +  +
Sbjct  843  IGVWYRILDCIGKLSVITNGFIIAFTSDM  871



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


Query= Dcitr00g02600.1.1 Interferon-inducible

Length=1276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJY9_DROME  unnamed protein product                                 73.2    6e-13
X2J5X6_DROME  unnamed protein product                                 72.8    6e-13
M9MRT5_DROME  unnamed protein product                                 68.6    9e-12


>Q9VJY9_DROME unnamed protein product
Length=465

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  608  VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  665
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  666  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  712
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  713  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  772
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  773  AKMLVRLQE  781
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


 Score = 38.1 bits (87),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  332  STKTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKK  388
            + KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKK  190

Query  389  QAKHKTAKNMLIEL  402
            +AKH  A+ ++ +L
Sbjct  191  EAKHAAARALIDKL  204


 Score = 35.4 bits (80),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query  108  VEANDLGDLNKKTPASILDEHLADQKEIPNYIFSETLDPSSSKTLQ-KCSLTLFDGLLSA  166
            V   D   L  KTP SIL E L+ +   P Y   +        T + + S    D   +A
Sbjct  123  VSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTA  182

Query  167  TGEGLTKKEAKQKTAESMLVKL  188
             G G +KKEAK   A +++ KL
Sbjct  183  MGAGRSKKEAKHAAARALIDKL  204


>X2J5X6_DROME unnamed protein product
Length=464

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 16/189 (8%)

Query  608  VIMKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFG--GQYQSTGSGQSK  665
            + MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SK
Sbjct  131  LAMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSK  189

Query  666  KQAKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSS---IKN  712
            K+AKH AA  ++ KL          S   P +  L       +     T    +      
Sbjct  190  KEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVG  249

Query  713  NSIFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSA  772
            N I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A
Sbjct  250  NPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA  309

Query  773  AKMLVRLQE  781
             +M +RLQE
Sbjct  310  HRMWMRLQE  318


 Score = 38.1 bits (87),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  332  STKTPVSLLHEYLVDQKELPDYEFSKVDS---DPSSLWFHCKLKILNGRYFAEATGLTKK  388
            + KTPVS+L E L  +   P YE  +++    +P +  F    K  +  + A   G +KK
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKK  190

Query  389  QAKHKTAKNMLIEL  402
            +AKH  A+ ++ +L
Sbjct  191  EAKHAAARALIDKL  204


 Score = 35.4 bits (80),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query  108  VEANDLGDLNKKTPASILDEHLADQKEIPNYIFSETLDPSSSKTLQ-KCSLTLFDGLLSA  166
            V   D   L  KTP SIL E L+ +   P Y   +        T + + S    D   +A
Sbjct  123  VSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTA  182

Query  167  TGEGLTKKEAKQKTAESMLVKL  188
             G G +KKEAK   A +++ KL
Sbjct  183  MGAGRSKKEAKHAAARALIDKL  204


>M9MRT5_DROME unnamed protein product
Length=359

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 58/198 (29%), Positives = 86/198 (43%), Gaps = 19/198 (10%)

Query  610  MKTPVSLLQEYLVEQGTVPRYIARELSTGPSTPKVFQYELSIFGGQ--YQSTGSGQSKKQ  667
            MKTPVS+LQE L  +G  P Y   ++      P  F++ +S       + + G+G+SKK+
Sbjct  133  MKTPVSILQELLSRRGITPGYELVQIEGAIHEP-TFRFRVSFKDKDTPFTAMGAGRSKKE  191

Query  668  AKHEAANNMLLKL----------SEQRPDLKKLLERNDFYEKMDKVTSNNSSIKN---NS  714
            AKH AA  ++ KL          S   P +  L       +     T    +      N 
Sbjct  192  AKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVGNP  251

Query  715  IFQLDSYCRYHNFNSPEYTFIEETGDPHNKTFTMKCEVEKIIVEGTGNKIQAAKHNSAAK  774
            I  L   C    +  P Y    E G PH + FT+ C +      G G   + AK  +A +
Sbjct  252  IGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHR  311

Query  775  MLVRLQE---ELNKIAES  789
            M +RLQE   +  KI++S
Sbjct  312  MWMRLQETPIDSGKISDS  329


 Score = 37.0 bits (84),  Expect = 0.085, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query  108  VEANDLGDLNKKTPASILDEHLADQKEIPNYIFSETLDPSSSKTLQ-KCSLTLFDGLLSA  166
            V   D   L  KTP SIL E L+ +   P Y   +        T + + S    D   +A
Sbjct  123  VSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTA  182

Query  167  TGEGLTKKEAKQKTAESMLVKL  188
             G G +KKEAK   A +++ KL
Sbjct  183  MGAGRSKKEAKHAAARALIDKL  204


 Score = 37.0 bits (84),  Expect = 0.092, Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (51%), Gaps = 2/73 (3%)

Query  332  STKTPVSLLHEYLVDQKELPDYEFSKVDS--DPSSLWFHCKLKILNGRYFAEATGLTKKQ  389
            + KTPVS+L E L  +   P YE  +++      +  F    K  +  + A   G +KK+
Sbjct  132  AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKE  191

Query  390  AKHKTAKNMLIEL  402
            AKH  A+ ++ +L
Sbjct  192  AKHAAARALIDKL  204



Lambda      K        H
   0.326    0.140    0.426 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3891044934


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Apr 30, 2020  2:49 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g02610.1.1 Unknown

Length=203


***** No hits found *****



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02620.1.1 ethanolamine-phosphate

Length=90
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q18225_CAEEL  unnamed protein product                                 28.9    0.47 
TAD2A_DROME  unnamed protein product                                  26.6    2.9  
Q9W279_DROME  unnamed protein product                                 26.6    3.5  


>Q18225_CAEEL unnamed protein product
Length=470

 Score = 28.9 bits (63),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  3    EAKIIVANEGEYGNVLLFLPAMCLTTENVLFIVSTLNRILTSL  45
            + +I V  +G+ G++LLFL       ENV F V  +NR   SL
Sbjct  361  KTEIGVRWQGDEGSILLFLSHDNGAEENVFFPVVVMNRDEKSL  403


>TAD2A_DROME unnamed protein product
Length=562

 Score = 26.6 bits (57),  Expect = 2.9, Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query  26  LTTENVLFIVSTL----NRILTSLQMDSSPAIMDLLLPRTSDTLVQQWPDSSGDSDASSP  81
            TT N LF V  L     R + + Q + +   M L  P T    +++  + + D ++S P
Sbjct  28  FTTLNCLFAVEPLGPQVKRFIHAHQNEHTRNSMVLYNPHTLHRYLEEMEEKTRDQNSSVP  87

Query  82  AASYNA  87
           +A+ +A
Sbjct  88  SATKDA  93


>Q9W279_DROME unnamed protein product
Length=417

 Score = 26.6 bits (57),  Expect = 3.5, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 9/41 (22%)

Query  46   QMDSSPAIMDLLL----PRTSDTLVQQWPDSSGDSDASSPA  82
            Q+   P+  DL++     +TSD     WP +SG SD  SPA
Sbjct  215  QLGLGPSDADLVVHDLGGKTSD-----WPAASGASDLESPA  250



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02630.1.1 Solute

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SO74D_DROME  unnamed protein product                                  703     0.0   
Q9W270_DROME  unnamed protein product                                 337     2e-105
Q9VK84_DROME  unnamed protein product                                 338     2e-105


>SO74D_DROME unnamed protein product
Length=819

 Score = 703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/728 (51%), Positives = 480/728 (66%), Gaps = 62/728 (9%)

Query  7    DDEGRKNEAEYRLLPEKVNGNGN---LNVEFVNSSSHKNGNGYK--------SSYEVDED  55
            +D G        +L    NG GN   L+ ++ +  +   G GYK           + D D
Sbjct  86   EDLGHLKNGLGNILSSNNNGTGNGHSLSEKYAHEQAPLTG-GYKLPPRSSESEESDFDSD  144

Query  56   MK----------CGLGPCTPNWMQVFTNKKAFLFTFCITWVLQGMYYTYFVSVITTIEKL  105
            +           CGL  C P W + F +   F+  F + ++LQGMY TYFVSVITTIEKL
Sbjct  145  LNGGSSAESSSSCGLFGCRPRWARRFASTHVFMVVFLLAYILQGMYMTYFVSVITTIEKL  204

Query  106  FQVQSKTTGIIMSATEIGQIGSSLLLTYYGGQGHRPRWIAWGMVLFAASSFICALPHFIF  165
            FQ++SKTTGI++SA+E+GQI +++LLTY+ G+GHRPRWIA GMVLF+ ++F CALPHFIF
Sbjct  205  FQIKSKTTGILLSASEMGQICTAMLLTYFAGRGHRPRWIACGMVLFSIAAFSCALPHFIF  264

Query  166  GDQPLNKQNLIFQGDNGTIDLPPNLCY-----------IPPSLTLSGNITMHDTSLDQCH  214
            G+Q ++   ++ Q    T   PPN  +           + P+L + G    H  S  +C+
Sbjct  265  GEQLMHSSVILQQ----TQVSPPNNSFSSHWLNASSEQVNPNLCILGGNQTHSGS--ECN  318

Query  215  KEKWDEQQAQSQITTIVLVIFFISLLGVGMGQTAVYTLGIPYIDDNVANRESPLYFAITI  274
            +E+  EQ + S+IT IVL IFF SLL  G+GQTAV TLGIPYIDDNV +++SP+Y A+TI
Sbjct  319  EERQLEQASHSKITVIVLCIFFGSLLSSGIGQTAVATLGIPYIDDNVGSKQSPMYMAVTI  378

Query  275  GVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMF  334
            G+RILGP+ GFI GSFCTR YV+ S P     +DPRWIGAWWLG V +   ++LA++AMF
Sbjct  379  GMRILGPASGFIFGSFCTRWYVNFSNPG-FDATDPRWIGAWWLGPVAIGSLMLLASIAMF  437

Query  335  MFPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLH  394
             FPK L       G T     P + E   + P LKDFPK V+R L NDILM+RTAS V H
Sbjct  438  SFPKQLRGKQKPPGQTATPAAPVEPE---EKPKLKDFPKTVRRQLSNDILMFRTASCVFH  494

Query  395  ILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVA  454
            +LPIAGLYTFLPKY ETQFRL ++ ANM++   GILVMGIGI++SG+FILK KP AR VA
Sbjct  495  LLPIAGLYTFLPKYLETQFRLATYDANMIAAFCGILVMGIGIVISGLFILKRKPTARGVA  554

Query  455  AWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISS--FEPMCATTHGCECDHSKFNP  512
            AWIA TA++Y+ GM IL FIGC M+++AG   ++G S    EP C+    C CD   F P
Sbjct  555  AWIAFTALVYSAGMIILMFIGCSMNDFAGYKPSDGNSPALIEPTCSAALNCTCDKENFAP  614

Query  513  ICGGDGRTYFSACHAGCQNIS--SIDGK--FSNCTCMSGMWGNGTILPDPLATTASLGPC  568
            IC  DG+ Y SACHAGC + S    D +  +S+C C+            P A  A  G C
Sbjct  615  ICA-DGKMYISACHAGCSSSSLRPSDNRTLYSDCACI------------PDAPEAVNGYC  661

Query  569  ENDCVSVKWYIILFSFFVFIHSTSEVGSMLLILRCVDPSDKAMALGLIQFAIGLFGNVPC  628
            +N+C +  ++I++F+  VF+HSTSEVGSMLL++RC  P DKAMA+G+IQ AIGLFGNVPC
Sbjct  662  DNNCKNFIYFILIFAICVFMHSTSEVGSMLLVMRCTHPKDKAMAMGVIQSAIGLFGNVPC  721

Query  629  PIVYGAVVDSACLVWESVCGEKGACNLYDTDVFRVFYHGTTGFILLLAFFVDTIVWYKAG  688
            PI+YGAVVDSACL+W+SVCG+ GAC+LYD D FR ++ G T  I+ LAF +D +VW KA 
Sbjct  722  PIIYGAVVDSACLIWKSVCGKHGACSLYDADTFRQYFLGITAGIMFLAFLMDLVVWRKAH  781

Query  689  SINFADEE  696
             I+ A E+
Sbjct  782  RIDIAPED  789


>Q9W270_DROME unnamed protein product
Length=680

 Score = 337 bits (863),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 212/680 (31%), Positives = 330/680 (49%), Gaps = 49/680 (7%)

Query  54   EDMKCGLGPCTPNWMQVFTNKKAFLFTFCITWVLQGMYYTYFVSVITTIEKLFQVQSKTT  113
             D  CG        +Q F     F+  + I      M +TYF   ITT+EK F + +K +
Sbjct  31   SDTTCGFSIFRGPALQRFATAHMFVIVYGIASCFLAMAFTYFTGTITTMEKRFNIPTKIS  90

Query  114  GIIMSATEIGQIGSSLLLTYYGGQGHRPRWIAWGMVLFAASSFICALPHFIFGDQPLNKQ  173
            G+I    +I  + SS  L+YY  +GHRPRW+A G+++ A    +   PH  +G     ++
Sbjct  91   GLITVGNDISTVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTPHIFYGP---GEE  147

Query  174  NLIFQGDNGTIDLPPNLCYIPPSLTLSGNITMHDTSLDQCHKEKWDEQQAQSQITTIVLV  233
             L    + G          +  S   S NIT  + SL  CH++  +  +     T IVL 
Sbjct  148  ALRLTEEYG----------MSESFGASLNITEKNDSL--CHEKNSNCLERAGDYTPIVL-  194

Query  234  IFFISLLGVGMGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTR  293
             FFI+    G+G +  Y  G+ Y+DDN A+ ++P   + +  +R+LGP++GF + S C R
Sbjct  195  -FFIAQFIGGIGCSLFYAPGLSYMDDNSASSKTPAMLSWSSFLRMLGPAMGFSMVSLCLR  253

Query  294  LYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVA  353
            LY+D      IT +DPRW+GAWW+G +L+   L ++AV + MFPK + +A          
Sbjct  254  LYIDPFKKPLITTNDPRWMGAWWIGWILLTFILTISAVFVGMFPKEMPRAKARR------  307

Query  354  TLPTKKESNQKNP----SLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYF  409
                K +  +  P    S +D   ++KRL  N + +Y   +S+L++      + F PKY 
Sbjct  308  ---LKADGEEDIPLAGRSFQDMLDSLKRLASNKVYVYNMLASILYLFGYMPYWIFTPKYI  364

Query  410  ETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMG  469
            E Q+R  + T+ M +G   +     GI++SG  I K+KP+AR +AAW  +   L   GM 
Sbjct  365  EIQYRQSASTSTMATGTWALGFSAAGILISGYVISKYKPSARAMAAWNFVVDYLTVAGML  424

Query  470  ILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGC  529
                +GC   +      AN +S      + +  C C++  + P+C  +  T+ SACHAGC
Sbjct  425  CYVLVGCDESD-----RANSLSIVPTGDSCSASCVCEYVYYAPVCSPENITFISACHAGC  479

Query  530  QNISSID-GK--FSNCTCMSGM-----WGNGTILPDPLATTASLGPCENDCVSVKWYIIL  581
             + +  + GK  ++ C CM  +       N T L    +  A  G C  DC   K ++I 
Sbjct  480  TDKAINELGKTIYTGCRCMGNVSSIISLSNVTSLASQ-SQIAMDGACPVDC--NKQFLIF  536

Query  582  FS---FFVFIHSTSEVGSMLLILRCVDPSDKAMALGLIQFAIGLFGNVPCPIVYGAVVDS  638
             +   F  F+ +T    ++LL LRCV   DK  +LG       +   +P PIV+G ++DS
Sbjct  537  LAVMCFLKFVGATGRSSNLLLALRCVPSKDKTFSLGFGSMVYSVLAFIPSPIVFGWMLDS  596

Query  639  ACLVWESVCGEKGACNLYDTDVFRVFYHGTTGFILLLAFFVDTIVWYKAGSINFADEETN  698
             CLVW   C  KG C +YDT   R   +     ++ L  F +  VWY A  +   DE+  
Sbjct  597  YCLVWGKTCSSKGNCWIYDTKSLRYTMNLVCASLIFLGSFWNIGVWYHAKDMKVFDEDEK  656

Query  699  TPEDDEMQAMTEKIKPETCV  718
            T +  +   +  K KP   V
Sbjct  657  TVQAKQSDDIELKEKPNDVV  676


>Q9VK84_DROME unnamed protein product
Length=745

 Score = 338 bits (868),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 221/741 (30%), Positives = 344/741 (46%), Gaps = 106/741 (14%)

Query  58   CGLGPCTPNWMQVFTNKKAFLFTFCITWVLQGMYYTYFVSVITTIEKLFQVQSKTTGIIM  117
            CG+    P W+Q +   K F+  + +   +Q M Y YF+  +TT+EK F++ S+TTGII+
Sbjct  18   CGMANWHPPWLQKYATTKMFMGVYGLLGTIQAMSYMYFIVTLTTLEKRFKIPSQTTGIIL  77

Query  118  SATEIGQIGSSLLLTYYGGQGHRPRWIAWGMVLFAASSFICALPHFIFG------DQPLN  171
            S  EI QI  SL+L+Y GGQ +RPRWIAWG+V    S +I  LPHFI+G           
Sbjct  78   SGNEISQIMLSLILSYIGGQRNRPRWIAWGIVFCGLSCYILVLPHFIYGAGHEVLQFTKE  137

Query  172  KQNLIFQGDNGTIDLPPNLCYIPPSLTLSGNITMHDTSLDQCHKEKWDEQQAQSQITTIV  231
             Q+ +  G  G+     N+  +      +  +   D + D C              + + 
Sbjct  138  YQDSLLNGTTGSDHSFQNISSVK-----TERLCGVDKTEDDC----------DDLFSYVP  182

Query  232  LVIFFISLLGVGMGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFC  291
            LV+ F+S   +G+G T  Y+LG  Y+DDN     +PL  A+ + +R++GP +GF  G   
Sbjct  183  LVLIFLSQFVLGVGNTLYYSLGQTYLDDNTKKTNTPLMLAVAMALRMIGPVVGFFFGFIS  242

Query  292  TRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTK--ASPVNGT  349
               ++D +    I   DPRW+GAWWLG V++   + L +  + +FPK L K  AS  N  
Sbjct  243  LNTFIDPTKTPLIDSKDPRWLGAWWLGWVILGTLMCLFSGLIGLFPKQLPKVNASRTNSH  302

Query  350  TTVATLPTKKE---------------------------SNQKNPSLKDFPKAVKRLLKND  382
              +A   TK+E                           +N   P LKDFP+A+ RLL+N 
Sbjct  303  LPLALRQTKEELKREENLSLSSRFSSNAALDTIGAAAGANADLPKLKDFPRALMRLLRNK  362

Query  383  ILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVF  442
            +L++   S+V +IL  +G  TFL KY E QF   + +A ++ G   I+ M +G+I SG+ 
Sbjct  363  LLIFNILSAVFYILGASGFMTFLTKYMEVQFHKDAQSATIIVGPISIMGMVVGLIGSGMV  422

Query  443  ILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHG  502
            + K KP+   V  W  I   +  LG     F+ CP      +T A G  +    C     
Sbjct  423  LSKKKPSVSKVLMWNVIVGGISILGQISYAFLYCP--NTFSMTQA-GQLNLTSNC--NMN  477

Query  503  CECDHSKFNPICGG-DGRTYFSACHAGCQNISSIDGKFSNCTCM----------------  545
            C C+   + P+C      T+FSACHAGC+  ++    + +C+C+                
Sbjct  478  CSCEGISYTPVCHEPTDTTFFSACHAGCRGYNATSKLYEDCSCVVNDPAPKSAAQRLLNL  537

Query  546  ---------------------------SGMWGNGTILPDPLATTASL---GPCENDCVSV  575
                                       +G + +  +     +T+ S+   G C  +C   
Sbjct  538  LQPTPEPELDTTTYFDEYLSGVPLLDDNGDFDDQLLSRTRRSTSDSVIRPGICTKNCNWS  597

Query  576  KWYIILFSFFV-FIHSTSEVGSMLLILRCVDPSDKAMALGLIQFAIGLFGNVPCPIVYGA  634
             W   + S  V +  S+  VG++L+  R V   DK+ A GL    I L   +P PI++G 
Sbjct  598  FWAFSITSMIVSWFGSSGRVGNVLVNYRAVAHEDKSFAQGLALMMISLLALIPGPIIFGR  657

Query  635  VVDSACLVWESVCGEKGACNLYDTDVFRVFYHGTTGFILLLAFFVDTIVWYKAGSIN-FA  693
            ++DS CLVW   C   G C LYD   FR   +  +  +  +    D +VWY   +++ + 
Sbjct  658  LIDSTCLVWTKTCNGNGNCQLYDQTRFRYSLNFLSCLLTFMGLLFDYLVWYYGRNLDIYG  717

Query  694  DEETNTPEDDEMQAMTEKIKP  714
            D+E    E++      + I P
Sbjct  718  DKEAK--EEERANRKDQPITP  736



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02640.1.1 Unknown

Length=127
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TUB1_CAEEL  unnamed protein product                                   33.1    0.047
G5EG83_CAEEL  unnamed protein product                                 27.3    3.8  
Q8MQ04_CAEEL  unnamed protein product                                 27.3    3.9  


>TUB1_CAEEL unnamed protein product
Length=426

 Score = 33.1 bits (74),  Expect = 0.047, Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 41/92 (45%), Gaps = 9/92 (10%)

Query  24   PTSD-LCHNRNVSCSSQFAEFYEEELYELEDLCYMYQYENAKSGK-NVSSCLFSE-----  76
            PT D +   R  S   Q  +  +E L  + D  Y     NAK  K N++SC+ S+     
Sbjct  77   PTQDPIAQPRMQSMPRQQPQQVQESLISIGD--YPDNDINAKLSKVNLTSCVVSDDEDED  134

Query  77   CRNYKSKPWNRDNITYHLAAHKLSTYLFVDKN  108
             R+Y   PWN D +   + +  L  Y F+  N
Sbjct  135  KRSYADSPWNTDVVADRIPSEVLPDYNFIKNN  166


>G5EG83_CAEEL unnamed protein product
Length=775

 Score = 27.3 bits (59),  Expect = 3.8, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 0/35 (0%)

Query  45   EEELYELEDLCYMYQYENAKSGKNVSSCLFSECRN  79
            +EE+ +L   C  Y+ ENA   + ++SC   E  N
Sbjct  537  DEEIKKLRGFCSRYKRENASMKERIASCEQGEQEN  571


>Q8MQ04_CAEEL unnamed protein product
Length=777

 Score = 27.3 bits (59),  Expect = 3.9, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 0/35 (0%)

Query  45   EEELYELEDLCYMYQYENAKSGKNVSSCLFSECRN  79
            +EE+ +L   C  Y+ ENA   + ++SC   E  N
Sbjct  539  DEEIKKLRGFCSRYKRENASMKERIASCEQGEQEN  573



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02650.1.1 major

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01768_CAEEL  unnamed protein product                                 31.2    0.92 
Q19350_CAEEL  unnamed protein product                                 30.0    2.3  
Q8I0B7_DROME  unnamed protein product                                 29.3    2.9  


>O01768_CAEEL unnamed protein product
Length=4858

 Score = 31.2 bits (69),  Expect = 0.92, Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  27    VWFSSFVKQRVLDTIDNHHLNSLILDTHSDVLYISDAGDCSI  68
             V+FS F + +++   D H L  L +D  S+ LY SD+ D  I
Sbjct  2471  VYFSGFKRDQIVQE-DLHDLRGLTIDLDSEKLYFSDSKDFKI  2511


>Q19350_CAEEL unnamed protein product
Length=1722

 Score = 30.0 bits (66),  Expect = 2.3, Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 3/38 (8%)

Query  99    NGHLYMTSYDSDMLFTLSARDIQKRLSAASNMSSLTLQ  136
             NGH++  + D     TLSA   +KRL+ A+N  S T+Q
Sbjct  1040  NGHIFTLTIDKS---TLSAYLFKKRLALATNSGSGTIQ  1074


>Q8I0B7_DROME unnamed protein product
Length=563

 Score = 29.3 bits (64),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query  18   CPAKIIQYDVWFSSFVKQRVLDTIDNHHLNSLILDTHSDVLYISDAGDCSILVMKPTDLE  77
            CP + + YD  FS  V  +    I+N  L   I    S   ++ DA    + V KP D E
Sbjct  112  CPLRNL-YDPLFSEIVA-KAEGAIENGVLPERIYQGSSGSYFVKDASHQCLAVFKPKDEE  169

Query  78   -YTRCYARYNEYI  89
             Y R   ++ +++
Sbjct  170  PYGRLNPKWTKWM  182



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02660.1.1 Ubiquitin

Length=389
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDD8_DROME  unnamed protein product                                 118     9e-29
Q8MQX4_DROME  unnamed protein product                                 118     1e-28
H1UUC2_DROME  unnamed protein product                                 114     2e-28


>Q9VDD8_DROME unnamed protein product
Length=896

 Score = 118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886


>Q8MQX4_DROME unnamed protein product
Length=896

 Score = 118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 90/170 (53%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WKCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  212  LNQCMDMYFSGERI---HGWNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  267

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  268  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  308

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  309  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  357



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02670.1.1 Ubiquitin

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H1UUC2_DROME  unnamed protein product                                 115     1e-29
Q9VDD8_DROME  unnamed protein product                                 117     2e-29
Q8MQX4_DROME  unnamed protein product                                 117     3e-29


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  212  LNQCMDMYFSGERI---HGWNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  267

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  268  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  308

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  309  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  357


>Q9VDD8_DROME unnamed protein product
Length=896

 Score = 117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W+CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886


>Q8MQX4_DROME unnamed protein product
Length=896

 Score = 117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 90/170 (53%), Gaps = 24/170 (14%)

Query  63   LEECFELYTKAEVLGADDAWHCPHCNLKQEVIKKLGLWTLPDILVVHLKRFRQTSSSKQQ  122
            L +C ++Y   E +     W CP C  K++ IKKL +  LP +LVVHLKRF    S+   
Sbjct  741  LNQCMDMYFSGERIHG---WKCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSG-  796

Query  123  VVRSPVKITTIVDFPLYGLDMSKYAGAGSNHANTPPWSPWRRNHLDTNLHLYTYDLYAIC  182
               S +K    + FPL  LDM+ Y     + A TP                 TY LYA+ 
Sbjct  797  ---SYMKKQNYLRFPLENLDMNPYIARAESRAVTPK----------------TYQLYAVS  837

Query  183  NHHGQHLQGGHYTAYCRNPYDSQWYSFDDAKVTPLIESELLTPGAYILFY  232
            NH+G  ++GGHYTA+C++    +W+ FDD  V+ L  S +++  AYILFY
Sbjct  838  NHYGT-MEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY  886



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02680.1.1 Ubiquitin

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H1UUC2_DROME  unnamed protein product                                 119     2e-29
UBPH_CAEEL  unnamed protein product                                   123     2e-29
Q8MQX4_DROME  unnamed protein product                                 121     9e-29


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 106/192 (55%), Gaps = 19/192 (10%)

Query  153  GVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQ  212
            G+ GL+N GNTC++N+ILQCLS+T  L EY + D+YK  +SR NK       T G+V E+
Sbjct  32   GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNK-------TNGQVIEE  84

Query  213  LAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATK  272
            +A L+K +W+  Y    S   + ++ +Y   +RG +Q D+ EFL  L+D +H DL T   
Sbjct  85   VAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTL--  142

Query  273  KKYKTIKNSFGRPDEVVAAETMA--NHVRCNNSFVHSVFQAQFRSSLTCPRCQRQSNTFD  330
                       R  E+++A   A     +   S +  +F  Q +S++ C  C ++S T++
Sbjct  143  --------HVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYE  194

Query  331  PFLCVSVPVPRN  342
             F  +S+ +P N
Sbjct  195  SFSNLSLELPPN  206


>UBPH_CAEEL unnamed protein product
Length=1178

 Score = 123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 98/381 (26%), Positives = 164/381 (43%), Gaps = 51/381 (13%)

Query  152  PGVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTE  211
            PG +GL N+GN C+ NA +QCL+    L +YF LD+  +D  +R      + G   E T 
Sbjct  567  PGAVGLVNYGNFCYRNAGIQCLARVSPLTQYF-LDEDNLDAIKRGNL---RRGDAAETTI  622

Query  212  QLAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTAT  271
            + A LL+ +W+        N F   I      +  + QHD QEF+ +LLD++H  +  + 
Sbjct  623  EYAKLLREMWAAKKKNIAPNDFNDAIRLSSDMFECSEQHDCQEFVAFLLDQLHTSMYESN  682

Query  272  KKKYKTIKNSFGRPDEVVA------------------AETMANHVRCNNSFVHSVFQAQF  313
            K  + + + S G     ++                    +   + + N S V  +F  Q 
Sbjct  683  KSLHPSPEESEGTDSNKLSDSSKKKEADKEEADEEKAERSWTEYEKQNESLVTQLFTGQL  742

Query  314  RSSLTCPRCQRQSNTFDPFLCVSVPVPRNQFQPLYVTILY-TSQSPRQVRLGISLPLNSD  372
            RS L C  CQ  S+ F+PF  +S+P+         V +++   + PR  R G  L  +S 
Sbjct  743  RSRLICRTCQSSSSVFEPFTSLSLPIGFEDVDLYQVIVVHRDGRIPR--RYGFRLSRDSK  800

Query  373  VRELRETLAQDAGVSEHHMLITEITDLGFQRTFSDTTSISVMRESDP---------IYCI  423
            V  LRE +A  +G+S  H+ I  ++  G   + S     S +R+  P         +Y +
Sbjct  801  VGNLREVVAVSSGISMSHLTIQCMSSKGTLMSRSPNHRSSNLRDELPLSSFPSGARLYAL  860

Query  424  ELPQLKDSSQ------------ESTYILLTWVNVLLVEDHCSRFGSPFSMQVGRDTGYAD  471
            ELP+     Q               YIL +    ++     SRFG P  + +  +     
Sbjct  861  ELPESTGEDQWRVAMHRKLQYNHEPYILGSTAGFIV-----SRFGLPLIVGLDEEVTGKK  915

Query  472  LQKLLLKEMAFILHDDVLTSA  492
            L + ++ +M   +   V +S+
Sbjct  916  LYEDVMYQMHRFMEHSVNSSS  936


>Q8MQX4_DROME unnamed protein product
Length=896

 Score = 121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 106/192 (55%), Gaps = 19/192 (10%)

Query  153  GVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQ  212
            G+ GL+N GNTC++N+ILQCLS+T  L EY + D+YK  +SR NK       T G+V E+
Sbjct  561  GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNK-------TNGQVIEE  613

Query  213  LAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATK  272
            +A L+K +W+  Y    S   + ++ +Y   +RG +Q D+ EFL  L+D +H DL T   
Sbjct  614  VAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTL--  671

Query  273  KKYKTIKNSFGRPDEVVAAETMA--NHVRCNNSFVHSVFQAQFRSSLTCPRCQRQSNTFD  330
                       R  E+++A   A     +   S +  +F  Q +S++ C  C ++S T++
Sbjct  672  --------HVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYE  723

Query  331  PFLCVSVPVPRN  342
             F  +S+ +P N
Sbjct  724  SFSNLSLELPPN  735



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02690.1.1 Unknown

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A5PEX5_CAEEL  unnamed protein product                                 27.7    4.9  
Q57ZG1_TRYB2  unnamed protein product                                 27.7    6.2  


>A5PEX5_CAEEL unnamed protein product
Length=209

 Score = 27.7 bits (60),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 10/52 (19%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  17   PKFVNIILHQEIKHKYNNLDKVEKCLLLTQVELMSKCHPVEFDMKDSAIRSI  68
            P +++ I+   +  ++  L + ++ + +  V + ++CH    D+  SA+ S+
Sbjct  115  PIYISRIIPGGVADRHGGLKRGDQLIAVNGVNVEAECHEKAVDLLKSAVGSV  166


>Q57ZG1_TRYB2 unnamed protein product
Length=2068

 Score = 27.7 bits (60),  Expect = 6.2, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 4/37 (11%)

Query  6    HRLPKQHSNLIPK---FVNIILHQEIKHKYNN-LDKV  38
            H LP+ H NLIP     V + L  E++  YN  LD V
Sbjct  617  HLLPQLHHNLIPAARVLVRLGLQDELRQLYNGVLDNV  653



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02700.1.1 Vacuolar

Length=229
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VR38_DROME  unnamed protein product                                 176     3e-52
Q8MRZ0_DROME  unnamed protein product                                 175     1e-51
Q9BI89_CAEEL  unnamed protein product                                 62.8    3e-11


>Q9VR38_DROME unnamed protein product
Length=528

 Score = 176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 136/254 (54%), Gaps = 56/254 (22%)

Query  1    MKKYNLRPMDIHLILNL--------------------FDASGYLYSHVSYLADDCAACLL  40
            MKKY++ P D+ LI NL                    FD +GYL++HVSYLADDC ACLL
Sbjct  305  MKKYSIHPADLRLIFNLVECSESFKSSENWSPICLPKFDMNGYLHAHVSYLADDCQACLL  364

Query  41   MLTVDKNLFFTLSEAKQVITEKLRRAKLLDEINTALSS--SHSLLTSSLNITSLRHFVYK  98
            +L+VD++ FFTL+EAK  ITEKLR++  L+ IN  L    +  L    + I  LRHF+YK
Sbjct  365  LLSVDRDAFFTLAEAKAKITEKLRKSHCLEAINEELQQPFNAKLYQQVVGIPELRHFLYK  424

Query  99   CKQTSQLICPQYEAPYVANSNFGSASIQSSVASSPSWMPSASIVARCDRTVLEYYSHLYC  158
             K T+QL+CP    PY +                               T LE    +YC
Sbjct  425  PKSTAQLLCPMLRHPYKS------------------------------LTELERLEAIYC  454

Query  159  D----IHRQSRHLKLYFQSRDTETLLGWTTAGFELYLIFEPLITKPSATNAVNKLLRWIK  214
            D    IH  SR LKL ++ ++ E +L W T  +ELY IFEP++ K +    V+KL++WI+
Sbjct  455  DLLHRIHNSSRPLKLIYEMKEREVVLAWATGTYELYAIFEPVVDKATVIKYVDKLIKWIE  514

Query  215  KEEDKMFMLNNYTL  228
            KE D  F+ N+ T 
Sbjct  515  KEYDVYFIRNHATF  528


>Q8MRZ0_DROME unnamed protein product
Length=528

 Score = 175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 135/254 (53%), Gaps = 56/254 (22%)

Query  1    MKKYNLRPMDIHLILNL--------------------FDASGYLYSHVSYLADDCAACLL  40
            MKKY++ P D+ LI NL                    FD +GYL++HVSYLADDC ACLL
Sbjct  305  MKKYSIHPADLRLIFNLVECSESFKSSENWSPICLPKFDMNGYLHAHVSYLADDCQACLL  364

Query  41   MLTVDKNLFFTLSEAKQVITEKLRRAKLLDEINTALSS--SHSLLTSSLNITSLRHFVYK  98
            +L+VD++ FFTL+EAK  ITEKLR++  L+ IN  L    +  L    + I  LRHF+YK
Sbjct  365  LLSVDRDAFFTLAEAKAKITEKLRKSHCLEAINEELQQPFNAKLYQQVVGIPELRHFLYK  424

Query  99   CKQTSQLICPQYEAPYVANSNFGSASIQSSVASSPSWMPSASIVARCDRTVLEYYSHLYC  158
             K T+QL+CP    PY +                               T LE    +YC
Sbjct  425  PKSTAQLLCPMLRHPYKS------------------------------LTELERLEAIYC  454

Query  159  D----IHRQSRHLKLYFQSRDTETLLGWTTAGFELYLIFEPLITKPSATNAVNKLLRWIK  214
            D    IH  SR LKL ++ ++ E +L W T  +ELY IFEP++ K +    V KL++WI+
Sbjct  455  DLLHRIHNSSRPLKLIYEMKEREVVLAWATGTYELYAIFEPVVDKATVIKYVVKLIKWIE  514

Query  215  KEEDKMFMLNNYTL  228
            KE D  F+ N+ T 
Sbjct  515  KEYDVYFIRNHATF  528


>Q9BI89_CAEEL unnamed protein product
Length=459

 Score = 62.8 bits (151),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/251 (24%), Positives = 101/251 (40%), Gaps = 54/251 (22%)

Query  2    KKYNLRPMDIHLILNL--------------------FDASGYLYSHVSY----LADDCAA  37
            KKY + P D+++++NL                    F+ +G+ Y+++SY       D   
Sbjct  233  KKYMIHPRDLNIVINLVSDNTLQTDSQNWVPICLPRFNDTGFFYAYISYPWCNKEQDIPV  292

Query  38   CLLMLTVDKNLFFTLSEAKQVITEKLRR-AKLLDEINTALSSSHSLLTSSL--NITSLRH  94
            C+++L+V ++ F  L E +Q I  KL    K       A+ + +    S +  N  SL  
Sbjct  293  CIVLLSVKRDHFDGLKEVRQQIVTKLENNQKFFVNFAQAMKTPNLYQISQIGSNSESLWS  352

Query  95   FVYKCKQTSQLICPQYEAPYVANSNFGSASIQSSVASSPSWMPSASIVARCDRTVLEYYS  154
            F+Y    +S+ +C                        S S +P   ++ R +R +     
Sbjct  353  FLY-LNHSSKQVC-----------------------MSASKIP---LITRDERWIARSEM  385

Query  155  HLYCDIHRQSRHLKLYFQSRDTETLLGWTTAGFELYLIFEPLITKPSATNAVNKLLRWIK  214
                 +     HL+  F       L  W T  F LY IF P +T   A   V KLL+ +K
Sbjct  386  RRSSSLSSLHPHLRTLFVRGTKHCLFVWVTDLFSLYCIFGPFVTATIAFQVVEKLLKSLK  445

Query  215  KEEDKMFMLNN  225
              E + F++N+
Sbjct  446  SHEQRYFIINS  456



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02710.1.1 Coiled-coil

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UZ3_TRYB2  unnamed protein product                                 32.7    0.68 


>Q57UZ3_TRYB2 unnamed protein product
Length=483

 Score = 32.7 bits (73),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 99/414 (24%), Positives = 213/414 (51%), Gaps = 14/414 (3%)

Query  94   RARESEARKQSLEQCARRCKTAGTGRDKIQMAEEFQRDNLLISRAIELQREREDEMKLCN  153
            R+ E+E  K+ ++Q     +  G     ++  EE Q+  L + RA  L  E+ DE+K  N
Sbjct  70   RSVEAEEHKRRMQQYDEEQRLCGGNDKPLEQIEEEQQRRLNLERAKTLLDEQYDEVKAMN  129

Query  154  SLLLMSKCQTIRDAQVAEKTLIAKELKAVELDLDRIMEEDRMKAIEEQDKLREQEEIKKK  213
             ++  ++C  +R+AQ+ E+ L  +E    E  ++ +M  +  KA +  ++  EQ+ + +K
Sbjct  130  QIVDEARCIAVRNAQIRERELRKEEEMEYERKMEEMMTAEAEKAAKLYNEREEQQVVARK  189

Query  214  LQFQSLTKQIQLN--KDLREMAVYALEKE--TRRLRQVEENRQKELENKKKLKLMEQEKR  269
                 +  Q++ +  + +R++ +   E+E  TR L  + E  Q E       KL +QEK 
Sbjct  190  KTLAVIKAQLEQHDVERVRKLELLQHEREAMTRHLELLREEAQAE-------KLQQQEKE  242

Query  270  KREIEE---TNQALRKLKEEQKEQKMLMNLKIQNILKEKIEAEEQQEREKKQIQLLRDKE  326
            +R +E     N     LK+ Q+E     + +I   +K K E +     E+++I+  +++E
Sbjct  243  RRIMEAVALANAQQISLKKRQQELDEEEDRRIAEFIKRKQERDRLYAEEQQRIRDEKERE  302

Query  327  FARLERERKRNDVMAELQYDMKCRQVQEECDREWRRRELEEQRKRKQMMEELVLCRKQQE  386
             ARL  E++R      L  D++ ++ QEE  R+ RR+E E + +   ++++L   R++Q 
Sbjct  303  VARLRAEQQRAQNTQALLDDIRAQRAQEEYARDMRRKEKERKEREAAVLQDLAQMREKQI  362

Query  387  AYRRQYQAVEQEKCDAMNTLLERQREADVEKEREKQRQAKQRTLEYGQHLQKLMEEKQAQ  446
              R++ +A E+   +     +   ++  +E+ERE++  A+++  E    + K + + + +
Sbjct  363  EERKRMKAEERRLEEEEVERINAVQKVALEQERERKMWARKQHEENSLAVLKQIMDVEER  422

Query  447  KKKLHESRVQDGRRLRQEQQNRIDGLKSSIGRKIIQVRNQKVPEKYLKEVEKQL  500
            +++  +  V +G  +  + + R   +++   RK+ ++    VPE+Y + ++K++
Sbjct  423  RRRERQEYVAEGNSIMMQIREREAAIEAIRQRKLKELEELGVPEEYCQALQKKM  476



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02720.1.1 protein

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EF89_CAEEL  unnamed protein product                                 27.3    7.4  
G5EGA4_CAEEL  unnamed protein product                                 27.3    7.6  
G5EDV5_CAEEL  unnamed protein product                                 27.3    8.3  


>G5EF89_CAEEL unnamed protein product
Length=1138

 Score = 27.3 bits (59),  Expect = 7.4, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 6/43 (14%)

Query  84   GPNGPGSNQGPPGMCGPSGPGSNQGPPGSSPMMCGPGPNSNQG  126
            GP GP  N G PG  G  G    +G  G+      PG + ++G
Sbjct  673  GPQGPSGNDGIPGSHGAPGHQGERGADGA------PGLHGSRG  709


>G5EGA4_CAEEL unnamed protein product
Length=1175

 Score = 27.3 bits (59),  Expect = 7.6, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 6/43 (14%)

Query  84   GPNGPGSNQGPPGMCGPSGPGSNQGPPGSSPMMCGPGPNSNQG  126
            GP GP  N G PG  G  G    +G  G+      PG + ++G
Sbjct  710  GPQGPSGNDGIPGSHGAPGHQGERGADGA------PGLHGSRG  746


>G5EDV5_CAEEL unnamed protein product
Length=778

 Score = 27.3 bits (59),  Expect = 8.3, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 6/43 (14%)

Query  84   GPNGPGSNQGPPGMCGPSGPGSNQGPPGSSPMMCGPGPNSNQG  126
            GP GP  N G PG  G  G    +G  G+      PG + ++G
Sbjct  313  GPQGPSGNDGIPGSHGAPGHQGERGADGA------PGLHGSRG  349



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02730.1.1 Transposon

Length=116
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATG2_CAEEL  unnamed protein product                                   27.7    3.0  
G5EC65_CAEEL  unnamed protein product                                 26.6    5.6  
G5EDF4_CAEEL  unnamed protein product                                 26.6    5.6  


>ATG2_CAEEL unnamed protein product
Length=2290

 Score = 27.7 bits (60),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  7     KIDPDRIEAIQKLVPPKNIKELQSMLGMVNYVRDFVPNMAEMT  49
             K D + ++ +Q+ V   ++     ++GM   V  FV ++AEMT
Sbjct  2126  KDDGNVMKGVQRGVGSFSVSSAAGIVGMAQTVTGFVQSLAEMT  2168


>G5EC65_CAEEL unnamed protein product
Length=1119

 Score = 26.6 bits (57),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 6/29 (21%)

Query  14   EAIQKLVPPKNIKELQSMLGMVNYVRDFV  42
            EAI KLV      +++  L M+NY RDFV
Sbjct  558  EAIMKLV------KIKGQLDMINYSRDFV  580


>G5EDF4_CAEEL unnamed protein product
Length=1161

 Score = 26.6 bits (57),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 6/29 (21%)

Query  14   EAIQKLVPPKNIKELQSMLGMVNYVRDFV  42
            EAI KLV      +++  L M+NY RDFV
Sbjct  600  EAIMKLV------KIKGQLDMINYSRDFV  622



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02740.1.1 RING/U-box

Length=285
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHI7_DROME  unnamed protein product                                 166     6e-49
Q54VX1_DICDI  unnamed protein product                                 77.0    1e-15
Q8T089_DROME  unnamed protein product                                 61.6    1e-10


>Q9VHI7_DROME unnamed protein product
Length=380

 Score = 166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 0/136 (0%)

Query  125  PLEHILSDLLVGIEATGFGEEGNSPLFFVGNPGDYAWGREGLDAIVTQLLNQMDGSGPPP  184
            PL    ++++ G    G G  GNS +FF+GNPGDYAWGREGLD IVTQ+LNQM+ SGPPP
Sbjct  169  PLAGATAEIVTGPGGGGVGGGGNSHMFFMGNPGDYAWGREGLDTIVTQMLNQMETSGPPP  228

Query  185  LSTDKIKQIPVAHITKAQIDSNLQCSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWLQLHG  244
            LS  +I +IP   I   +++  +QCS+CW+ F +DE VRKLPC H YH  CI PWL LH 
Sbjct  229  LSAQRINEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHS  288

Query  245  TCPICRQTLHSESAES  260
            TCPICR++L  +  ++
Sbjct  289  TCPICRKSLADDGNDA  304


 Score = 33.1 bits (74),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query  17  ESSRYYCHTCEAEFDNVTRRNDEVLCQNCNNGFVEIL  53
           E+ R++CH C  E   +   N +  C  C NGFVE L
Sbjct  13  EAKRFFCHMCNVE---INIPNSDFTCPLCANGFVEEL  46


>Q54VX1_DICDI unnamed protein product
Length=457

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 1/102 (1%)

Query  155  NPGDYAWGREGLDAIVTQLLNQMDGSGPPPLSTDKIKQIPVAHITKAQIDSNLQCSVCWE  214
            NP DY  G +     + ++       G PP S ++I+++    + +  +D  + C+VC +
Sbjct  303  NPNDYFQGGD-WQGFLNRMFQASKKKGTPPASKEEIEKLKRDRVDQTIVDQKVDCAVCKD  361

Query  215  QFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICRQTLHSE  256
            +F   +   +LPC H YH  CI PWL+ H +CP+CR  L ++
Sbjct  362  EFKWGDDYIELPCQHLYHPECILPWLEQHNSCPVCRFELKTD  403


>Q8T089_DROME unnamed protein product
Length=352

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 2/74 (3%)

Query  185  LSTDKIKQIPVAHITKAQIDSNLQ-CSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWL-QL  242
            L    +K++PV   TK   ++    C +C E F  D+ +R LPC H YHT CI+PWL + 
Sbjct  26   LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTEN  85

Query  243  HGTCPICRQTLHSE  256
               CPIC++ + ++
Sbjct  86   RRVCPICKRKVFTK  99



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02750.1.1 RING/U-box

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHI7_DROME  unnamed protein product                                 167     1e-48
Q54VX1_DICDI  unnamed protein product                                 77.8    1e-15
Q8T089_DROME  unnamed protein product                                 62.4    1e-10


>Q9VHI7_DROME unnamed protein product
Length=380

 Score = 167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 97/148 (66%), Gaps = 13/148 (9%)

Query  126  LEHILSDLLVGIEATGFGEE-------------GNSPLFFVGNPGDYAWGREGLDAIVTQ  172
            L+++L D L  +   G   E             GNS +FF+GNPGDYAWGREGLD IVTQ
Sbjct  157  LDNVLFDFLQSLPLAGATAEIVTGPGGGGVGGGGNSHMFFMGNPGDYAWGREGLDTIVTQ  216

Query  173  LLNQMDGSGPPPLSTDKIKQIPVAHITKAQIDSNLQCSVCWEQFTLDEAVRKLPCDHFYH  232
            +LNQM+ SGPPPLS  +I +IP   I   +++  +QCS+CW+ F +DE VRKLPC H YH
Sbjct  217  MLNQMETSGPPPLSAQRINEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYH  276

Query  233  TPCIEPWLQLHGTCPICRQTLHSESAES  260
              CI PWL LH TCPICR++L  +  ++
Sbjct  277  ENCIVPWLNLHSTCPICRKSLADDGNDA  304


 Score = 33.9 bits (76),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query  17  ESSRYYCHTCEAEFDNVTRRNDEVLCQNCNNGFVEIL  53
           E+ R++CH C  E   +   N +  C  C NGFVE L
Sbjct  13  EAKRFFCHMCNVE---INIPNSDFTCPLCANGFVEEL  46


>Q54VX1_DICDI unnamed protein product
Length=457

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 1/102 (1%)

Query  155  NPGDYAWGREGLDAIVTQLLNQMDGSGPPPLSTDKIKQIPVAHITKAQIDSNLQCSVCWE  214
            NP DY  G +     + ++       G PP S ++I+++    + +  +D  + C+VC +
Sbjct  303  NPNDYFQGGD-WQGFLNRMFQASKKKGTPPASKEEIEKLKRDRVDQTIVDQKVDCAVCKD  361

Query  215  QFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICRQTLHSE  256
            +F   +   +LPC H YH  CI PWL+ H +CP+CR  L ++
Sbjct  362  EFKWGDDYIELPCQHLYHPECILPWLEQHNSCPVCRFELKTD  403


>Q8T089_DROME unnamed protein product
Length=352

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 2/74 (3%)

Query  185  LSTDKIKQIPVAHITKAQIDSNLQ-CSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWL-QL  242
            L    +K++PV   TK   ++    C +C E F  D+ +R LPC H YHT CI+PWL + 
Sbjct  26   LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTEN  85

Query  243  HGTCPICRQTLHSE  256
               CPIC++ + ++
Sbjct  86   RRVCPICKRKVFTK  99



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02760.1.1 Mediator

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED31_DROME  unnamed protein product                                  195     3e-64
Q57VY5_TRYB2  unnamed protein product                                 32.0    0.15 
Q38FZ8_TRYB2  unnamed protein product                                 29.3    1.3  


>MED31_DROME unnamed protein product
Length=204

 Score = 195 bits (496),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 106/145 (73%), Gaps = 0/145 (0%)

Query  4    KGGPETEDQQRLRFQIELEFIQCLANPNYLNFLAQRGYLKDEAFVNYLKYLLYWKEPQYA  63
            K   E+E+ Q+ R+QIELEF+QCL+NPNYLNFLAQRG+ KD++F+NYLKYL YWKEP YA
Sbjct  9    KTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYA  68

Query  64   KYLKYPMCLYFLDLLQYEHFRREIVNSQCAKFIDDQQVLLWQHYTRKRTKLLNEAAQNNI  123
            KYL YPMCLYFLDLLQYEHFRREIVNSQC KFIDDQ +L WQHYTRKR KL+        
Sbjct  69   KYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQ  128

Query  124  SGVGRDSLQNNGNGANNGTTIKSES  148
                    Q   NG    T  +S +
Sbjct  129  QQQQLQQQQQQANGMEAATGGESAA  153


>Q57VY5_TRYB2 unnamed protein product
Length=749

 Score = 32.0 bits (71),  Expect = 0.15, Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 41/75 (55%), Gaps = 7/75 (9%)

Query  5    GGPETE-DQQRLRFQIELEFIQCLANPNYLNFLAQRGYLKDEAFVNYLKYLLYWKEPQYA  63
            G PE E +Q+R+ F  + +     AN N+L  L   G ++++  +  L++LLY  E +  
Sbjct  258  GLPEDEAEQRRMNFAAKQK-----ANINFLGLLFTHGLVREKVVLQILQWLLYGPETKRR  312

Query  64   KYLKYPMCLYFLDLL  78
                Y + ++F++LL
Sbjct  313  IPADYEI-IHFMNLL  326


>Q38FZ8_TRYB2 unnamed protein product
Length=817

 Score = 29.3 bits (64),  Expect = 1.3, Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 0/31 (0%)

Query  103  LWQHYTRKRTKLLNEAAQNNISGVGRDSLQN  133
            +WQH TR R+ L ++ A ++   +G D   N
Sbjct  766  VWQHLTRPRSTLSSDVAADSREPIGEDKRHN  796



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02770.1.1 DALR

Length=392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q18625_CAEEL  unnamed protein product                                 31.2    1.4  
L2CC_DROME  unnamed protein product                                   31.2    1.4  
Q95RB1_DROME  unnamed protein product                                 28.9    8.2  


>Q18625_CAEEL unnamed protein product
Length=283

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 0/43 (0%)

Query  231  ASVASSSRLSASGEISHNTKDAIFVVYNYVRLKTILNTYHSKV  273
            A VA  + L   GEI  NT+  + +  N+   K ILN+Y + V
Sbjct  38   AQVAEINLLQGGGEIGPNTQVILHLKLNFKEKKVILNSYENGV  80


>L2CC_DROME unnamed protein product
Length=276

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (49%), Gaps = 6/72 (8%)

Query  43   ISILKRPLNDCIENVDALIEESKSKWCLP------LKAVNISTDYIHLFFNKDIVFRKTL  96
            + IL RP+ D +  +  ++ +   +  LP      LKAV    D   L   +++V ++  
Sbjct  92   LRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVS  151

Query  97   QEVQNKNKSYGF  108
            QE+  + K +GF
Sbjct  152  QELTVRAKQFGF  163


>Q95RB1_DROME unnamed protein product
Length=418

 Score = 28.9 bits (63),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 29/59 (49%), Gaps = 8/59 (14%)

Query  192  PEEYFSLKSSEVNSMSNGMDSASSSEHLVDTSVKFNLFHASV-------ASSSRLSASG  243
            P +YF+L+  ++N M  GM       +LV  S  + ++           A+S+ LS+SG
Sbjct  331  PNDYFNLRQEQINVMPAGMKLHQLPSNLVPASA-YQMYGQPTYAAPYGNATSTALSSSG  388



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02780.1.1 Retrovirus-related

Length=137
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABCGM_DICDI  unnamed protein product                                  29.6    0.93 
PIPA_DROME  unnamed protein product                                   27.3    5.3  


>ABCGM_DICDI unnamed protein product
Length=615

 Score = 29.6 bits (65),  Expect = 0.93, Method: Composition-based stats.
 Identities = 23/80 (29%), Positives = 34/80 (43%), Gaps = 12/80 (15%)

Query  47   DTVTATLETMGGMGQERSKIDSRSQKCVLI--GYAQNGYRLFNLEKKKMMLSRDVV----  100
            D  T+ L+T   M   ++ ++   QK V +     Q    +F L  K M+L+   +    
Sbjct  202  DEPTSGLDTTSAMAVMKTLVELTQQKSVTVICTIHQPRSEIFKLFTKIMVLAEGRLVYYG  261

Query  101  ------FKENEFPFKDQYNP  114
                  F E  FPF DQ NP
Sbjct  262  NRPVEHFTEIGFPFPDQTNP  281


>PIPA_DROME unnamed protein product
Length=1095

 Score = 27.3 bits (59),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (51%), Gaps = 2/51 (4%)

Query  84   RLFNLEK--KKMMLSRDVVFKENEFPFKDQYNPEGNDDENIEDCNLDLIKG  132
            R F  EK  K+    RD +FK +E+ F   +  EG D + IE C +  I+ 
Sbjct  25   RWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRA  75



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02790.1.1 39S

Length=216
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57TS5_TRYB2  unnamed protein product                                 31.2    0.66 
CAN5_CAEEL  unnamed protein product                                   29.3    2.8  
Q57VB4_TRYB2  unnamed protein product                                 29.3    3.1  


>Q57TS5_TRYB2 unnamed protein product
Length=864

 Score = 31.2 bits (69),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 25/101 (25%), Positives = 47/101 (47%), Gaps = 6/101 (6%)

Query  107  QNTTVSYTRAYNAPIPHATPEKSDLSFHSVIELRGNPFPP-LVQRAVD---SRLLIQNVL  162
            +N  V  +R+       A  +++   F SV+EL  + FPP  + RA D       IQ V+
Sbjct  363  KNPCVDLSRSCVGVCVSAKGDRNIDLFWSVVELMTSAFPPKCMSRAADYTSHCCSIQGVV  422

Query  163  LDEAKKEYRAQKY--AEIAQDLESRANADSSAKSEKLAQNN  201
            L+ +K  +  + +   +  QD+  R +  S  +  +  +N+
Sbjct  423  LESSKHLFDEEGFRTKKGVQDIVKRKDMTSRKQQSRFERNS  463


>CAN5_CAEEL unnamed protein product
Length=648

 Score = 29.3 bits (64),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 24/40 (60%), Gaps = 1/40 (3%)

Query  83   DMADFWIEEKNIVHKLFKVLVPRFQNTTV-SYTRAYNAPI  121
            D  DFW+  ++ VH    + + +  NT+V S++R+Y+  I
Sbjct  329  DDGDFWMPWESFVHYFTDISLCQLFNTSVFSFSRSYDEQI  368


>Q57VB4_TRYB2 unnamed protein product
Length=1118

 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 20/39 (51%), Gaps = 0/39 (0%)

Query  171  RAQKYAEIAQDLESRANADSSAKSEKLAQNNSQTPSETT  209
            RA+K     +D+ SR  AD+     K   N +QTP  T+
Sbjct  475  RAEKLGSRLRDMSSRCCADAEVSLRKENGNGTQTPGSTS  513



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02800.1.1 conserved

Length=119
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GR59C_DROME  unnamed protein product                                  28.9    0.92 
Q57ZZ0_TRYB2  unnamed protein product                                 27.7    3.1  
Q580J9_TRYB2  unnamed protein product                                 26.9    4.6  


>GR59C_DROME unnamed protein product
Length=397

 Score = 28.9 bits (63),  Expect = 0.92, Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (55%), Gaps = 4/55 (7%)

Query  29   QKRTAIRWMNKILSLKSEDPQVKK----NRNCFLKYYLTLLKNTSEAVSEQSREK  79
            Q+   IR  N+IL+L  + PQV +     R+  LK+   +L ++   +S+ S ++
Sbjct  100  QRSRFIRIWNQILALVRDRPQVVRGRWYRRSIILKFVFCVLSDSLHTISDVSAQR  154


>Q57ZZ0_TRYB2 unnamed protein product
Length=2503

 Score = 27.7 bits (60),  Expect = 3.1, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 31/76 (41%), Gaps = 16/76 (21%)

Query  59   KYYLTLLKNTSEAVSEQSREKPLDIMSQWSLD--KKTYVAIKPL--------------PN  102
            K YL  +     +V +Q+ E    IMS+WSL   +K +  I P               P 
Sbjct  796  KTYLYPICEAHNSVLKQAAEACHQIMSKWSLPSRRKNFSLILPCINRLLDRTHETSTHPQ  855

Query  103  EGALIYMALIKGPIAL  118
            E  L  +  + GPI L
Sbjct  856  EQLLFLLGRLNGPIEL  871


>Q580J9_TRYB2 unnamed protein product
Length=608

 Score = 26.9 bits (58),  Expect = 4.6, Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 0/37 (0%)

Query  57   FLKYYLTLLKNTSEAVSEQSREKPLDIMSQWSLDKKT  93
            F KYY+ L +      S+ +R + L I  +W L + T
Sbjct  455  FFKYYMVLKRELQADASDYARAQWLSIALKWVLTQPT  491



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02810.1.1 Unknown

Length=161
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WDR59_DROME  unnamed protein product                                  29.6    1.2  


>WDR59_DROME unnamed protein product
Length=969

 Score = 29.6 bits (65),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/41 (37%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  79   HVNNIAILTELRSEINNKILLLDFHSRRNKRSLLPILGKGI  119
            H N I +LT     +NNK L L  H+    R+   I G G+
Sbjct  579  HFNAIGMLTTFAQPVNNKRLTLRQHTALTPRTFSSINGSGL  619



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02820.1.1 RNA-directed

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IIJ0_PLAF7  unnamed protein product                                 33.9    0.088
Q6NR50_DROME  unnamed protein product                                 32.7    0.23 
A0A0B4KH60_DROME  unnamed protein product                             32.7    0.24 


>Q8IIJ0_PLAF7 unnamed protein product
Length=1016

 Score = 33.9 bits (76),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 9/132 (7%)

Query  13   DTRYPKMCYEELKRIEYYEPLKKQHNWAAQIRQELLDVGKEELYNSVSTETVKQEIENIL  72
            D R  K+  E++ RI   E + +  N   ++ +  LD        S+S    K  ++++ 
Sbjct  47   DRRIIKLAEEDINRIAAGEVIIRPCNALKELVENSLDANSS----SISIHLNKGGLKSLQ  102

Query  73   QIHRQKNMEEDTRRITSSSYSTQYKNISNGPNIEKYLTFDLRTGVIRTVSH---LRVASD  129
             I     + ++  RI    ++T    ISN  +I    TF  R   + ++SH   L + S 
Sbjct  103  IIDDGDGIHKEDLRIVCERFTTS--KISNHKDIRNIKTFGFRGEALASISHVSYLTITSK  160

Query  130  ERIQIYTNNCSY  141
            +R   +   C+Y
Sbjct  161  KRNSPFCYTCNY  172


>Q6NR50_DROME unnamed protein product
Length=1186

 Score = 32.7 bits (73),  Expect = 0.23, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>A0A0B4KH60_DROME unnamed protein product
Length=1330

 Score = 32.7 bits (73),  Expect = 0.24, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02820.1.2 RNA-directed

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IIJ0_PLAF7  unnamed protein product                                 33.9    0.079
Q9VGI1_DROME  unnamed protein product                                 33.5    0.13 
Q6NR50_DROME  unnamed protein product                                 32.7    0.24 


>Q8IIJ0_PLAF7 unnamed protein product
Length=1016

 Score = 33.9 bits (76),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 9/132 (7%)

Query  13   DTRYPKMCYEELKRIEYYEPLKKQHNWAAQIRQELLDVGKEELYNSVSTETVKQEIENIL  72
            D R  K+  E++ RI   E + +  N   ++ +  LD        S+S    K  ++++ 
Sbjct  47   DRRIIKLAEEDINRIAAGEVIIRPCNALKELVENSLDANSS----SISIHLNKGGLKSLQ  102

Query  73   QIHRQKNMEEDTRRITSSSYSTQYKNISNGPNIEKYLTFDLRTGVIRTVSH---LRVASD  129
             I     + ++  RI    ++T    ISN  +I    TF  R   + ++SH   L + S 
Sbjct  103  IIDDGDGIHKEDLRIVCERFTTS--KISNHKDIRNIKTFGFRGEALASISHVSYLTITSK  160

Query  130  ERIQIYTNNCSY  141
            +R   +   C+Y
Sbjct  161  KRNSPFCYTCNY  172


>Q9VGI1_DROME unnamed protein product
Length=1354

 Score = 33.5 bits (75),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>Q6NR50_DROME unnamed protein product
Length=1186

 Score = 32.7 bits (73),  Expect = 0.24, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02820.1.3 RNA-directed

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IIJ0_PLAF7  unnamed protein product                                 33.9    0.079
Q9VGI1_DROME  unnamed protein product                                 33.5    0.13 
Q6NR50_DROME  unnamed protein product                                 32.7    0.24 


>Q8IIJ0_PLAF7 unnamed protein product
Length=1016

 Score = 33.9 bits (76),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 9/132 (7%)

Query  13   DTRYPKMCYEELKRIEYYEPLKKQHNWAAQIRQELLDVGKEELYNSVSTETVKQEIENIL  72
            D R  K+  E++ RI   E + +  N   ++ +  LD        S+S    K  ++++ 
Sbjct  47   DRRIIKLAEEDINRIAAGEVIIRPCNALKELVENSLDANSS----SISIHLNKGGLKSLQ  102

Query  73   QIHRQKNMEEDTRRITSSSYSTQYKNISNGPNIEKYLTFDLRTGVIRTVSH---LRVASD  129
             I     + ++  RI    ++T    ISN  +I    TF  R   + ++SH   L + S 
Sbjct  103  IIDDGDGIHKEDLRIVCERFTTS--KISNHKDIRNIKTFGFRGEALASISHVSYLTITSK  160

Query  130  ERIQIYTNNCSY  141
            +R   +   C+Y
Sbjct  161  KRNSPFCYTCNY  172


>Q9VGI1_DROME unnamed protein product
Length=1354

 Score = 33.5 bits (75),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534


>Q6NR50_DROME unnamed protein product
Length=1186

 Score = 32.7 bits (73),  Expect = 0.24, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 55/126 (44%), Gaps = 13/126 (10%)

Query  10   EMPDTRYPKMCYEELKRIEYYEPLKK-QHNWAAQIRQELLDVGKEELYNSVSTETVKQEI  68
            E P  R      + L   +  +P+KK  HN   Q+R +  D G      + STE    E 
Sbjct  415  ESPPLRAKPFLSKSLDGSKQAQPVKKFVHNVDEQLRHKNEDDG------ASSTEASPMES  468

Query  69   ENILQIHRQKNMEEDTRRITSSSYSTQYKNISNGPNI------EKYLTFDLRTGVIRTVS  122
            +  L +HRQ+  +++T  + S+    + K I N  +         Y T DL++ +   + 
Sbjct  469  KQSLMLHRQEEFDKETVPMGSAQGEFRSKFIINCESTVFEHTGVSYETGDLQSELSSGIQ  528

Query  123  HLRVAS  128
            H  VAS
Sbjct  529  HTSVAS  534



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02830.1.1 Ubiquitin

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKZ8_DROME  unnamed protein product                                 216     2e-66
Q583H3_TRYB2  unnamed protein product                                 163     2e-46
H1UUC2_DROME  unnamed protein product                                 59.7    9e-10


>Q9VKZ8_DROME unnamed protein product
Length=475

 Score = 216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/329 (35%), Positives = 187/329 (57%), Gaps = 25/329 (8%)

Query  8    IKPGHLFMVIGAAGPLPSAPTEKVVFMEDLDDKQLSQALKNPVGLTNLGNTCYLNSSIQV  67
            IK G + +++G+   +P  P   V F+ED+++ + + A++ P GLTNLGNTCY+N+++Q 
Sbjct  62   IKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQC  121

Query  68   LRAIPELQSNLNNSQNNG---------LSRSLEALFSSLNNSTDAITPTSFLTTLRSNYQ  118
            L A+PEL++ L+   N+G         +S +++++F+ +   T  +TP   L  L     
Sbjct  122  LNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGT-TVTPIVLLQALHRASP  180

Query  119  QFTERDRFGQFAQQDAEEAWGAILSSL-----------AGTTGMEGKSFVDQYMRGSYVK  167
            QF +    G + QQDA E W  IL  L           + T      SF+DQ+  G++  
Sbjct  181  QFAQTGENGTYRQQDANECWAEILKMLQQKLRPKNQEPSNTVQKRHSSFIDQFFGGTFEV  240

Query  168  EMSTPEAPEEEPTYSIEEFTKLGCNISSNTNYLQQGLSEGLDEQIEKYSGTLNRNAQYVQ  227
            +MS+ E P+E  T + E F +L C IS +  Y+Q GL   + EQ+ K S TL R+A+Y++
Sbjct  241  KMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIR  300

Query  228  KSRINRLPSYLTVHLVRFYWRADLGKKAKILRKVKFPMEYDASELVSDDLKAKINPVNKK  287
               ++RLP+YLTV  VRF ++   G  AK+L+ +KFP+++DA EL + +L+ K+ P+  K
Sbjct  301  TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSK  360

Query  288  LYSINKDREERRRLRKRIKTRNDLEEKAN  316
                 KD E+++     +K     EEK +
Sbjct  361  F----KDLEDKKMEVDVVKRNEPNEEKKD  385


>Q583H3_TRYB2 unnamed protein product
Length=465

 Score = 163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 147/271 (54%), Gaps = 5/271 (2%)

Query  45   ALKNPVGLTNLGNTCYLNSSIQVLRAIPELQSNLNNSQNNGLSRSLEALFSSLNNSTDAI  104
            A K  VGL N+ NTCY+N+++Q+LR +PE++  LN + N+ +   L  L+++++   D +
Sbjct  102  AEKQAVGLQNIANTCYMNAAVQMLRLVPEVRDVLNFNANDPIVSELLKLYNTMDTKRDPV  161

Query  105  TPTSFLTTLRSNYQQFTERDRFGQFAQQDAEEAWGAILSSLAGTTGMEGKSFVDQYMRGS  164
             P S  + L +++  F E +  G   Q D++EA  A+L  +        K    +   G+
Sbjct  162  VPASLWSILLAHFPTFAEVNEKGHPMQHDSQEALNALLQRINSCLPESHK----RLFTGN  217

Query  165  YVKEMSTPEAPEEEPTYSIEEFTKLGCNISSNTNYLQQGLSEGLDEQIEKYSGTLNRNAQ  224
              ++M   + P+++P      F  L CNI +    L+ GL    +E ++ +S  L R A 
Sbjct  218  LSQKMVCKDDPDDQPVLHDVPFLMLSCNIDAEIETLEAGLEAAFNETVKLHSEKLAREAL  277

Query  225  YVQKSRINRLPSYLTVHLVRFYWRADLGKKAKILRKVKFPMEYDASELVSDDLKAKINPV  284
            + + SRI  +P YL +H+VRF WR+D+  KAKIL+ V FPM  D   L +++ K ++  V
Sbjct  278  HTRTSRIAAMPEYLFIHMVRFSWRSDIQSKAKILKPVTFPMTLDLHALCAEEYKPELE-V  336

Query  285  NKKLYSINKDREERRRLRKRIKTRNDLEEKA  315
             +K     +D E  RR   + KT+ D +E A
Sbjct  337  ERKRVLKRRDIEMERRRAAKNKTKLDDDEAA  367


>H1UUC2_DROME unnamed protein product
Length=367

 Score = 59.7 bits (143),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 131/325 (40%), Gaps = 62/325 (19%)

Query  13   LFMVIGAAGPLPSAPTEKVVFMEDLDDKQLSQALKNPVGLTNLGNTCYLNSSIQVLRAIP  72
            +  V G    LP+AP    ++      ++     +   GL NLGNTCY+NS +Q L   P
Sbjct  1    MICVAGVRLQLPTAPPTYSIYSSIFPLRRG----RGLTGLKNLGNTCYMNSILQCLSNTP  56

Query  73   EL-QSNLNNSQNNGLSRS----------LEALFSSLNNSTDAITPTSFLTTLRSNYQQFT  121
            +L +  +++   N +SRS          + AL   L N       +  L  +   YQ+  
Sbjct  57   QLTEYCISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKI-  115

Query  122  ERDRFGQFAQQDAEEAWGAILSSL---------------------AGTTGMEGK-SFVDQ  159
                F    QQD+ E    ++  L                     A     + K S +  
Sbjct  116  ----FRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILH  171

Query  160  YMRGSYVKEMSTPEAPEEEPTYSIEEFTKLGCNISSNTNYLQQGLSEGLD-----EQIEK  214
               G     +      +E  TY  E F+ L   +  N+N  Q  L++ +D     E+I  
Sbjct  172  LFYGQMKSTVKCVACHKESATY--ESFSNLSLELPPNSNVCQ--LNQCMDMYFSGERIHG  227

Query  215  Y---SGTLNRNAQYVQKSRINRLPSYLTVHLVRFYWRADLGKKAKILRK---VKFPME-Y  267
            +   S    R+A  ++K  I++LP  L VHL RFY  AD       ++K   ++FP+E  
Sbjct  228  WNCPSCKTKRDA--IKKLDISKLPPVLVVHLKRFY--ADPSNSGSYMKKQNYLRFPLENL  283

Query  268  DASELVSDDLKAKINPVNKKLYSIN  292
            D +  ++      + P   +LY+++
Sbjct  284  DMNPYIARAESRAVTPKTYQLYAVS  308



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02840.1.1 rRNA

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q585P9_TRYB2  unnamed protein product                                 110     2e-29
PPP6_DROME  unnamed protein product                                   81.3    9e-19
PPP6_CAEEL  unnamed protein product                                   76.3    9e-17


>Q585P9_TRYB2 unnamed protein product
Length=344

 Score = 110 bits (274),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 0/84 (0%)

Query  8    ELSKRFQGKVAILMFQREFALRLCARPGTEMWCRLSANAQLYSKIDHIMKVSKGNFRPPP  67
            +L KR   K A+LMFQREFALR+CA+PG+E +CRLS N+QL ++  H+MK+SK +F PPP
Sbjct  172  KLLKRPNFKCAVLMFQREFALRVCAQPGSEAYCRLSVNSQLLARCSHLMKISKNSFNPPP  231

Query  68   QVESSVVRIVPLDPPPPVKFEEFD  91
            +VESSV+R+ P  P P V FEE+D
Sbjct  232  KVESSVIRLDPKHPAPSVDFEEWD  255


>PPP6_DROME unnamed protein product
Length=303

 Score = 81.3 bits (199),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 50/64 (78%), Gaps = 0/64 (0%)

Query  93   DPQQWLDTILSGKYLAESQIKMLCDVVLGLLVEESNIQPVSSPVTVCGDIHGQFWDLLEL  152
            D  +W++ +   KYL E+++K LC++V  +L+EE+NI PVS+PVTVCGDIHGQF+DL +L
Sbjct  3    DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQL  62

Query  153  LRVG  156
             R G
Sbjct  63   FRTG  66


>PPP6_CAEEL unnamed protein product
Length=331

 Score = 76.3 bits (186),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 2/78 (3%)

Query  92   VDPQQWLDTILSGKYLAESQIKMLCDVVLGLLVEESNIQPVSSPVTVCGDIHGQFWDLLE  151
            ++P+QW+      KYL ES    LC  ++  L  E+N+ PVSSPVT+CGDIHGQF+DLLE
Sbjct  30   IEPEQWITWASECKYLPESDAVALCATLIDRLSLEANVVPVSSPVTICGDIHGQFYDLLE  89

Query  152  LLRVGECVNGLRP--MGD  167
            L + G  V   +   MGD
Sbjct  90   LFKTGGTVPNTKYVFMGD  107



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02850.1.1 Phosphatidyl-N-methylethanolamine

Length=203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7YU60_DROME  unnamed protein product                                 31.2    0.62 
Q23975_DROME  unnamed protein product                                 29.6    2.0  
A1Z7L9_DROME  unnamed protein product                                 29.6    2.1  


>Q7YU60_DROME unnamed protein product
Length=595

 Score = 31.2 bits (69),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 9/43 (21%)

Query  88   DYFGIL---MSHRVTSFPFNVVEDPMYIGSTL--CFFGTSIWY  125
            +Y G+L   + HR+TS+ F  +     +G+TL  CF GTS WY
Sbjct  200  NYSGVLPDYVPHRLTSWEFVAI----ILGATLFICFTGTSTWY  238


>Q23975_DROME unnamed protein product
Length=601

 Score = 29.6 bits (65),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 6/32 (19%)

Query  96   HRVTSFPFNVVEDPMYIGSTL--CFFGTSIWY  125
            HR+TS+ F  +     +G+TL  CF GTS WY
Sbjct  217  HRLTSWEFVAI----ILGATLFICFTGTSTWY  244


>A1Z7L9_DROME unnamed protein product
Length=601

 Score = 29.6 bits (65),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 6/32 (19%)

Query  96   HRVTSFPFNVVEDPMYIGSTL--CFFGTSIWY  125
            HR+TS+ F  +     +G+TL  CF GTS WY
Sbjct  217  HRLTSWEFVAI----ILGATLFICFTGTSTWY  244



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02860.1.1 Electron

Length=906
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ETFA_CAEEL  unnamed protein product                                   81.6    3e-16
Q7KLW5_DROME  unnamed protein product                                 77.0    9e-15
Q7KN94_DROME  unnamed protein product                                 76.6    1e-14


>ETFA_CAEEL unnamed protein product
Length=332

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 1/59 (2%)

Query  6    RPDLGSASRVISGGRALKSAENFNQIIEPLADKLGAAIGASRAAVDSGYADNSLQVGQT  64
            RPDL +A  V+SGGR LKS +NF ++I  LADKLGA +GASRAAVD+GY  N +QVGQT
Sbjct  210  RPDLATAKVVVSGGRGLKSGDNF-KLIYDLADKLGAGVGASRAAVDAGYVPNDMQVGQT  267


>Q7KLW5_DROME unnamed protein product
Length=340

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 1/64 (2%)

Query  1    MTVTARPDLGSASRVISGGRALKSAENFNQIIEPLADKLGAAIGASRAAVDSGYADNSLQ  60
            +T + RP+L  A  ++SGGR LKS +NF +++  LADK GAA+GASRAAVD+G+  N LQ
Sbjct  214  LTKSDRPELAGAKVIVSGGRGLKSGDNF-KLLYDLADKFGAAVGASRAAVDAGFVPNDLQ  272

Query  61   VGQT  64
            +GQT
Sbjct  273  IGQT  276


>Q7KN94_DROME unnamed protein product
Length=330

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 1/64 (2%)

Query  1    MTVTARPDLGSASRVISGGRALKSAENFNQIIEPLADKLGAAIGASRAAVDSGYADNSLQ  60
            +T + RP+L  A  ++SGGR LKS +NF +++  LADK GAA+GASRAAVD+G+  N LQ
Sbjct  204  LTKSDRPELAGAKVIVSGGRGLKSGDNF-KLLYDLADKFGAAVGASRAAVDAGFVPNDLQ  262

Query  61   VGQT  64
            +GQT
Sbjct  263  IGQT  266



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02870.1.1 Electron

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KN94_DROME  unnamed protein product                                 106     2e-27
Q7KLW5_DROME  unnamed protein product                                 106     2e-27
ETFA_CAEEL  unnamed protein product                                   96.7    9e-24


>Q7KN94_DROME unnamed protein product
Length=330

 Score = 106 bits (264),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query  10   FSATSRRTFSTS---RTKLDALVYLEHRDGKINPGSLSALTAAQKVDGKVVGLVAGSENV  66
            F++ +R    +S   R K   LV  EH +  +NP +L+ ++AA+K+ G V  LVAG++  
Sbjct  2    FASNTRNLMRSSILQRCK-STLVVAEHNNEVLNPITLNTISAAKKIGGDVTVLVAGTKCG  60

Query  67   DSVVEEAKKLPVNKLLLAKSDIYNHHSPSTLAPLLKSIVENDSAITHLFAVHSAVGKNVL  126
             +    +K   V K+L+A++  +N  +  +L PL+ +  ++    TH+ A  SA GKNVL
Sbjct  61   PASEALSKVDGVTKVLVAENAAFNGFTAESLTPLVLA-AQSQFKFTHILAGASAFGKNVL  119

Query  127  PRAAALLDTSIIADILNLENGGSEFTRGIYAGNAISTIKSDEPKKVVTVRGTAFDAAVAG  186
            PR AA LD S I++I+++++  + F R IYAGNAI T+KS +  KV+TVR T F  A   
Sbjct  120  PRVAAKLDVSPISEIIDVKSDDT-FVRTIYAGNAILTLKSKDAVKVITVRSTNFPPAATS  178

Query  187  SSEVAVEEIAAVD  199
                AVE+  A D
Sbjct  179  GGSGAVEQAPAGD  191


>Q7KLW5_DROME unnamed protein product
Length=340

 Score = 106 bits (264),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query  10   FSATSRRTFSTS---RTKLDALVYLEHRDGKINPGSLSALTAAQKVDGKVVGLVAGSENV  66
            F++ +R    +S   R K   LV  EH +  +NP +L+ ++AA+K+ G V  LVAG++  
Sbjct  12   FASNTRNLMRSSILQRCK-STLVVAEHNNEVLNPITLNTISAAKKIGGDVTVLVAGTKCG  70

Query  67   DSVVEEAKKLPVNKLLLAKSDIYNHHSPSTLAPLLKSIVENDSAITHLFAVHSAVGKNVL  126
             +    +K   V K+L+A++  +N  +  +L PL+ +  ++    TH+ A  SA GKNVL
Sbjct  71   PASEALSKVDGVTKVLVAENAAFNGFTAESLTPLVLA-AQSQFKFTHILAGASAFGKNVL  129

Query  127  PRAAALLDTSIIADILNLENGGSEFTRGIYAGNAISTIKSDEPKKVVTVRGTAFDAAVAG  186
            PR AA LD S I++I+++++  + F R IYAGNAI T+KS +  KV+TVR T F  A   
Sbjct  130  PRVAAKLDVSPISEIIDVKSDDT-FVRTIYAGNAILTLKSKDAVKVITVRSTNFPPAATS  188

Query  187  SSEVAVEEIAAVD  199
                AVE+  A D
Sbjct  189  GGSGAVEQAPAGD  201


>ETFA_CAEEL unnamed protein product
Length=332

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query  6    LRSAFSATSRRTFSTSRTKLDA-LVYLEHRDGKINPGSLSALTAAQKVDGKVVGLVAGSE  64
            + SA +  SR    ++ ++L++ LV  EH + K+ P +L+A+TAA K+  +V  LV G+ 
Sbjct  1    MLSARTVLSRAGLISNASRLNSTLVVAEHDETKLAPITLNAITAASKLGNEVSVLVTGA-  59

Query  65   NVDSVVEEAKKL-PVNKLLLAKSDIYNHHSPSTLAPLLKSIVENDSAITHLFAVHSAVGK  123
            N   V E+  K+  V ++L+A+ +   ++ P  +AP++ +  +     T + A  SA G+
Sbjct  60   NATKVAEQVAKVNGVKRVLVAQDEKLKNNLPERVAPVILA-SQKQFNFTAITAGSSAFGR  118

Query  124  NVLPRAAALLDTSIIADILNLENGGSEFTRGIYAGNAISTIKSDEPKKVVTVRGTAFDAA  183
             V+PR AA LD S I+D+  + +  S FTR +YAGNA+  +KS  P K++T RGT+F+ A
Sbjct  119  GVIPRVAAKLDVSSISDVTEVHSADS-FTRTLYAGNAVKKVKSTAPIKLLTFRGTSFEPA  177

Query  184  VAGSSEVAVEEIAAVD  199
              G S  AVE   + D
Sbjct  178  KEGGSG-AVENAPSAD  192



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02880.1.1 Glycine-tRNA

Length=431
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961R8_DROME  unnamed protein product                                 394     1e-131
Q9VUK8_DROME  unnamed protein product                                 395     9e-131
Q54PF9_DICDI  unnamed protein product                                 347     4e-113


>Q961R8_DROME unnamed protein product
Length=679

 Score = 394 bits (1012),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 265/418 (63%), Gaps = 29/418 (7%)

Query  1    MLEVDTTAVTLGEVLKTSGHVDKFTDWMTRDTKTGDIFRADHLIEAVLEARLKGDKEARG  60
            MLEVD + +T   VLK SGHV++F D M +D KTG+ FR DHLI+  LE +L   K+A  
Sbjct  121  MLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKQALE-KLSKAKDATP  179

Query  61   VQQTEQPKXXXXXXXXXVKSTAVKLDDAVVQQYETILAQIDNFDGEGLADLIAKHTIKSP  120
              Q E                            E I+ ++D  + + LA ++AK+ IKSP
Sbjct  180  ALQAE---------------------------CEDIIIKLDGLNKQELAGVLAKYNIKSP  212

Query  121  ETQNDLTKPVEFNLMFESSIGPTGQVKGYLRPETAQGHFVNFARLLEFNNGRVPFASAQI  180
             T NDLT+P+EFNLMF + IGPTG VKG+LRPETAQG FVNF RLLEFN G++PFA AQI
Sbjct  213  LTGNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQI  272

Query  181  GKSFRNEISPKQGLLRVREFLMAEIEHYVDPLKKDHPRFSEVENVELQILPKEVQVEGKT  240
            G SFRNEISP+ GL+RVREF MAEIEH+ DP+ KDHP+F  +++ +L +     Q++GK+
Sbjct  273  GNSFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKS  332

Query  241  DLTTITVGEAVKKGIIDNQTLGYFVARINLFLQKIGINKDRLRFRQHMSNEMAHYASDCW  300
                + +GEAV   ++ N+TLGY++ARI  FL  IGI  + LRFRQHMSNEMAHYA DCW
Sbjct  333  -AAQVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCW  391

Query  301  DAEIHTSYGWIECVGCADRSAYDLTVHAVRTGQPLVVREPLPEIKIEEKWAPEINKKKFG  360
            DAEI TSYGW+ECVGCADRSAYDL  H   TG  LV  + LP  K  E      NK+  G
Sbjct  392  DAEILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALG  451

Query  361  PTFRANQKIVESTIFALDQPRLECIKKEFDEQGKSDVQAADGNKYELTPELLTIEKKT  418
             TF+   K +   +  L    +  ++++    G+  +  ADG  ++L  + ++++  T
Sbjct  452  KTFKKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHST  509


>Q9VUK8_DROME unnamed protein product
Length=765

 Score = 395 bits (1014),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 265/418 (63%), Gaps = 29/418 (7%)

Query  1    MLEVDTTAVTLGEVLKTSGHVDKFTDWMTRDTKTGDIFRADHLIEAVLEARLKGDKEARG  60
            MLEVD + +T   VLK SGHV++F D M +D KTG+ FR DHLI+  LE +L   K+A  
Sbjct  207  MLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKQALE-KLSKAKDATP  265

Query  61   VQQTEQPKXXXXXXXXXVKSTAVKLDDAVVQQYETILAQIDNFDGEGLADLIAKHTIKSP  120
              Q E                            E I+ ++D  + + LA ++AK+ IKSP
Sbjct  266  ALQAE---------------------------CEDIIIKLDGLNKQELAGVLAKYNIKSP  298

Query  121  ETQNDLTKPVEFNLMFESSIGPTGQVKGYLRPETAQGHFVNFARLLEFNNGRVPFASAQI  180
             T NDLT+P+EFNLMF + IGPTG VKG+LRPETAQG FVNF RLLEFN G++PFA AQI
Sbjct  299  LTGNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQI  358

Query  181  GKSFRNEISPKQGLLRVREFLMAEIEHYVDPLKKDHPRFSEVENVELQILPKEVQVEGKT  240
            G SFRNEISP+ GL+RVREF MAEIEH+ DP+ KDHP+F  +++ +L +     Q++GK+
Sbjct  359  GNSFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKS  418

Query  241  DLTTITVGEAVKKGIIDNQTLGYFVARINLFLQKIGINKDRLRFRQHMSNEMAHYASDCW  300
                + +GEAV   ++ N+TLGY++ARI  FL  IGI  + LRFRQHMSNEMAHYA DCW
Sbjct  419  -AAQVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCW  477

Query  301  DAEIHTSYGWIECVGCADRSAYDLTVHAVRTGQPLVVREPLPEIKIEEKWAPEINKKKFG  360
            DAEI TSYGW+ECVGCADRSAYDL  H   TG  LV  + LP  K  E      NK+  G
Sbjct  478  DAEILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALG  537

Query  361  PTFRANQKIVESTIFALDQPRLECIKKEFDEQGKSDVQAADGNKYELTPELLTIEKKT  418
             TF+   K +   +  L    +  ++++    G+  +  ADG  ++L  + ++++  T
Sbjct  538  KTFKKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHST  595


>Q54PF9_DICDI unnamed protein product
Length=678

 Score = 347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/428 (43%), Positives = 255/428 (60%), Gaps = 31/428 (7%)

Query  1    MLEVDTTAVTLGEVLKTSGHVDKFTDWMTRDTKTGDIFRADHLIEAVLEARLKGDKEARG  60
            M EVD  +VT  +VLK SGHV KF D+M +D  T   FRADH++EA ++  LK       
Sbjct  121  MSEVDCVSVTPEQVLKASGHVAKFADFMVKDEVTKAFFRADHILEAHIQTLLKDTS----  176

Query  61   VQQTEQPKXXXXXXXXXVKSTAVKLDDAVVQQYETILAQIDNFDGEGLADLIAKHTIKSP  120
                                   K+    +++   +LA+  +++ E L + + K+ +K+P
Sbjct  177  -----------------------KMSKEQIEELNFVLAKAGDYNQEQLKESLIKYNVKAP  213

Query  121  ETQNDLTKPVEFNLMFESSIGPTGQVKGYLRPETAQGHFVNFARLLEFNNGRVPFASAQI  180
            ET N LT+P  FNLMF++ IGP+G   GYLRPETAQG F NF +L E+N  ++PFA+AQI
Sbjct  214  ETGNALTEPYPFNLMFQTQIGPSGLSTGYLRPETAQGIFTNFGKLYEYNGKKLPFAAAQI  273

Query  181  GKSFRNEISPKQGLLRVREFLMAEIEHYVDPLKKDHPRFSEVENVELQILPKEVQVEGKT  240
            G +FRNEI+P+ GLLRVREF MAEIEH+V+P  K HP+F+E+++VE  +L  + Q +  +
Sbjct  274  GNAFRNEIAPRAGLLRVREFTMAEIEHFVNPNNKTHPKFNEIKDVEANLLSSDSQ-DKTS  332

Query  241  DLTTITVGEAVKKGIIDNQTLGYFVARINLFLQKIGINKDRLRFRQHMSNEMAHYASDCW  300
            ++   T GEAV+K +IDN+TL YF+AR   FL  +GI    LRFRQH  NEMAHYA DCW
Sbjct  333  EIQVCTFGEAVEKKLIDNETLAYFMARTQQFLHTVGIKPAGLRFRQHQKNEMAHYAQDCW  392

Query  301  DAEIHTSYGWIECVGCADRSAYDLTVHAVRTGQPLVVREPLPEIKIEEKWAPEINKKKFG  360
            DAEI +SYGW+ECVG ADRS YDL VHA  +   L   E   E +  +     +N     
Sbjct  393  DAEILSSYGWVECVGHADRSCYDLKVHATESKSNLSAYEEFKEPQFVDIAKVVVNPGAIS  452

Query  361  PTFRANQKIVESTIFAL--DQPRLECIKKEFDEQGKSDVQAADGNKYELTPELLTIEKKT  418
               RA    ++  +  L  D  +   I++   + G  ++   DGN Y++T +++TI K  
Sbjct  453  KKHRAAVSPIKKYLTELKDDLAKALEIQETITKDGSYNL-VLDGNTYDITADMVTISKAQ  511

Query  419  FKETKREF  426
             K+    F
Sbjct  512  EKKNGHTF  519



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02890.1.1 Acetolactate

Length=198
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44565_CAEEL  unnamed protein product                                 29.3    2.4  
NEK2_DICDI  unnamed protein product                                   28.1    5.9  
SP28D_DROME  unnamed protein product                                  28.1    6.5  


>O44565_CAEEL unnamed protein product
Length=1790

 Score = 29.3 bits (64),  Expect = 2.4, Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 34/60 (57%), Gaps = 3/60 (5%)

Query  83    SNTQRPSEVQEDLTKMS--LSEALRTKHAHLSALKNLAEQFSGKLVDVSSDSVIVEVTGK  140
             +  QR +  + +L K++  + E L  + +    ++NLAE+  GK + ++ D  I ++TGK
Sbjct  1495  NTAQRANSSRAELDKIAEEIGEFLTAQKSSPEQIRNLAEEVLGKEISLTPDQ-ITDLTGK  1553


>NEK2_DICDI unnamed protein product
Length=418

 Score = 28.1 bits (61),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 26/44 (59%), Gaps = 0/44 (0%)

Query  6   RGQDAVVEQARRQLEDLVPVWAVLDYTNTSVIERELLLVKVSLL  49
           +G   VV + +R+ +  V VW  + Y N    E++LL+ +V++L
Sbjct  12  KGSFGVVSKIKRKEDGRVLVWKEICYENMQEKEKQLLVNEVNIL  55


>SP28D_DROME unnamed protein product
Length=536

 Score = 28.1 bits (61),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 0/52 (0%)

Query  89   SEVQEDLTKMSLSEALRTKHAHLSALKNLAEQFSGKLVDVSSDSVIVEVTGK  140
            S VQ DL+ ++ +EA RT     ++L+NL  Q         SD V+ ++  K
Sbjct  425  SAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHK  476



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02900.1.1 Actin-related

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97182_DROME  unnamed protein product                                 339     2e-114
ARPC1_DICDI  unnamed protein product                                  332     5e-112
CIAO1_DROME  unnamed protein product                                  52.0    4e-07 


>O97182_DROME unnamed protein product
Length=377

 Score = 339 bits (869),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 237/372 (64%), Gaps = 22/372 (6%)

Query  15   VTAYAFNADRSQLAVCPNSNVLQIYQKSANTWTLSAELKEHDKLITSVDWAPQSNRIVTC  74
            +T +A+N DR+Q+A+ PN++ + IY +  + W L+  L +HD  +  +DWA  +NRIV+C
Sbjct  14   ITCHAWNKDRTQIALSPNNHEIHIYSREGSDWKLADVLNQHDLRVMGIDWAKNTNRIVSC  73

Query  75   SQDRNAYVWTF-QAGQWKPTLVLLRINRSATFVRWSPLENKFAVASGARAIAVCSFDPES  133
            + DRNAYVWT    G+WKP LVLLRINR+AT V+WSP ENKFAV SGAR I+VC F+ E+
Sbjct  74   AADRNAYVWTQGDDGKWKPALVLLRINRAATCVKWSPAENKFAVGSGARLISVCYFESEN  133

Query  134  DWWVAKHIKKPLRSTVLSLDWHPNNVLLVAGSADSRARVFSAYIKDVDSKPAPSVWGERL  193
            DWWV+KHIKKP+RSTV SLDWHPNNVLL+AGS D + RVFSA+IKD++  P P+ WG R 
Sbjct  134  DWWVSKHIKKPIRSTVTSLDWHPNNVLLLAGSTDYKVRVFSAFIKDIEEPPTPTPWGNRK  193

Query  194  PFNTICGEY---ASPASGWIHSVSFTPSGNAIAFVSHDSNLSIIYPTGVDNPPSVFNVRL  250
            P   +  E+    +   GWI+SVSF+  GN + +V HDS +SI   T   N  +V   R 
Sbjct  194  PLGQLMAEFRNSQTSGGGWINSVSFSSDGNKVCWVGHDSCVSIADAT---NGNTVIRCRT  250

Query  251  ASLPHTSVTFLTEDSLIAAGHDCQPMLYRLINNNSWEFVKSLDDATGASQSNKASVAGRL  310
              LP  S  +++  S++ AG+ C P+LY L  +        LD      +S K   +G  
Sbjct  251  GYLPFLSCEWVSPTSVVVAGYSCVPLLYSLTADGKLVLSGKLD------KSQKKESSGI-  303

Query  311  NNTAFNAFKAADSMGATGGVTGVGAGDTVLTTVHQNTITSVRPFAGVPGNITHVSTAGRD  370
              TA   F++ D    T         DTV+ ++HQN ITSVR +AG   + T VST+G D
Sbjct  304  --TAMRIFQSMDRNMRTENT------DTVVDSIHQNAITSVRLYAGDKASATKVSTSGVD  355

Query  371  GKIVIWDINSGG  382
            G++VIW++  GG
Sbjct  356  GQLVIWNVEQGG  367


>ARPC1_DICDI unnamed protein product
Length=369

 Score = 332 bits (852),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/370 (44%), Positives = 239/370 (65%), Gaps = 19/370 (5%)

Query  11   FAVPVTAYAFNADRSQLAVCPNSNVLQIYQKSANTWTLSAELKEHDKLITSVDWAPQSNR  70
             A  +TA+A+NADRS++A+CPN+N + IY K   +W +   L EHD+L+TS+DWAP++NR
Sbjct  9    LASCITAHAWNADRSRVALCPNNNEVHIYAKQGTSWVVEHVLAEHDQLVTSIDWAPKTNR  68

Query  71   IVTCSQDRNAYVWTFQAGQWKPTLVLLRINRSATFVRWSPLENKFAVASGARAIAVCSFD  130
            I+T SQDRNAYVWTF+ GQWKP LVLLRINR+AT V+WSP ENKFAVA+GA+ + +C F+
Sbjct  69   ILTSSQDRNAYVWTFKDGQWKPVLVLLRINRAATHVKWSPQENKFAVATGAKLVCICFFE  128

Query  131  PESDWWVAKHIKKPLRSTVLSLDWHPNNVLLVAGSADSRARVFSAYIKDVDSKPAPSVWG  190
             E DWW + HIKK  +STVL +DWHPNN+LL   S+D + RVF AYIK  D +     +G
Sbjct  129  EEHDWWASNHIKKH-KSTVLKVDWHPNNLLLATSSSDYKVRVFDAYIKKADGRSVTRPYG  187

Query  191  ERLPFNTICGEYASPASGWIHSVSFTPSGNAIAFVSHDSNLSIIYPTGVDNPPSVFNVRL  250
            E + F     E+   AS W+H++ ++PSG+ +A+ SHD   ++       NPP++  +R+
Sbjct  188  E-VAFGEPVFEFDQCAS-WVHALKWSPSGSTLAYSSHDGVFAV--ANFSTNPPTIEKLRV  243

Query  251  ASLPHTSVTFLTEDSLIAAGHDCQPMLYRLINNNSWEFVKSLDDATGASQSNKASVAGRL  310
             +LP   + ++TE+S+   G+DC P+L  + N N W++   +D A+    +  +  + R 
Sbjct  244  RNLPLRDLLYITENSIAGVGYDCAPLL--ITNQNGWKYSGEMDKASEGGAAAGSETSAR-  300

Query  311  NNTAFNAFKAADSMGATGGVTGVGAGDTVLTTVHQNTITSVRPFAGVPGNITHVSTAGRD  370
                   F+    +G +       + D  LTTVHQN ITS+ PF  V G ++  ST+G D
Sbjct  301  -----KLFQNKVDLGES------KSADKKLTTVHQNCITSIVPFKSVGGVVSDFSTSGLD  349

Query  371  GKIVIWDINS  380
            G IV+W + +
Sbjct  350  GNIVVWHVKA  359


>CIAO1_DROME unnamed protein product
Length=335

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 67/140 (48%), Gaps = 1/140 (1%)

Query  38   IYQKSANTWTLSAELKEHDKLITSVDWAPQSNRIVTCSQDRNAYVWTFQA-GQWKPTLVL  96
            I+ KS+  +  +A L+ H+  + SV W+     + TCS+D++ ++W      +++   VL
Sbjct  85   IWSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAGDDEFECAAVL  144

Query  97   LRINRSATFVRWSPLENKFAVASGARAIAVCSFDPESDWWVAKHIKKPLRSTVLSLDWHP  156
                +    V W P ++  A AS    I + + +P  + W          STV  +D+  
Sbjct  145  NPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGIDFDA  204

Query  157  NNVLLVAGSADSRARVFSAY  176
            +   LV+ S D+  +++ AY
Sbjct  205  DGERLVSCSDDTTIKIWRAY  224


 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 65/156 (42%), Gaps = 2/156 (1%)

Query  27   LAVCPNSNVLQIYQKSANTWTLSAELKE-HDKLITSVDWAPQSNRIVTCSQDRNAYVWTF  85
             A C     ++I+  + NTW+    L + H + I  + W+P    + + S D    +W+ 
Sbjct  29   FASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREIRWSPCGQYLASASFDATTAIWSK  88

Query  86   QAGQWKPTLVLLRINRSATFVRWSPLENKFAVASGARAIAVCSFDPESDWWVAKHIKKPL  145
             +G+++    L         V WS      A  S  +++ +     + ++  A  +  P 
Sbjct  89   SSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAGDDEFECAA-VLNPH  147

Query  146  RSTVLSLDWHPNNVLLVAGSADSRARVFSAYIKDVD  181
               V  + WHP   +L + S D+  ++F+    D D
Sbjct  148  TQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDND  183


 Score = 42.0 bits (97),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 73/195 (37%), Gaps = 19/195 (10%)

Query  48   LSAELKEHDKLITSVDWAPQSNRIVTCSQDRNAYVWTFQAGQWKPTLVLLRIN-RSATFV  106
            L   L+ H   I  V W P+ N   +C +D+   +W+     W    +L   + R+   +
Sbjct  6    LEHTLQGHKGRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREI  65

Query  107  RWSPLENKFAVASGARAIAVCSFDPESDWWVAKHIKKPLRSTVLSLDWHPNNVLLVAGSA  166
            RWSP     A AS     A+  +   S  +      +   + V S+ W  +  LL   S 
Sbjct  66   RWSPCGQYLASASFDATTAI--WSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSR  123

Query  167  DSRARVFSAYIKDVDSKPAPSVWGERLPFNTICGEYASPASGWIHSVSFTPSGNAIAFVS  226
            D    ++     D               F   C    +P +  +  V + P+ + +A  S
Sbjct  124  DKSVWIWEVAGDD--------------EFE--CAAVLNPHTQDVKRVVWHPTKDILASAS  167

Query  227  HDSNLSIIYPTGVDN  241
            +D+ + +     +DN
Sbjct  168  YDNTIKMFAEEPIDN  182



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02910.1.1 Cyclin

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K6A7_PLAF7  unnamed protein product                                 47.8    4e-06
Q75J86_DICDI  unnamed protein product                                 44.7    1e-04
G5EEP2_CAEEL  unnamed protein product                                 29.3    4.2  


>Q7K6A7_PLAF7 unnamed protein product
Length=229

 Score = 47.8 bits (112),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 45/76 (59%), Gaps = 0/76 (0%)

Query  200  SLLCGRRTFLSSLILANKYLSERNYSNRAWSRMSGLTANEISSNERAFLILINYELCVSE  259
            SLLC  R  +++ +++ K+  +  YSN  ++++ G+T  E++  E  FL LI+Y+L VS 
Sbjct  90   SLLCIHRLVITAAMISVKFFDDLYYSNSYYAKIGGVTTKELNKLEIYFLNLIDYKLFVSS  149

Query  260  STWKRWVAFLRTLVEK  275
              +  +  ++   V+K
Sbjct  150  QEYDFYRKYICLAVQK  165


>Q75J86_DICDI unnamed protein product
Length=798

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 42/61 (69%), Gaps = 0/61 (0%)

Query  197  CQDSLLCGRRTFLSSLILANKYLSERNYSNRAWSRMSGLTANEISSNERAFLILINYELC  256
             Q S L   R F++S+I+A+K+ +++  +NR ++++ G++  E++  E  FL+L+N++L 
Sbjct  389  IQISPLNIHRLFMASIIVASKFHNDKALNNRYYAQVGGISLFEMNQLEIHFLLLLNWKLH  448

Query  257  V  257
            +
Sbjct  449  I  449


>G5EEP2_CAEEL unnamed protein product
Length=287

 Score = 29.3 bits (64),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 62/161 (39%), Gaps = 34/161 (21%)

Query  4    NSPINNWRYDSS-------PESSSTSSKQSLP-----SQYNTSPTSYSNSSIDNLPKLQT  51
            N PIN+W  D+        P +S+  +    P     SQ +  P +   + ++  P    
Sbjct  16   NMPINDWLEDAPMPDCYNVPSTSTDENNDPFPFSNISSQSSLKPKTPEKAVVEVRPTGNE  75

Query  52   LSLDAPKAP---------------------VAAPLPTPPTSSSIRGTKRCRSSSQASDSS  90
            +    PK P                       A +PT     +   +  CR S  +  SS
Sbjct  76   MLDPEPKYPKEEKPWCTIFYYELTVRLGKAFEAKVPTITIDGATGASDECRMSLTSQPSS  135

Query  91   RGSFSAASSDDIGSVERKSYADGLIDTSVFTIEAIW-KCPL  130
            R S S+   + +G+  + +Y +G +  +V T + ++ +CP 
Sbjct  136  RNSKSSQIRNTVGAGIQLAYENGELWLTVLTDQIVFVQCPF  176



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02920.1.1 Phosphoglycerate

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q386L9_TRYB2  unnamed protein product                                 30.0    0.54 
O01485_CAEEL  unnamed protein product                                 28.5    2.0  
SHARK_DROME  unnamed protein product                                  27.7    3.8  


>Q386L9_TRYB2 unnamed protein product
Length=291

 Score = 30.0 bits (66),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 34/76 (45%), Gaps = 4/76 (5%)

Query  6   KTIYFTRHAQAAHNV--ADDYTIPD--APLTQLGREQSSRLNPLTEETIQKTAELLVSSP  61
           + +   RH ++  NV  A    +PD   PLT  GREQ+        + I+     +  SP
Sbjct  18  RRLLLVRHGESEANVDRALYSKVPDWKIPLTARGREQAFECGRRLRKIIKNEKLYVYYSP  77

Query  62  LRRPMQTMLEGYPNLV  77
             R  QT+ E   +L+
Sbjct  78  YTRTRQTLTEVRKSLL  93


>O01485_CAEEL unnamed protein product
Length=2076

 Score = 28.5 bits (62),  Expect = 2.0, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 30/56 (54%), Gaps = 3/56 (5%)

Query  41   RLNPLTEETIQKTAELLVSSPLRR--PMQTMLEGYPNLVKRLESEGKPPILLTIAQ  94
            R + L  ET+Q+ +  L+SS L    PM T L G   L +  ++   PP + +IAQ
Sbjct  860  RGHKLDNETLQRASFDLISSSLSNSCPM-TRLVGAEALARLSQAVNSPPFVASIAQ  914


>SHARK_DROME unnamed protein product
Length=939

 Score = 27.7 bits (60),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 0/40 (0%)

Query  93   AQEVNGHPCDTGSEPDNLISDPEFKGLDFKDVHPGWTNKK  132
            A EV         EP+ L+ D E    +F  VH GW  +K
Sbjct  645  ATEVEAAKLRFFIEPEKLVLDREIGHGEFGSVHSGWLLRK  684



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02930.1.1 Tryptophan

Length=112
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ELBA3_DROME  unnamed protein product                                  28.1    1.8  
A0A0B4K614_DROME  unnamed protein product                             28.1    2.0  
A0A0B4LH20_DROME  unnamed protein product                             28.1    2.0  


>ELBA3_DROME unnamed protein product
Length=379

 Score = 28.1 bits (61),  Expect = 1.8, Method: Composition-based stats.
 Identities = 26/97 (27%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query  7    DTFTECHKKGRPAFVTFMTAGYPY-----KNSTVDLMLSLEKGGADII--ELGVPYGEEK  59
            DT+        P  V +    Y       +N   D++  ++  G+DI+   + + YG++K
Sbjct  208  DTWMLVQYSPEPEMVVYQVVQYRQTVWRKENLFKDVIAYMQLPGSDIVLQAVVISYGQDK  267

Query  60   AVKDAKDAGASGYIM-VDLP-PEEAIKFRNICTSEGL  94
             V+DAK      +   +D P PEE  K  +  TS  L
Sbjct  268  EVQDAKYEELQRFSFDIDFPLPEELEKHPDHMTSTAL  304


>A0A0B4K614_DROME unnamed protein product
Length=4716

 Score = 28.1 bits (61),  Expect = 2.0, Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 26/45 (58%), Gaps = 1/45 (2%)

Query  58    EKAVKDAKDAGASGYIMVDLPPEEAIKFR-NICTSEGLSYIPLVA  101
             +K V++A+       I+ DLPPE +I+ + + CT E L  + + A
Sbjct  2537  QKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFA  2581


>A0A0B4LH20_DROME unnamed protein product
Length=4724

 Score = 28.1 bits (61),  Expect = 2.0, Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 26/45 (58%), Gaps = 1/45 (2%)

Query  58    EKAVKDAKDAGASGYIMVDLPPEEAIKFR-NICTSEGLSYIPLVA  101
             +K V++A+       I+ DLPPE +I+ + + CT E L  + + A
Sbjct  2545  QKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFA  2589



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02940.1.1 Tryptophan

Length=159
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SRR_DICDI  unnamed protein product                                    30.0    0.83 
Q57Y25_TRYB2  unnamed protein product                                 29.3    1.6  
PKS37_DICDI  unnamed protein product                                  29.3    1.9  


>SRR_DICDI unnamed protein product
Length=324

 Score = 30.0 bits (66),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 40/98 (41%), Gaps = 3/98 (3%)

Query  57   EYMGRPSYLYEATRLTEEAGGARIWLKREDLNHTGSHKINNAVGQILLAKRLGKKRIIAE  116
            +Y+ +   L  +T    E  G  ++ K E+L  TGS K+  A   I         + +  
Sbjct  21   KYIHKTPVLTNST--INELAGKELYFKCENLQKTGSFKMRGACNAIFSLDEEELSKGVVT  78

Query  117  TGAGQHGVATATVCARFGMECHVFMGAEDVRRQGLNVF  154
              +G HG A +       ++C+V +  ED     LN  
Sbjct  79   HSSGNHGQALSYASKVRCVKCYVVV-PEDAPSVKLNAI  115


>Q57Y25_TRYB2 unnamed protein product
Length=877

 Score = 29.3 bits (64),  Expect = 1.6, Method: Composition-based stats.
 Identities = 18/49 (37%), Positives = 26/49 (53%), Gaps = 0/49 (0%)

Query  100  GQILLAKRLGKKRIIAETGAGQHGVATATVCARFGMECHVFMGAEDVRR  148
            G +LL      K ++A+  AG+ GV    VC    +E +V MGA  VR+
Sbjct  345  GALLLGPPGTGKTLLAKAVAGESGVGFIPVCGSDFVELYVGMGALRVRQ  393


>PKS37_DICDI unnamed protein product
Length=2968

 Score = 29.3 bits (64),  Expect = 1.9, Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query  102   ILLAKRLGK-KRIIAETGAGQHGVATATVCARFGMECHVFMGAEDVRR  148
             I++  RL K ++I+  +G G  G+AT  +    G E HV +G+ + ++
Sbjct  1857  IVIQGRLKKGEKILIHSGCGGVGLATIQISMMIGAEIHVTVGSNEKKQ  1904



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


Query= Dcitr00g02950.1.1 Unknown

Length=273
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRSN_PIERA  unnamed protein product                                   31.2    1.2  
Q2YS44_CAEEL  unnamed protein product                                 29.6    2.4  
Q9VBA0_DROME  unnamed protein product                                 29.6    2.7  


>PRSN_PIERA unnamed protein product
Length=850

 Score = 31.2 bits (69),  Expect = 1.2, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query  83   AGSVWELVGDTLKKCRNVQHVKLRAMGLWHEDRRGLVEGLGAID  126
            A S+WELV D+ KK  N+    +  +G  ++++   V+ LG ID
Sbjct  748  ASSIWELVYDSSKKAYNIYSSDINNLGWIYQNKNFFVK-LGNID  790


>Q2YS44_CAEEL unnamed protein product
Length=332

 Score = 29.6 bits (65),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 25/52 (48%), Gaps = 0/52 (0%)

Query  63   NVPLELLSKVKTLHLNLPSAAGSVWELVGDTLKKCRNVQHVKLRAMGLWHED  114
            + P E L  V    LNLP  + SV  ++ D L K    ++ K+R   L + D
Sbjct  230  DFPFEHLVHVSCFELNLPRISVSVAIIIRDVLMKTAQFEYGKIRLYDLNNMD  281


>Q9VBA0_DROME unnamed protein product
Length=368

 Score = 29.6 bits (65),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 68/173 (39%), Gaps = 29/173 (17%)

Query  62   KNVPLELLSKVKTLHLNLPSAAGSVWELVGD--------TLKKCRNVQHVKLRAMGLWHE  113
            +N  +EL+ +    HL L S +  + E+ GD        T K+  N  H  +  +G    
Sbjct  49   RNSNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYK--  106

Query  114  DRRGLVEG--LGAIDPVSFEWT--SPDPPHHVSLSLVTPCLTILLHQL-----------P  158
                L  G  L  I   S+ ++     P   VS  + TP ++IL+H++           P
Sbjct  107  ----LPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDP  162

Query  159  KWTRLESLTLSHMQFPQCAHPDRYLPMILSPTVRFVKLGQAIRAPAKMLAGIA  211
             + R+ +     +        +  L   L  +  F  LG+ I  PAK+   +A
Sbjct  163  VFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLA  215



Lambda      K        H
   0.322    0.134    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1563481556


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Apr 30, 2020  2:49 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= Dcitr00g02960.1.1 Peptidase

Length=866
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q76NL8_PLAF7  unnamed protein product                                 84.0    4e-16
IDE_DROME  unnamed protein product                                    45.1    3e-04
Q9VYT3_DROME  unnamed protein product                                 40.4    0.007


>Q76NL8_PLAF7 unnamed protein product
Length=1193

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 93/202 (46%), Gaps = 23/202 (11%)

Query  70   FVVPTEIFDDSGCPHTLEHLVFLGSKLYPYKGVLDTLANRAFAAGTNAWTDTDQTVYTLQ  129
            F V T      G PH LEH V  GSK Y YK  +  L         NA+T  D+TVY   
Sbjct  115  FYVKTLTHSGKGIPHILEHSVLSGSKNYNYKNSIGLLEKGTLHTHLNAYTFNDRTVYMAG  174

Query  130  TAGYEGFLRMLPVYMDHLLRPTITD-------AGYTTEIHHINEAGEDA-----------  171
            +   + F  ++ VYMD + +P + +        G+T E+  + E  +             
Sbjct  175  SMNNKDFFNIMGVYMDSVFQPNVLENKYIFETEGWTYEVEKLKEDEKGKAEIPQMKDYKV  234

Query  172  ---GVVYSEMQGRSTAPFDLMEDKHRALMYPEQSAYRSETGGRMDALRVLTADKVRDFHK  228
               G+VY+EM+G  ++P + +  +    M+P+ + + + +GG    +  LT ++ ++F+ 
Sbjct  235  SFNGIVYNEMKGALSSPLEDLYHEEMKYMFPD-NVHSNNSGGDPKEITNLTYEEFKEFYY  293

Query  229  KYYAPHNLS-LVVTGDIPTDKL  249
            K Y P  +     + + PT+ L
Sbjct  294  KNYNPKKVKVFFFSKNNPTELL  315


>IDE_DROME unnamed protein product
Length=990

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/224 (25%), Positives = 91/224 (41%), Gaps = 34/224 (15%)

Query  81   GCPHTLEHLVFLGSKLYPYKGVLDTLANRAFAAGTNAWTDTDQTVYTLQTAGYEGFLRML  140
            G  H  EH++FLG++ YP++    T  +++    +NA T    T Y    A  +     L
Sbjct  78   GLAHFCEHMLFLGTEKYPHENGYTTYLSQS-GGSSNAATYPLMTKYHFHVAP-DKLDGAL  135

Query  141  PVYMDHLLRPTITDAGYTTEIHHINEAGEDAGVVYSEMQGRSTAPFDLMEDK--HRALMY  198
              +    + P  T +    EI+ +N   E               P DL   K  +R L  
Sbjct  136  DRFAQFFIAPLFTPSATEREINAVNSEHE------------KNLPSDLWRIKQVNRHLAK  183

Query  199  PEQSAYRSETGGRMDALRVLTADK---VRD----FHKKYYAPHNLSLVVTGDIPTDKLLD  251
            P+  AY     G    L  +   K   VRD    FHK++Y+ + + L V G     + LD
Sbjct  184  PDH-AYSKFGSGNKTTLSEIPKSKNIDVRDELLKFHKQWYSANIMCLAVIG----KESLD  238

Query  252  VMQNVIEPRLIDDAKERGIELGIKPRGWKR-PFVETASAEPLKI  294
             ++ ++  +  +   +      +K  GW R P+ E    + +KI
Sbjct  239  ELEGMVLEKFSEIENK-----NVKVPGWPRHPYAEERYGQKVKI  277


>Q9VYT3_DROME unnamed protein product
Length=1147

 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (52%), Gaps = 4/62 (6%)

Query  70   FVVPTEIFDDSGCPHTLEHLVFLGSKLYPYKGVLDTLANRAFAAGTNAWTDTDQTVYTLQ  129
            F  PT+     G  H LEH++F+GS+ YP + + D    +      NA TD + T++  +
Sbjct  147  FAEPTKY---QGLAHFLEHMIFMGSEKYPKENIFDAHIKKC-GGFANANTDCEDTLFYFE  202

Query  130  TA  131
             A
Sbjct  203  VA  204



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g02970.1.1 Ohcu

Length=176
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O62178_CAEEL  unnamed protein product                                 27.7    7.7  
G5ED36_CAEEL  unnamed protein product                                 27.3    8.1  
Q582S3_TRYB2  unnamed protein product                                 27.3    8.2  


>O62178_CAEEL unnamed protein product
Length=2271

 Score = 27.7 bits (60),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (51%), Gaps = 4/57 (7%)

Query  115  EKYPKQRFITFVNGRTRAEIIPEIESIL-SQSDGVQEFGSNNWL---RELDRNINAI  167
            EK P+Q  + + NG  RA +  E + IL S  DG++  G+N         +RN+  I
Sbjct  291  EKDPQQFIVEYENGDGRAYVAAERDLILASLLDGIRASGNNEVFVCGHRFERNLRVI  347


>G5ED36_CAEEL unnamed protein product
Length=2279

 Score = 27.3 bits (59),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (51%), Gaps = 4/57 (7%)

Query  115  EKYPKQRFITFVNGRTRAEIIPEIESIL-SQSDGVQEFGSNNWL---RELDRNINAI  167
            EK P+Q  + + NG  RA +  E + IL S  DG++  G+N         +RN+  I
Sbjct  291  EKDPQQFIVEYENGDGRAYVAAERDLILASLLDGIRASGNNEVFVCGHRFERNLRVI  347


>Q582S3_TRYB2 unnamed protein product
Length=1414

 Score = 27.3 bits (59),  Expect = 8.2, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 3/89 (3%)

Query  35   YLLVPQLSRDISGSNYLDCLEVAKSIVNTWDLSSKALFVNSHPRIGQVSGLSKLSREEQA  94
            YL+  +L R I   +YL+   V KS+   W    +   +    R   + G   + + E+ 
Sbjct  895  YLMNQRLERLIKEIHYLESGRVPKSLFERWLTEEQRKHIKYEDRDEWLQGKQYVGKSERT  954

Query  95   SKRTPEDVLIKLDELNRAYEE--KYPKQR  121
            + RT    L+K   +  A EE  + P++R
Sbjct  955  ANRTLYLQLLK-TRVESALEEAQRSPRER  982



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g02980.1.1 Glucose-6-phosphate

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3D1_DROME  unnamed protein product                                 125     4e-34
Q8IP67_DROME  unnamed protein product                                 124     8e-34
X2JAD3_DROME  unnamed protein product                                 123     2e-33


>Q9V3D1_DROME unnamed protein product
Length=297

 Score = 125 bits (313),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/277 (34%), Positives = 138/277 (50%), Gaps = 23/277 (8%)

Query  11   IVHSSGN--SVVINKLGATITSFKDAHQKEHLFLSN--KLIPGKAIRGGIPIAFPVFGKP  66
            +V   GN  +  IN  GAT+ S++  + +E LF+S        KAIRGGIP  FP FG  
Sbjct  14   VVLDRGNNTTCTINLHGATVVSWR-VNNQEQLFVSKLASFDGKKAIRGGIPFVFPQFG--  70

Query  67   PTSGAYSDLPQHGYARISEWTYDETP-VMDNDDGVSVRFILDSPPKLP----PARLVYTV  121
                A+S  PQHG+ARI+ W  +  P  + N D  ++  ++D+           R+ Y +
Sbjct  71   ----AWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQFRITYRL  126

Query  122  TLTAHQLTSTLHVKNTSSTDVLPFQALLHTYY-AGNPNEVGVKGLNGVRYSDKTTGGETR  180
             L   +L   + V N S      F  LLHTY    +     + GL G  + DKT      
Sbjct  127  ILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKTRENALY  186

Query  181  IESNDVVYANKNTDSVYMNTTDEIHLTN---GIKIR--KHNLPDTVIWNPS-EGAKSMAD  234
             E  +VV  N+ TD +Y +T  E  +TN   G K+R  K+N PDTVIWNP  + ++ M+D
Sbjct  187  QEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDRSREMSD  246

Query  235  MHEGGWNEFICVEPGHVRDFYDLVPGKEWIGFQVITI  271
              +  +   +CVE G+V     L+PG  +   Q++ I
Sbjct  247  FGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQILQI  283


>Q8IP67_DROME unnamed protein product
Length=289

 Score = 124 bits (311),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 138/277 (50%), Gaps = 23/277 (8%)

Query  11   IVHSSGN--SVVINKLGATITSFKDAHQKEHLFLSN--KLIPGKAIRGGIPIAFPVFGKP  66
            +V   GN  +  IN  GAT+ S++  + +E LF+S        KAIRGGIP  FP FG  
Sbjct  14   VVLDRGNNTTCTINLHGATVVSWR-VNNQEQLFVSKLASFDGKKAIRGGIPFVFPQFG--  70

Query  67   PTSGAYSDLPQHGYARISEWTYDETP-VMDNDDGVSVRFILDSPPKLP----PARLVYTV  121
                A+S  PQHG+ARI+ W  +  P  + N D  ++  ++D+           R+ Y +
Sbjct  71   ----AWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQFRITYRL  126

Query  122  TLTAHQLTSTLHVKNTSSTDVLPFQALLHTYY-AGNPNEVGVKGLNGVRYSDKTTGGETR  180
             L   +L   + V N S      F  LLHTY    +     + GL G  + DKT      
Sbjct  127  ILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKTRENALY  186

Query  181  IESNDVVYANKNTDSVYMNTTDEIHLTN---GIKIR--KHNLPDTVIWNPS-EGAKSMAD  234
             E  +VV  N+ TD +Y +T  E  +TN   G K+R  K+N PDTVIWNP  + ++ M+D
Sbjct  187  QEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDRSREMSD  246

Query  235  MHEGGWNEFICVEPGHVRDFYDLVPGKEWIGFQVITI  271
              +  +   +CVE G+V     L+PG  +   Q++ +
Sbjct  247  FGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQILQV  283


>X2JAD3_DROME unnamed protein product
Length=308

 Score = 123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 137/275 (50%), Gaps = 23/275 (8%)

Query  11   IVHSSGN--SVVINKLGATITSFKDAHQKEHLFLSN--KLIPGKAIRGGIPIAFPVFGKP  66
            +V   GN  +  IN  GAT+ S++  + +E LF+S        KAIRGGIP  FP FG  
Sbjct  14   VVLDRGNNTTCTINLHGATVVSWR-VNNQEQLFVSKLASFDGKKAIRGGIPFVFPQFG--  70

Query  67   PTSGAYSDLPQHGYARISEWTYDETP-VMDNDDGVSVRFILDSPPKLP----PARLVYTV  121
                A+S  PQHG+ARI+ W  +  P  + N D  ++  ++D+           R+ Y +
Sbjct  71   ----AWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQFRITYRL  126

Query  122  TLTAHQLTSTLHVKNTSSTDVLPFQALLHTYY-AGNPNEVGVKGLNGVRYSDKTTGGETR  180
             L   +L   + V N S      F  LLHTY    +     + GL G  + DKT      
Sbjct  127  ILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKTRENALY  186

Query  181  IESNDVVYANKNTDSVYMNTTDEIHLTN---GIKIR--KHNLPDTVIWNPS-EGAKSMAD  234
             E  +VV  N+ TD +Y +T  E  +TN   G K+R  K+N PDTVIWNP  + ++ M+D
Sbjct  187  QEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDRSREMSD  246

Query  235  MHEGGWNEFICVEPGHVRDFYDLVPGKEWIGFQVI  269
              +  +   +CVE G+V     L+PG  +   Q++
Sbjct  247  FGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQIL  281



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g02990.1.1 Protein

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

2AAA_DICDI  unnamed protein product                                   587     0.0  
2AAA_DROME  unnamed protein product                                   558     0.0  
2AAA_CAEEL  unnamed protein product                                   558     0.0  


>2AAA_DICDI unnamed protein product
Length=584

 Score = 587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/575 (51%), Positives = 415/575 (72%), Gaps = 6/575 (1%)

Query  7    PVALLLDELKSDDVTLRLNAIHRISTIALALGPDRTRDELIPFLQDS-LDDEDEVLLALA  65
            P+ +L+DELK++D+ LRLN+I ++ +IA ALGP+RTR ELIP+LQDS L+DEDEVL+ L+
Sbjct  13   PIVILIDELKNEDIQLRLNSIKKLQSIAKALGPERTRTELIPYLQDSVLEDEDEVLVVLS  72

Query  66   EELGSFTEYVGGKEYAHVTLAPLESLAGMEETLVRDKACESINKIAVELSSEQIEKYYLP  125
            EELG+  E+VGG E+A   L PL+ LAG EE +VR+KA ES+ KIA E+ +   E+ +LP
Sbjct  73   EELGNLIEFVGGAEHAVCLLPPLQILAGAEELVVREKAVESLCKIAKEIPTSSFEESFLP  132

Query  126  ELQRLTNGDWFTPRTSACALFASVYDQSNTAARQELRNLYKKLSNDDTPMVRRSAAKNMA  185
             L  L+  DWFT RTSAC LF   Y ++N   ++ LR  +  L +DDTPMV+R+AA N+ 
Sbjct  133  LLFSLSKADWFTSRTSACGLFTVSYPRANAEMKKSLRKTFGGLCHDDTPMVKRAAATNLG  192

Query  186  DFVKVLPPQEILDDILPLYKKLSIDDQDSVRLLTVEALIAIMQKLDKQQVLTDLLPCVRS  245
             F K +  + +  +ILPL++ LS D+QDSVRLL VE    +   L  ++ +  +LP +++
Sbjct  193  SFAKQIEKESVKSEILPLFQSLSTDEQDSVRLLGVENCALLGSMLTNEENIQFILPTIKA  252

Query  246  ACNDASWRVRFMVGQKFVEVAECVTQDVIRDELIQAFVNLLKDNEAEVRTASSSQIPGIS  305
            +  D SWRVR+MV +   E+ E +  ++ + ELI AFV LLKD EAEVRT +S +I  + 
Sbjct  253  SSLDKSWRVRYMVARLLKELCESMGTEITKTELIGAFVKLLKDTEAEVRTEASLRIADVC  312

Query  306  KFVDQEIILAKILPVVREIAGDQSQHVRAAVGNELSGLAPLLGKEETVENLLPIFLQLLK  365
              + +E+ +  ILP V+++  D SQHVRAA+   +  LAP+ GKE+T+ +LL +FL LLK
Sbjct  313  SLLTKEMNIKTILPCVKDLVSDSSQHVRAALAQVIMSLAPIYGKEDTLTHLLELFLHLLK  372

Query  366  DEFPDVRLNIISRLDKVNEVIGIDYLSKALLPAIFELAEDKQWRVRQAIIEYIPLLAKQL  425
            D+FPDVRLNIIS+LD+V++VIGI+ LS++LLPAI ELAED QWRVR AII+YIPLLA QL
Sbjct  373  DDFPDVRLNIISKLDQVSKVIGIEMLSQSLLPAIVELAEDHQWRVRLAIIDYIPLLASQL  432

Query  426  GVEFFNEQLGNLCMSWLGDTVFSIRDAATINLKNLTEVFGSEWASQTVVPKVVAMGNHSN  485
            GVEFF+E+LGNLCM+WLGD VFSIR+AAT NLK LTEVFG +WA   ++PKV+++ +H N
Sbjct  433  GVEFFDEKLGNLCMTWLGDPVFSIREAATNNLKKLTEVFGVDWAKNNIIPKVLSLHSHPN  492

Query  486  YLYRMTTVFAITTMSPALEPKVIQEQILSIILSLTTDPIPNVRFNVAKCLEVLSGNLQQT  545
            YLYRMTT+F+I+T+S  +   VI   ++ ++  + +D +PN+RFNVAK  + +   L  T
Sbjct  493  YLYRMTTLFSISTLSTVVGGDVISSSMVPLLAKMVSDKVPNIRFNVAKTFQTIIPLLDST  552

Query  546  PEGQEVIQREILPAVEKLKEDQDADVRFFANKAIE  580
                 ++Q  + P + KL ED D DV+F+A++A++
Sbjct  553  -----IVQSRVKPLLVKLHEDTDKDVKFYASQALQ  582


>2AAA_DROME unnamed protein product
Length=591

 Score = 558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/578 (50%), Positives = 410/578 (71%), Gaps = 9/578 (2%)

Query  1    MDEQLFPVALLLDELKSDDVTLRLNAIHRISTIALALGPDRTRDELIPFLQDSLDDEDEV  60
            +D+ L+P+A+L+DELK++DV LRLN+I ++STIALALG +RTR ELIPFL +++ DEDEV
Sbjct  8    VDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGEERTRSELIPFLTETIYDEDEV  67

Query  61   LLALAEELGSFTEYVGGKEYAHVTLAPLESLAGMEETLVRDKACESINKIAVELSSEQIE  120
            LLALA++LG+FT  VGG E+A   + PLESLA +EET+VRDKA ES+  +A E S++ +E
Sbjct  68   LLALADQLGNFTSLVGGPEFAMYLIPPLESLATVEETVVRDKAVESLRTVAAEHSAQDLE  127

Query  121  KYYLPELQRLTNGDWFTPRTSACALFASVYDQSNTAARQELRNLYKKLSNDDTPMVRRSA  180
             + +P LQRL +GDWFT RTSAC LF+  Y +     + ELR  ++KL  D+TPMVRR+A
Sbjct  128  IHVVPTLQRLVSGDWFTSRTSACGLFSVCYPRVTQPVKAELRANFRKLCQDETPMVRRAA  187

Query  181  AKNMADFVKVLPPQEILDDILPLYKKLSIDDQDSVRLLTVEALIAIMQKLDKQQVLTDLL  240
            A  + +F KV+  + +  D++P + +L+ DDQDSVRLL VEA ++I Q L +  V   +L
Sbjct  188  ANKLGEFAKVVETEYLKSDLIPNFVQLAQDDQDSVRLLAVEACVSIAQLLPQDDVEHLVL  247

Query  241  PCVRSACNDASWRVRFMVGQKFVEVAECVTQDVIRDELIQAFVNLLKDNEAEVRTASSSQ  300
            P +R   +D+SWRVR+MV +KFV++ + V  ++ R +L+ AF  LLKD EAEVR A +++
Sbjct  248  PTLRQCASDSSWRVRYMVAEKFVDLQKAVGPEITRVDLVPAFQYLLKDAEAEVRAAVATK  307

Query  301  IPGISKFVDQ----EIILAKILPVVREIAGDQSQHVRAAVGNELSGLAPLLGKEETVENL  356
            +      +D+    +IIL+ ILP VR++  D + HV++A+ + + GL+P+LG  +TVE L
Sbjct  308  VKDFCANLDKVNQVQIILSSILPYVRDLVSDPNPHVKSALASVIMGLSPMLGAYQTVEQL  367

Query  357  LPIFLQLLKDEFPDVRLNIISRLDKVNEVIGIDYLSKALLPAIFELAEDKQWRVRQAIIE  416
            LP+FL  LKDE P+VRLNIIS LD VN+VIGI  LS++LLPAI ELAED +WRVR AIIE
Sbjct  368  LPLFLIQLKDECPEVRLNIISNLDCVNDVIGIQQLSQSLLPAIVELAEDSKWRVRLAIIE  427

Query  417  YIPLLAKQLGVEFFNEQLGNLCMSWLGDTVFSIRDAATINLKNLTEVFGSEWASQTVVPK  476
            Y+P LA QLG EFF+++L  LCM WL D V++IR+AAT+N+K L E FG+ WA Q ++P 
Sbjct  428  YMPALAGQLGQEFFDQKLRGLCMGWLNDHVYAIREAATLNMKKLVEQFGAPWAEQAIIPM  487

Query  477  VVAMGNHSNYLYRMTTVFAITTMSPALEPKVIQEQILSIILSLTTDPIPNVRFNVAKCLE  536
            ++ M  + NYL+RMT +F +  ++      +  + +L  +L L  DP+ NVRFNVAK L+
Sbjct  488  ILVMSRNKNYLHRMTCLFCLNVLAEVCGTDITTKLLLPTVLLLAADPVANVRFNVAKTLQ  547

Query  537  VLSGNLQQTPEGQEVIQREILPAVEKLKEDQDADVRFF  574
             +S  L+ +     VI  ++ P ++KL  D D DV+ F
Sbjct  548  KISPFLEAS-----VIDAQVKPTLDKLNTDTDVDVKHF  580


 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 119/267 (45%), Gaps = 9/267 (3%)

Query  322  REIAGDQSQHVRAAVGNELSGLAPLLGKEETVENLLPIFLQLLKDEFPDVRLNIISRLDK  381
            R++  D++  VR A  N+L   A ++  E    +L+P F+QL +D+   VRL  +     
Sbjct  173  RKLCQDETPMVRRAAANKLGEFAKVVETEYLKSDLIPNFVQLAQDDQDSVRLLAVEACVS  232

Query  382  VNEVIGIDYLSKALLPAIFELAEDKQWRVRQAIIEYIPLLAKQLGVEFFNEQLGNLCMSW  441
            + +++  D +   +LP + + A D  WRVR  + E    L K +G E     L       
Sbjct  233  IAQLLPQDDVEHLVLPTLRQCASDSSWRVRYMVAEKFVDLQKAVGPEITRVDLVPAFQYL  292

Query  442  LGDTVFSIRDAATINLK----NLTEVFGSEWASQTVVPKVVAMGNHSNYLYRMTTVFAIT  497
            L D    +R A    +K    NL +V   +    +++P V  + +  N   +      I 
Sbjct  293  LKDAEAEVRAAVATKVKDFCANLDKVNQVQIILSSILPYVRDLVSDPNPHVKSALASVIM  352

Query  498  TMSPALEPKVIQEQILSIILSLTTDPIPNVRFNVAKCLEVLSGNLQQTPEGQEVIQREIL  557
             +SP L      EQ+L + L    D  P VR N+   L+ ++  +     G + + + +L
Sbjct  353  GLSPMLGAYQTVEQLLPLFLIQLKDECPEVRLNIISNLDCVNDVI-----GIQQLSQSLL  407

Query  558  PAVEKLKEDQDADVRFFANKAIESITG  584
            PA+ +L ED    VR    + + ++ G
Sbjct  408  PAIVELAEDSKWRVRLAIIEYMPALAG  434


>2AAA_CAEEL unnamed protein product
Length=590

 Score = 558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/585 (49%), Positives = 406/585 (69%), Gaps = 9/585 (2%)

Query  2    DEQLFPVALLLDELKSDDVTLRLNAIHRISTIALALGPDRTRDELIPFLQDSLDDEDEVL  61
            D+ L+P+A+L+DEL+++DVTLRLN+I ++STIALALG +RTR+ELI FL D++ DEDEVL
Sbjct  9    DDALYPIAVLIDELRNEDVTLRLNSIRKLSTIALALGVERTRNELIQFLTDTIYDEDEVL  68

Query  62   LALAEELGSFTEYVGGKEYAHVTLAPLESLAGMEETLVRDKACESINKIAVELSSEQIEK  121
            L LAE+LG+FT  VGG ++ H  L PLE+LA +EET+VRDKA ES+ KIA + SS  +E+
Sbjct  69   LVLAEQLGNFTPLVGGPDHVHCLLLPLENLATVEETVVRDKAVESLRKIADKHSSASLEE  128

Query  122  YYLPELQRLTNGDWFTPRTSACALFASVYDQSNTAARQELRNLYKKLSNDDTPMVRRSAA  181
            +++P L+RL  GDWFT RTSAC LF+ VY + + A + EL+++++ L  DDTPMVRR+AA
Sbjct  129  HFVPMLRRLATGDWFTSRTSACGLFSVVYPRVSPAIKSELKSMFRTLCRDDTPMVRRAAA  188

Query  182  KNMADFVKVLPPQEILDDILPLYKKLSIDDQDSVRLLTVEALIAIMQKLDKQQVLTDLLP  241
              + +F KV     +++ +      L +D+QDSVRLLTVE+ IA    LDK      + P
Sbjct  189  AKLGEFAKVFEKTAVIEGLHSSLTDLHVDEQDSVRLLTVESAIAFGTLLDKANKKKLIEP  248

Query  242  CVRSACNDASWRVRFMVGQKFVEVAECVTQDVIRDELIQAFVNLLKDNEAEVRTASSSQI  301
             +    +D SWRVR+MV +K +E+   + +D+    L+  + NLLKD E EVR A++ ++
Sbjct  249  ILIELFDDKSWRVRYMVAEKLIEIQNVLGEDMDTTHLVNMYTNLLKDPEGEVRCAATQRL  308

Query  302  P----GISKFVDQEIILAKILPVVREIAGDQSQHVRAAVGNELSGLAPLLGKEETVENLL  357
                  + +   Q II   +L V +E+  D +Q V++ +   + GLAPL+GKE+TV  LL
Sbjct  309  QEFALNLPEDKRQNIICNSLLNVAKELVTDGNQLVKSELAGVIMGLAPLIGKEQTVSELL  368

Query  358  PIFLQLLKDEFPDVRLNIISRLDKVNEVIGIDYLSKALLPAIFELAEDKQWRVRQAIIEY  417
            PI++QLL D+ P+VRLNIIS LDKVNEVIG   LS +LLPAI  LAED +WRVR AI+++
Sbjct  369  PIYMQLLNDQTPEVRLNIISSLDKVNEVIGAAQLSTSLLPAIVGLAEDGKWRVRLAIVQF  428

Query  418  IPLLAKQLGVEFFNEQLGNLCMSWLGDTVFSIRDAATINLKNLTEVFGSEWASQTVVPKV  477
            +PLLA QLG EFF+E+L  LC++WL D VFSIR+A+T+ +K LT+ FG +WAS  +VPK+
Sbjct  429  MPLLASQLGQEFFDEKLLPLCLNWLTDHVFSIREASTLIMKELTQKFGGQWASTNIVPKM  488

Query  478  VAMGNHSNYLYRMTTVFAITTMSPALEPKVIQEQILSIILSLTTDPIPNVRFNVAKCLEV  537
              +   +NYL RMT +F + T+S A+  + I ++I+ I+  L  D +PNVRFN AK L+ 
Sbjct  489  QKLQKDTNYLQRMTCLFCLNTLSEAMTQEQILKEIMPIVKDLVEDDVPNVRFNAAKSLKR  548

Query  538  LSGNLQQTPEGQEVIQREILPAVEKLKEDQDADVRFFANKAIESI  582
            +  NL  TP     +  E+ P +EKL +D D DVR+F+ +A  S+
Sbjct  549  IGKNL--TP---STLTSEVKPLLEKLGKDSDFDVRYFSEEAKNSL  588



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03000.1.1 L-threonine

Length=393
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZN1_TRYB2  unnamed protein product                                 29.6    5.5  
Q7K2J4_DROME  unnamed protein product                                 28.9    8.1  


>Q57ZN1_TRYB2 unnamed protein product
Length=1675

 Score = 29.6 bits (65),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (51%), Gaps = 5/67 (7%)

Query  40   TVPTSEVLEAMVNATFYDEIYEGDATVAQL--EQKMATMAGKEAALWVVSGTQANQISLR  97
            TV   E++E +++       ++G+ T A+   +Q+ A  A K+A LWV    + NQ+  +
Sbjct  254  TVVYQEIMEKLLDCVI---TWQGEVTGARAREQQRDAAAAIKKAVLWVSLELRQNQLEAK  310

Query  98   THLHQPP  104
                 PP
Sbjct  311  PSTKAPP  317


>Q7K2J4_DROME unnamed protein product
Length=603

 Score = 28.9 bits (63),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (54%), Gaps = 11/63 (17%)

Query  296  YFTSELGLQLSVPTETNMVVI----DLE--AAGIPPRVFRHRLLQFGVRVFEQGRLVFHN  349
            YF  +     ++PT T    +    DLE  A+  PP+   H +L+ G+R  +QG  +++N
Sbjct  282  YFNKDF---YTLPTTTKRPTLAISSDLEDSASNSPPQ--NHMVLRKGIRKIKQGMKMYNN  336

Query  350  QIT  352
            Q++
Sbjct  337  QLS  339



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03010.1.1 60S

Length=188
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RL38_DROME  unnamed protein product                                   80.5    3e-20
Q38BR9_TRYB2  unnamed protein product                                 66.2    1e-14
Q8II62_PLAF7  unnamed protein product                                 48.9    4e-08


>RL38_DROME unnamed protein product
Length=70

 Score = 80.5 bits (197),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 9/68 (13%)

Query  118  EIKDIKNFLEIARRKDARSARIKKTKTIGAKGESAQLTKFKIRCSRYLYTLVVSDAEKAE  177
            EIK++K+FL  ARR DAR+ +IKK  T          TKFKIRCSR+LYTLVV D EKA+
Sbjct  4    EIKEVKDFLNKARRSDARAVKIKKNPTN---------TKFKIRCSRFLYTLVVQDKEKAD  54

Query  178  KLKQSLPP  185
            K+KQSLPP
Sbjct  55   KIKQSLPP  62


>Q38BR9_TRYB2 unnamed protein product
Length=82

 Score = 66.2 bits (160),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 9/69 (13%)

Query  118  EIKDIKNFLEIARRKDARSARIKKTKTIGAKGESAQLTKFKIRCSRYLYTLVVSDAEKAE  177
            EIK++K FL I  RKD R  ++K          + ++TKFK+RCSRYLYTLV++D +KA+
Sbjct  4    EIKNLKEFLAICSRKDVRCVKVK---------HNPKVTKFKVRCSRYLYTLVMADKKKAD  54

Query  178  KLKQSLPPS  186
            K+++S+ P+
Sbjct  55   KIERSIHPT  63


>Q8II62_PLAF7 unnamed protein product
Length=87

 Score = 48.9 bits (115),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 2/69 (3%)

Query  118  EIKDIKNFLEIARRKDARSARIKKTKTIGAKGESAQLTKFKIRCSRYLYTLVVSDAEKAE  177
            +I DI+ FL+I+R+ D  +  I   K      ++  +TK K+R  +YLYT+V +D +KAE
Sbjct  4    QITDIRKFLKISRKPDTTAVII--MKKKSKTKKNTVITKLKLRTKKYLYTMVFADRKKAE  61

Query  178  KLKQSLPPS  186
            +++ SL PS
Sbjct  62   RIENSLLPS  70



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03020.1.1 ABC

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EFD4_CAEEL  unnamed protein product                                 493     9e-163
Q9VF20_DROME  unnamed protein product                                 494     2e-162
ABCB5_DICDI  unnamed protein product                                  389     3e-124


>G5EFD4_CAEEL unnamed protein product
Length=801

 Score = 493 bits (1268),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 254/570 (45%), Positives = 368/570 (65%), Gaps = 8/570 (1%)

Query  244  KRMYDLGDILWPRNSVYLQSVAFFCLGLLVAGRYINLVVPIQLGKVIQDLTAFSSPWKHL  303
            K++  +   +WP  S+ LQ    FCL LL+ GR IN+ +PI L K I D  A    +++ 
Sbjct  206  KKVVTVAPYIWPTKSISLQLRVVFCLFLLIIGRLINVSLPI-LSKWIVDELATPDTFQYS  264

Query  304  ALYLV--LRFFQGSG---GLLQVIQSVAWIPITQWTDQKMSTHCFTHLLNLSLAFHTHRK  358
             L+L   L+F QG+G   G L  +++  WIPI Q+T +++    F HL +LSL +H  RK
Sbjct  265  LLFLATFLKFLQGNGAMGGFLNTVRTYLWIPIQQYTTRELEVELFKHLHSLSLRWHLSRK  324

Query  359  TGEILRILDKG-AALNGFFQILLFNIFPTIADILVALGYFFFKFGPLLSIIIATVMFLYG  417
            TG++LR++D+G +++N     +LFN+ PTIADI++A+ +FF  F     +I+   M LY 
Sbjct  325  TGQVLRVMDRGTSSVNNILNYILFNVVPTIADIVIAVIFFFSAFNAYFGLIVFGTMALYL  384

Query  418  FISIVITRWRTEQRRDYVAKDNATKAIYTDALLNYDTIKYFTAEDNEINRYTRAFKDFQA  477
             ++I IT WRT+  R+   KDNAT AI TD+L+NY+T+KY+  E+ E+NR+  A + +Q 
Sbjct  385  TVTISITEWRTQYIREANEKDNATSAIATDSLINYETVKYYGNEEFEVNRFKNAIESYQV  444

Query  478  VEKKVIASLYLLNMAQNIIIVSGIATGTAVVCAGIIKNKA-EAAELVVFLTFLQQLYVPL  536
             E K  ASL  LN  QN II  G+  G+  V   I+  K     + V+F T+L QLY PL
Sbjct  445  TEWKTQASLAFLNCLQNAIIGIGMIGGSVFVVYMIVHEKTLTVGDYVLFTTYLLQLYTPL  504

Query  537  NNLGSIYRAINTSLVDSERLMQLLAEPTDINDKPNAITLETRQPVIKFENVGFSYDTTND  596
            N  G+IYR I  + VD E +  L+ +  ++ D P+A+     +  I  +N+ F Y+T   
Sbjct  505  NFFGTIYRVIQKAFVDMENMFDLMNDEVEVKDLPHALPYTDPRGTISVKNLTFEYNTGLP  564

Query  597  ALSGLSFDVPTGKTVALVGESGSGKSTILRLLYRFYDIKEGSINIDGIDIRDMKQQSLRK  656
             +  +SF++  G+TVALVG SGSGKST++RLL+R ++  EGSI  DGID+R+    SLR+
Sbjct  565  VIKNISFEIGNGQTVALVGSSGSGKSTLIRLLFRLFESTEGSIEFDGIDVRNYTMHSLRQ  624

Query  657  HIAIIPQDCALFNETIAFNLKYGKENASEEEIMNAARAAQMHERVLSFSNGYDTRVGERG  716
             I I+PQD  LFN+TI +N+++G+ +AS+EE++ AA+AA +HE++ S   GY T VGERG
Sbjct  625  QIGIVPQDTVLFNDTIMYNIRFGRPDASDEEVIEAAKAAMIHEKITSLPEGYATMVGERG  684

Query  717  VRLSGGEKQRIAIARALLKDAPILCLDEATSALDTNTEREIQSAFNELSQGRTTIIIAHR  776
            ++LSGGEKQR+AIAR +LK    + LDEATSALDT TER IQ    +L + RT +++AHR
Sbjct  685  LKLSGGEKQRVAIARTILKKPQFIFLDEATSALDTPTERAIQKCLEKLCKSRTGVVVAHR  744

Query  777  LSTIAKADKILFIQNGRVTESGTHSELLSQ  806
            LST+  AD IL +  G + E G H ELL+Q
Sbjct  745  LSTVVNADLILVLDKGIILERGNHKELLAQ  774


>Q9VF20_DROME unnamed protein product
Length=866

 Score = 494 bits (1272),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 257/572 (45%), Positives = 364/572 (64%), Gaps = 12/572 (2%)

Query  243  FKRMYDLGDILWPRNSVYLQSVAFFCLGLLVAGRYINLVVPIQLGKVIQDLTAFSSP---  299
            ++++  +   LWP+ ++ LQ     C+ LL+AGR I L +PI   K++  LT   +P   
Sbjct  229  WRKLRTVFPYLWPKKNIALQIAVIVCIILLLAGRVIKLFLPIYRKKLVDSLTI--APIVF  286

Query  300  -WKHLALYLVLRFFQGSG----GLLQVIQSVAWIPITQWTDQKMSTHCFTHLLNLSLAFH  354
             W  + +Y+ L F QG G    GL   +++  WI + Q+T +++    F HL  LSL +H
Sbjct  287  RWDFVLIYVALSFLQGGGTGSMGLFNNLRTFLWIRVQQYTTREIEIELFRHLHQLSLRWH  346

Query  355  THRKTGEILRILDKGA-ALNGFFQILLFNIFPTIADILVALGYFFFKFGPLLSIIIATVM  413
              RKTGE+LR++D+G  ++N     ++F+I PTI D+LVA+ YF + F     +I+   M
Sbjct  347  LQRKTGEVLRVMDRGTDSINNLLNYIVFSIAPTILDLLVAVAYFVYAFNWWFGLIVFLTM  406

Query  414  FLYGFISIVITRWRTEQRRDYVAKDNATKAIYTDALLNYDTIKYFTAEDNEINRYTRAFK  473
            FLY   +I IT WRT+ +R     DN  +A   D+LLN++T+KY+ AE  E++ Y  A  
Sbjct  407  FLYIASTIAITEWRTKYQRRMNLADNEQRARSVDSLLNFETVKYYGAEHYEVDCYREAIL  466

Query  474  DFQAVEKKVIASLYLLNMAQNIIIVSGIATGTAVVCAGIIKNKA-EAAELVVFLTFLQQL  532
             +Q  E   + +L +LN AQNII+  G+  G+ +    ++ ++     + V+F T+L +L
Sbjct  467  KYQKEEFLSMLTLNMLNTAQNIILCLGLLAGSLLCVYLVVHHQTLTVGDFVLFSTYLMEL  526

Query  533  YVPLNNLGSIYRAINTSLVDSERLMQLLAEPTDINDKPNAITLETRQPVIKFENVGFSYD  592
            Y+PLN  G+ YRAI  + VD E +  LL E  +I D P    L T    I+F NV F Y 
Sbjct  527  YMPLNWFGTYYRAIQKNFVDMENMFDLLKEEEEIVDAPGCSPLLTAGGGIEFSNVTFGYS  586

Query  593  TTNDALSGLSFDVPTGKTVALVGESGSGKSTILRLLYRFYDIKEGSINIDGIDIRDMKQQ  652
                 L  +SF VP GKTVA+VG SG+GKSTI+RLL+RFYD++ G+I IDG +I+ ++QQ
Sbjct  587  PEKIVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQ  646

Query  653  SLRKHIAIIPQDCALFNETIAFNLKYGKENASEEEIMNAARAAQMHERVLSFSNGYDTRV  712
            SLRK I ++PQD  LFN TI +N++Y K  AS+E +  AARAA +HER+L F   Y+T+V
Sbjct  647  SLRKAIGVVPQDTVLFNNTIFYNIEYAKLGASDEAVYEAARAADIHERILGFPEKYETKV  706

Query  713  GERGVRLSGGEKQRIAIARALLKDAPILCLDEATSALDTNTEREIQSAFNELSQGRTTII  772
            GERG+RLSGGEKQR+AIAR LLK   I+ LDEATSALDT+TER IQ+A   +   RTTII
Sbjct  707  GERGLRLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCANRTTII  766

Query  773  IAHRLSTIAKADKILFIQNGRVTESGTHSELL  804
            +AHRLSTI  AD+IL +Q G + E G H EL+
Sbjct  767  VAHRLSTIIHADEILVLQQGSIAERGRHEELV  798


>ABCB5_DICDI unnamed protein product
Length=697

 Score = 389 bits (999),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 215/557 (39%), Positives = 325/557 (58%), Gaps = 6/557 (1%)

Query  253  LWPRNSVYLQSVAFFCLGLLVAGRYINLVVPIQLGKVIQDLTAFSSPWKHLALYLVLRFF  312
            LWP+++   +      + LL++ + + + +P     ++  LT   S    L L L+L + 
Sbjct  128  LWPKDNNDSKIRIITSVLLLLSAKVLTVQIPFIFKDIVDSLTTTQSEMLTLPLGLLLAYG  187

Query  313  Q---GSGGLLQVIQSVAWIPITQWTDQKMSTHCFTHLLNLSLAFHTHRKTGEILRILDKG  369
                 S G  ++ Q++ +  +     + +S   F  L  L L FH  R+TG + RI+D+G
Sbjct  188  AVKITSNGFQELRQTI-FSKVAHDAIRDVSCSTFKRLHQLDLTFHLSRQTGSLSRIIDRG  246

Query  370  A-ALNGFFQILLFNIFPTIADILVALGYFFFKFGPLLSIIIATVMFLYGFISIVITRWRT  428
               +N     +LF++ PT  +I +     +   G   S +    +  Y   ++ +T+WRT
Sbjct  247  GRGINFLLNSILFHVVPTAFEISLVSYVMYTTLGWEYSALSLATIAAYTVFTVKVTKWRT  306

Query  429  EQRRDYVAKDNATKAIYTDALLNYDTIKYFTAEDNEINRYTRAFKDFQAVEKKVIASLYL  488
            + R      DN       D+L+N++T+KYF  +  E+ RY    K++     K  +SL  
Sbjct  307  QFRVKMNKMDNEASNKMMDSLINFETVKYFNNDALEVERYHNYLKEYDKASLKTTSSLSF  366

Query  489  LNMAQNIIIVSGIATGTAVVCAGIIKNKAEAAELVVFLTFLQQLYVPLNNLGSIYRAINT  548
            LN  Q +I    +     +   G+++      +LV+    L Q+ +PLN LG++YR I  
Sbjct  367  LNFGQALIFSLSMTAMMIMAAQGVVQGNLSVGDLVLVNGLLFQISLPLNFLGTVYREIKQ  426

Query  549  SLVDSERLMQLLAEPTDINDKPNAITLETRQPVIKFENVGFSYDTTNDALSGLSFDVPTG  608
            SLVD + L  LL     I+D  ++  L+     I F ++ F Y+ +   L+ +SF+   G
Sbjct  427  SLVDMDHLFSLLNLNPKISDNKDSKPLKLENGTIVFRDISFKYNDSVQVLNNVSFECEGG  486

Query  609  KTVALVGESGSGKSTILRLLYRFYDIKEGSINIDGIDIRDMKQQSLRKHIAIIPQDCALF  668
            K +A+VG SGSGKST+LRLLYRFYD+  GSI IDG DIR ++ +SLRKHI ++PQD  LF
Sbjct  487  KRIAIVGSSGSGKSTLLRLLYRFYDVSSGSIEIDGQDIRGIQLESLRKHIGVVPQDTVLF  546

Query  669  NETIAFNLKYGKENASEEEIMNAARAAQMHERVLSFSNGYDTRVGERGVRLSGGEKQRIA  728
            N+TI +N+ YG  NA++E++ NAARAA +HE +L+  NGYDT VGERG++LSGGEKQR++
Sbjct  547  NDTIYYNIAYGNPNATKEQVENAARAAHIHEVILNMKNGYDTVVGERGLKLSGGEKQRVS  606

Query  729  IARALLKDAPILCLDEATSALDTNTEREIQSAFNELSQGRTTIIIAHRLSTIAKADKILF  788
            IARA+LKD+PI+  DEATS+LDT  E+ I  A  EL +GRTTI+IAHRLSTI  AD+I+ 
Sbjct  607  IARAILKDSPIVFYDEATSSLDTEKEKLIMDALRELFKGRTTIMIAHRLSTIVDADEIIV  666

Query  789  IQNGRVT-ESGTHSELL  804
            +  G +  E G H +LL
Sbjct  667  LGTGGIILERGNHQQLL  683



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03030.1.1 Methylcrotonoyl-CoA

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCCB_DROME  unnamed protein product                                   632     0.0  
MCCB_CAEEL  unnamed protein product                                   617     0.0  
Q385A6_TRYB2  unnamed protein product                                 554     0.0  


>MCCB_DROME unnamed protein product
Length=578

 Score = 632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/431 (71%), Positives = 353/431 (82%), Gaps = 17/431 (4%)

Query  1    MLVRDRIDALIDPGSPFLELSQLAAHQMY-ENQSPSAGIITGIGTIHGTECMIVANDATV  59
            +L R+RI+ L+D GSPFLELS LA H++Y E    S GI+TG+G + GTEC++VANDATV
Sbjct  80   LLARERINLLLDKGSPFLELSALAGHELYGEEVVNSGGIVTGVGRVCGTECLVVANDATV  139

Query  60   KGGTYYPMTAKKHLRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQAN  119
            KGG+YYP+T KKHLRAQEIA EN LPCIYLVDSGGANL  QA+ FPDK HFGRIF+NQAN
Sbjct  140  KGGSYYPITVKKHLRAQEIAQENRLPCIYLVDSGGANLPRQADVFPDKLHFGRIFYNQAN  199

Query  120  MSAKGIPQIAVVLGLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEEL  179
            MSA+GIPQIAVV+G CTAGGAYVPAM+D+SIIVK QGTI+LAGPPLV+AATGE VSAE+L
Sbjct  200  MSAQGIPQIAVVMGSCTAGGAYVPAMADESIIVKKQGTIFLAGPPLVKAATGEEVSAEDL  259

Query  180  GGADLHCRTSGVTDHYALNDHHALDLTRDIFKT-SLS-RNSLSDLCPH------------  225
            GGADLHC+TSGVTDHYAL+D HAL L R I    +LS  NS +D   H            
Sbjct  260  GGADLHCKTSGVTDHYALDDEHALYLARQIVSNLNLSATNSYNDQLMHSSQVNFQTATPP  319

Query  226  --FEEPLYPAEELYGIVGTDLKKSFDVKEVIMRIVDGSKFSEFKPLYGESLVTAFANIYG  283
               EEP Y AEELYGIVG +L KSFDV+EVI RIVDGS+F+EFK LYGE+LV  FA +YG
Sbjct  320  SAVEEPRYDAEELYGIVGPNLTKSFDVREVIARIVDGSRFTEFKKLYGETLVCGFAKLYG  379

Query  284  IKCGIVANNGVLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAK  343
               GIV NNGVLFSESALKG+HFI+LC QRKIPL+F+QNITGFMVG+DAE  GIAKNGAK
Sbjct  380  HTVGIVGNNGVLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAK  439

Query  344  MVTAVACAKVPKITLIIGGSYGAGNYGMCGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQ  403
            MVTAVACA VPK T+IIGGSYGAGNYGMCGR YSPRFL+ WPNS+I+VMGG QAA V+AQ
Sbjct  440  MVTAVACANVPKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAANVMAQ  499

Query  404  VTRENRRRVWK  414
            +T + R+R  K
Sbjct  500  ITEDQRKRAGK  510


>MCCB_CAEEL unnamed protein product
Length=608

 Score = 617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/412 (70%), Positives = 345/412 (84%), Gaps = 1/412 (0%)

Query  1    MLVRDRIDALIDPGSPFLELSQLAAHQMY-ENQSPSAGIITGIGTIHGTECMIVANDATV  59
            ML R+RID ++D GSPF+E SQLA ++MY + + PS GI+TG+G + G  C+IVANDATV
Sbjct  126  MLARERIDGIVDAGSPFIEFSQLAGYEMYGKEEVPSGGILTGVGIVSGRVCVIVANDATV  185

Query  60   KGGTYYPMTAKKHLRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQAN  119
            KGGTYYP+T KKHLRAQEIA EN LPCIYLVDSGGANL  QA+ F D  HFGRIF+NQA 
Sbjct  186  KGGTYYPITVKKHLRAQEIARENKLPCIYLVDSGGANLPRQADIFADSQHFGRIFYNQAT  245

Query  120  MSAKGIPQIAVVLGLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEEL  179
            MS++GIPQ+AVV+G CTAGGAYVPAMSDQ+IIVK  GT++L GPPLV+AATGE +SAEEL
Sbjct  246  MSSEGIPQLAVVMGSCTAGGAYVPAMSDQAIIVKGTGTVFLGGPPLVKAATGEEISAEEL  305

Query  180  GGADLHCRTSGVTDHYALNDHHALDLTRDIFKTSLSRNSLSDLCPHFEEPLYPAEELYGI  239
            GGADLHC  SGVTD+YA ND HAL L R                P+ +EPLYPAEE+YGI
Sbjct  306  GGADLHCGESGVTDYYAHNDKHALYLARSCIAGLPPVEEHMTFNPNADEPLYPAEEIYGI  365

Query  240  VGTDLKKSFDVKEVIMRIVDGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNGVLFSES  299
            VG++LKK++DV+EVI RIVDGS+F EFK  YGE+LVT FA IYG + GI+ANNGVLF+ES
Sbjct  366  VGSNLKKTYDVREVIARIVDGSRFHEFKERYGETLVTGFATIYGQRVGILANNGVLFAES  425

Query  300  ALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAKVPKITLI  359
            A+KGSHFIELCCQRKIPL+F+QNITGFMVG+DAE GGIAK+GAK+VTAVACAKVPKIT++
Sbjct  426  AMKGSHFIELCCQRKIPLLFLQNITGFMVGRDAEAGGIAKHGAKLVTAVACAKVPKITVL  485

Query  360  IGGSYGAGNYGMCGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQVTRENRRR  411
            +GGSYGAGNYGMCGR YSPR++F WPNS+I+VMGG QAA VL+ V +E ++R
Sbjct  486  VGGSYGAGNYGMCGRGYSPRYVFMWPNSRISVMGGEQAANVLSTVQKEKKKR  537


>Q385A6_TRYB2 unnamed protein product
Length=612

 Score = 554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 324/423 (77%), Gaps = 10/423 (2%)

Query  1    MLVRDRIDALIDPGSPFLELSQLAAHQMYENQS-PSAGIITGIGTIHGTECMIVANDATV  59
            +LV  RI+ L+DP SPFLELSQLA   +Y  ++    GI+TGIG +HG   MIVANDATV
Sbjct  134  LLVHQRIEKLVDPMSPFLELSQLAGGDLYPGEACHRGGILTGIGVVHGMRVMIVANDATV  193

Query  60   KGGTYYPMTAKKHLRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQAN  119
            KGGTYYP+T KKHLRAQ IA EN LPCIYLVDSGGANL  Q + FPD+ HFGRIFFNQAN
Sbjct  194  KGGTYYPITVKKHLRAQRIAEENRLPCIYLVDSGGANLGMQGDVFPDEQHFGRIFFNQAN  253

Query  120  MSAKGIPQIAVVLGLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEEL  179
            MSAKGI QIA V+G CTAGGAYVPAMSD+SIIVK  GTI+L GPPLV AATGE V+ EEL
Sbjct  254  MSAKGIAQIATVMGSCTAGGAYVPAMSDESIIVKGNGTIFLGGPPLVFAATGEEVTPEEL  313

Query  180  GGADLHCRTSGVTDHYALNDHHALDLTRDIFKTSLSRNSLSDLC--PHFEEPLYPAEELY  237
            GGAD+HCR SGVTD++A +D HAL LTR I   +L+RN     C    F  PLY   E+ 
Sbjct  314  GGADVHCRASGVTDYFATDDLHALYLTRRIV-ANLNRNDCERPCRGREFTPPLYDPSEIG  372

Query  238  GIV---GTDLKKSFDVKEVIMRIVDGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNGV  294
            G +   G D+ K FDV+ VI R+VDGS+F EFK LYG++LV  FA   G+  GIVANNG+
Sbjct  373  GFIPDMGADVVKGFDVRAVIARLVDGSEFDEFKKLYGDTLVCGFARFEGMLVGIVANNGI  432

Query  295  LFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAKVP  354
            L+SESALKG+HF+ELC  R IPL+F+QNITGFMVGK  E GGIAKNGAK+VTAV+   VP
Sbjct  433  LYSESALKGAHFVELCSHRNIPLLFLQNITGFMVGKTYEEGGIAKNGAKLVTAVSTTHVP  492

Query  355  KITLIIGGSYGAGNYGMCGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQVT---RENRRR  411
            KIT+IIGGSYGAGNYGMCGR + PRFLF WPN++I+VMGG QAA VLA      REN  +
Sbjct  493  KITIIIGGSYGAGNYGMCGRAFGPRFLFMWPNARISVMGGNQAATVLALTNSKLRENEVQ  552

Query  412  VWK  414
             +K
Sbjct  553  DFK  555



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03040.1.1 Pancreatic

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8T1_DROME  unnamed protein product                                 126     2e-34
Q7K3Z8_DROME  unnamed protein product                                 98.6    4e-24
Q9VX69_DROME  unnamed protein product                                 98.6    7e-24


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 126 bits (316),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 113/206 (55%), Gaps = 10/206 (5%)

Query  5    VGILAAEMVNKLVELNFTQYDRIHMIGHSLGAHVSGATGTYCKE-KMARITGLDPAGPGF  63
            V    A+++  L+E    + + +H+IG  LGAHV+G  G +  E K+  IT LDPA P +
Sbjct  123  VARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFY  182

Query  64   MVLMGNDMRLDMSDAQFVDVIHTAAGVAGYYGVLGHADFYPNSGKPPQPGCVELSLNVYK  123
            MV     ++LD +DA+FVDV+HT   + G    +GH DFY N G   QP C  ++     
Sbjct  183  MV-KDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVS-QPNCGPIN-----  235

Query  124  VVSSGFGCSHMRSYELYTESIVNPKAFKSIKCDSWYDYESKTYCNESDIQYMGDPVQPTA  183
             + + F C H R+ + Y ESI +P  F    C ++  +       + +I+ MG  V P A
Sbjct  236  KMETHF-CYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKA  294

Query  184  RGVYYLATGDKPPYSLIDNMTDSISR  209
            RG Y+L T + PPY+  +N T SISR
Sbjct  295  RGRYFLDTNNGPPYAKGENFT-SISR  319


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 98.6 bits (244),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 99/203 (49%), Gaps = 16/203 (8%)

Query  4    QVGILAAEMVNKLVELNFTQYDRIHMIGHSLGAHVSGATG------TYCKEKMARITGLD  57
            Q+G   A+++ K+ +      ++ H++GHS+G  ++G  G      T    K+ RI+ LD
Sbjct  115  QLGPELAKVLLKMFDHGL-DIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALD  173

Query  58   PAGPGFMVLMGNDMRLDMSDAQFVDVIHTAAGVAGYYGVLGHADFYPNSGKPPQPGCVEL  117
            PA P F         L  +DA+FVDVIHT A + G     G ADF+PN G   QPGC + 
Sbjct  174  PAFPLFY----PGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKR  229

Query  118  SLNVYKVVSSGFGCSHMRSYELYTESIVN--PKAFKSIKCDSWYDYESKTYCNESDIQYM  175
            +   YK++S     SH RS+  + ES+ +  P  F ++    W D++            M
Sbjct  230  N---YKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVM  286

Query  176  GDPVQPTARGVYYLATGDKPPYS  198
            G     T  G +YL T    P++
Sbjct  287  GHHCPTTIHGDFYLQTNGHTPFA  309


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 98.6 bits (244),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 106/221 (48%), Gaps = 33/221 (15%)

Query  2    THQVGILAAEMVNKLVELNFTQYDRIHMIGHSLGAHVSGATGTYCK----EKMARITGLD  57
            T ++G   A  + KL++L     + IH+IGHSLGAH+ G+ G + +    + + RITGLD
Sbjct  185  TEEIGENIALGLVKLLDL--VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLD  242

Query  58   PAGPGF---MVLMGNDMRLDMSDAQFVDVIHTAAGVAGYYGVLGHADFYPNSGKPPQPGC  114
            PA P F     L G    L   DA FVDVIH+  GV G    +G  DFYP    P   GC
Sbjct  243  PAKPCFNEGEALSG----LMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGC  298

Query  115  VELSLNVYKVVSSGFGCSHMRSYELYTESIV--NPKAFKSIKCDSWYDYESKTYCNESDI  172
              ++            C+H RS+E + E++   N + F + +C+S      + +    D 
Sbjct  299  FSVT------------CAHARSWEYFAETVFPGNERNFMATRCNSISKL--RDFRCPGDE  344

Query  173  QYMGDPVQPTARGVYYLATGDKPPYSLIDNMTDSISRAASL  213
              MG  V    +G Y+L      P+     M  S+ R+A L
Sbjct  345  VPMGYAVPQNIKGNYFLEVSASAPFG----MHASVVRSAHL  381



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03050.1.1 Lipase

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8T1_DROME  unnamed protein product                                 161     4e-45
Q7K3Z8_DROME  unnamed protein product                                 150     5e-41
Q9VX69_DROME  unnamed protein product                                 137     1e-35


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 160/321 (50%), Gaps = 27/321 (8%)

Query  173  NQQVSFWLYTRYNPQCKQILYVNDPDSILDSY-FSSDKKTVVLVHGWLNAGNMSFSQTLK  231
            N  +SFWLYT+ N +  ++         L+ + F   K   VL+HG+    + S +  L+
Sbjct  35   NANISFWLYTKENQEGTKLSVFE-----LNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLR  89

Query  232  NSYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLV  291
              +L   DYN+I +D+  LA    Y  A    KY+ +  A +L  +  +        HL+
Sbjct  90   PLFLT-QDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLI  148

Query  292  GHSLGAHVCGIAGENIAHGKIGRITGLDPALPLF-SSNITGRLDSTDATFVDIIHTCGGY  350
            G  LGAHV G  G+ +   K+  IT LDPA P +   +   +LD TDA FVD++HT    
Sbjct  149  GLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTM  208

Query  351  LGYYQPCGHVDFYPNGGTFIQPGCG----WDIGTCSHTRSYMFFTESIRTKIGFYARQCN  406
            LG     GHVDFY N G   QP CG     +   C H R+  ++ ESI +  GFY   C 
Sbjct  209  LGLLDAVGHVDFYLNMGV-SQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCP  267

Query  407  SWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYALGRYFPQPKHDTFPSSR  466
            ++  + KG C    +++ LMG HV+  ARG+Y+L T +  PYA G        + F S  
Sbjct  268  NFKSFAKGICIPD-KNIELMGFHVDPKARGRYFLDTNNGPPYAKG--------ENFTSIS  318

Query  467  GQLRGHLRTYRKYVNSVLIKE  487
             QL+G     R +VN  +I +
Sbjct  319  RQLKG-----RTFVNDDIIDK  334


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 146/302 (48%), Gaps = 24/302 (8%)

Query  168  SKSELNQQVSFWLYTRYNPQCKQILYVNDPDSIL-DSYFSSDKKTVVLVHGWLNAGNMSF  226
            SK++L     F LY         I  + D  S+L D +    K TV+ +HG+L   ++  
Sbjct  18   SKADLTT-AKFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVES  76

Query  227  SQTLKNSYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWC  286
               +  +YLE  D N+I +DW  LA       A   +K +G  LA +L  +    G D  
Sbjct  77   IHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKM-FDHGLDIE  135

Query  287  MFHLVGHSLGAHVCGIAGENIAHG-----KIGRITGLDPALPLFSSNITGRLDSTDATFV  341
             FH+VGHS+G  + G+ G  I        KI RI+ LDPA PLF       L + DA FV
Sbjct  136  KFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT--HLSANDAEFV  193

Query  342  DIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGW-------DIGTCSHTRSYMFFTESI  394
            D+IHT     G     G  DF+PNGG  +QPGC         D    SH RS+ F+ ES+
Sbjct  194  DVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESV  253

Query  395  --RTKIGFYARQCNSWSDYKKGHCKGSVEDM--ILMGEHVNTSARGKYYLMTASSKPYAL  450
              R  IGF A     WSD+K+      VE+   ++MG H  T+  G +YL T    P+A 
Sbjct  254  SDRYPIGFDAVPAKKWSDFKQNKI---VENCPPVVMGHHCPTTIHGDFYLQTNGHTPFAR  310

Query  451  GR  452
            G+
Sbjct  311  GK  312


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 142/271 (52%), Gaps = 18/271 (7%)

Query  189  KQILYVNDPDSILDS-YFSSDKKTVVLVHGWLNAGNMSFS-QTLKNSYLELHDYNIICVD  246
            K+   +  P+S+  S  F   KK V+L  GW    N S + +    +Y    D N + VD
Sbjct  110  KKNFPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVD  169

Query  247  WSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGHSLGAHVCGIAGEN  306
             +    + LY  + +  + IG+++A  L  +      +    HL+GHSLGAH+ G AG +
Sbjct  170  AARFV-DTLYTWSAFNTEEIGENIALGLVKLLDLVPVE--NIHLIGHSLGAHIVGSAGRH  226

Query  307  IAH---GKIGRITGLDPALPLFSSN--ITGRLDSTDATFVDIIHTCGGYLGYYQPCGHVD  361
            + H     I RITGLDPA P F+    ++G L   DA FVD+IH+  G LG   P G VD
Sbjct  227  LQHLTNQTIPRITGLDPAKPCFNEGEALSG-LMRGDAHFVDVIHSNPGVLGKRDPVGDVD  285

Query  362  FYPNGGTFIQPGCGWDIGTCSHTRSYMFFTESI--RTKIGFYARQCNSWSDYKKGHCKGS  419
            FYP G + +  GC + + TC+H RS+ +F E++    +  F A +CNS S  +   C G 
Sbjct  286  FYPGGMSPLAAGC-FSV-TCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCPG-  342

Query  420  VEDMILMGEHVNTSARGKYYLMTASSKPYAL  450
              D + MG  V  + +G Y+L  ++S P+ +
Sbjct  343  --DEVPMGYAVPQNIKGNYFLEVSASAPFGM  371



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03050.1.2 Lipase

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8T1_DROME  unnamed protein product                                 127     6e-35
Q7K3Z8_DROME  unnamed protein product                                 116     9e-31
Q8SXG0_DROME  unnamed protein product                                 117     1e-30


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 127 bits (320),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 108/205 (53%), Gaps = 20/205 (10%)

Query  16   FHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLF-SSNITGRLDSTDATFVDIIHT  74
             HL+G  LGAHV G  G+ +   K+  IT LDPA P +   +   +LD TDA FVD++HT
Sbjct  145  LHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHT  204

Query  75   CGGYLGYYQPCGHVDFYPNGGTFIQPGCG----WDIGTCSHTRSYMFFTESIRTKIGFYA  130
                LG     GHVDFY N G   QP CG     +   C H R+  ++ ESI +  GFY 
Sbjct  205  DVTMLGLLDAVGHVDFYLNMGV-SQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYG  263

Query  131  RQCNSWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYALGRYFPQPKHDTF  190
              C ++  + KG C    +++ LMG HV+  ARG+Y+L T +  PYA G        + F
Sbjct  264  FYCPNFKSFAKGICIPD-KNIELMGFHVDPKARGRYFLDTNNGPPYAKG--------ENF  314

Query  191  PSSRGQLRGHLRTYRKYVNSVLIKE  215
             S   QL+G     R +VN  +I +
Sbjct  315  TSISRQLKG-----RTFVNDDIIDK  334


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 116 bits (291),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 95/187 (51%), Gaps = 21/187 (11%)

Query  10   GYDWCMFHLVGHSLGAHVCGIAGENIAHG-----KIGRITGLDPALPLFSSNITGRLDST  64
            G D   FH+VGHS+G  + G+ G  I        KI RI+ LDPA PLF       L + 
Sbjct  131  GLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT--HLSAN  188

Query  65   DATFVDIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGW-------DIGTCSHTRSYMF  117
            DA FVD+IHT     G     G  DF+PNGG  +QPGC         D    SH RS+ F
Sbjct  189  DAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWF  248

Query  118  FTESI--RTKIGFYARQCNSWSDYKKGHCKGSVED--MILMGEHVNTSARGKYYLMTASS  173
            + ES+  R  IGF A     WSD+K+      VE+   ++MG H  T+  G +YL T   
Sbjct  249  WAESVSDRYPIGFDAVPAKKWSDFKQNKI---VENCPPVVMGHHCPTTIHGDFYLQTNGH  305

Query  174  KPYALGR  180
             P+A G+
Sbjct  306  TPFARGK  312


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 96/169 (57%), Gaps = 11/169 (7%)

Query  16   FHLVGHSLGAHVCGIAGENIAH---GKIGRITGLDPALPLFSS-NITGRLDSTDATFVDI  71
             HL+GHSLGAH+ G AG ++ H     I RITGLDPA P F+       L   DA FVD+
Sbjct  208  IHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDV  267

Query  72   IHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGWDIGTCSHTRSYMFFTESI--RTKIGFY  129
            IH+  G LG   P G VDFYP G + +  GC + + TC+H RS+ +F E++    +  F 
Sbjct  268  IHSNPGVLGKRDPVGDVDFYPGGMSPLAAGC-FSV-TCAHARSWEYFAETVFPGNERNFM  325

Query  130  ARQCNSWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYAL  178
            A +CNS S  +   C G   D + MG  V  + +G Y+L  ++S P+ +
Sbjct  326  ATRCNSISKLRDFRCPG---DEVPMGYAVPQNIKGNYFLEVSASAPFGM  371



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03060.1.1 Methylcrotonoyl-CoA

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCCB_DROME  unnamed protein product                                   751     0.0  
MCCB_CAEEL  unnamed protein product                                   734     0.0  
Q385A6_TRYB2  unnamed protein product                                 644     0.0  


>MCCB_DROME unnamed protein product
Length=578

 Score = 751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/549 (66%), Positives = 441/549 (80%), Gaps = 18/549 (3%)

Query  14   FYSKINTKSSQFQQNHDDMVQLVEILKSNVRKIVQGDA-RSQEKHLKKGKMLVRDRIDAL  72
             +S+++ +S+++++N  +M  LV  L++   ++++G   ++ E+H  +GK+L R+RI+ L
Sbjct  30   LHSEVDKQSAEYKENAREMASLVGDLRNFTSQVLKGGGQKAIERHTSRGKLLARERINLL  89

Query  73   IDPGSPFLELSQLAAHQMY-ENQSPSAGIITGIGTIHGTECMIVANDATVKGGTYYPMTA  131
            +D GSPFLELS LA H++Y E    S GI+TG+G + GTEC++VANDATVKGG+YYP+T 
Sbjct  90   LDKGSPFLELSALAGHELYGEEVVNSGGIVTGVGRVCGTECLVVANDATVKGGSYYPITV  149

Query  132  KKHLRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQANMSAKGIPQIA  191
            KKHLRAQEIA EN LPCIYLVDSGGANL  QA+ FPDK HFGRIF+NQANMSA+GIPQIA
Sbjct  150  KKHLRAQEIAQENRLPCIYLVDSGGANLPRQADVFPDKLHFGRIFYNQANMSAQGIPQIA  209

Query  192  VVLGLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEELGGADLHCRTS  251
            VV+G CTAGGAYVPAM+D+SIIVK QGTI+LAGPPLV+AATGE VSAE+LGGADLHC+TS
Sbjct  210  VVMGSCTAGGAYVPAMADESIIVKKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCKTS  269

Query  252  GVTDHYALNDHHALDLTRDIFKT-SLS-RNSLSDLC--------------PDFEEPLYPA  295
            GVTDHYAL+D HAL L R I    +LS  NS +D                   EEP Y A
Sbjct  270  GVTDHYALDDEHALYLARQIVSNLNLSATNSYNDQLMHSSQVNFQTATPPSAVEEPRYDA  329

Query  296  EELYGIVGTDLKKSFDVKEVIMRIVDGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNG  355
            EELYGIVG +L KSFDV+EVI RIVDGS+F+EFK LYGE+LV  FA +YG   GIV NNG
Sbjct  330  EELYGIVGPNLTKSFDVREVIARIVDGSRFTEFKKLYGETLVCGFAKLYGHTVGIVGNNG  389

Query  356  VLFSESALKGSHFIELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAKV  415
            VLFSESALKG+HFI+LC QRKIPL+F+QNITGFMVG+DAE  GIAKNGAKMVTAVACA V
Sbjct  390  VLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAKMVTAVACANV  449

Query  416  PKITLIIGGSYGAGNYGMCGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQVTRENRRRVG  475
            PK T+IIGGSYGAGNYGMCGR YSPRFL+ WPNS+I+VMGG QAA V+AQ+T + R+R G
Sbjct  450  PKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAANVMAQITEDQRKRAG  509

Query  476  KPWTEEDETKLKSPIIKKFDQESDCYYATARLWDDGIIDPADTRKVLGLSLSVALKSPIE  535
            K ++EE+  KLK+PI++ F+ E   YY+TARLWDDGIIDPA+TR++LGLSL  AL +  +
Sbjct  510  KEFSEEEAQKLKAPIVEMFEAEGSPYYSTARLWDDGIIDPANTRQILGLSLKAALNNAGQ  569

Query  536  DTKFGVFRM  544
            +TKFGVFRM
Sbjct  570  ETKFGVFRM  578


>MCCB_CAEEL unnamed protein product
Length=608

 Score = 734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/531 (65%), Positives = 425/531 (80%), Gaps = 2/531 (0%)

Query  16   SKINTKSSQFQQNHDDMVQLVEILKSNVRKIVQ-GDARSQEKHLKKGKMLVRDRIDALID  74
            + I+  S  F  N  +M  LVE LK+ + KI Q G  ++ + H  +GKML R+RID ++D
Sbjct  78   TSIDNSSDDFAANTAEMKVLVEDLKAKISKIEQAGGEKAVKLHRSRGKMLARERIDGIVD  137

Query  75   PGSPFLELSQLAAHQMY-ENQSPSAGIITGIGTIHGTECMIVANDATVKGGTYYPMTAKK  133
             GSPF+E SQLA ++MY + + PS GI+TG+G + G  C+IVANDATVKGGTYYP+T KK
Sbjct  138  AGSPFIEFSQLAGYEMYGKEEVPSGGILTGVGIVSGRVCVIVANDATVKGGTYYPITVKK  197

Query  134  HLRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQANMSAKGIPQIAVV  193
            HLRAQEIA EN LPCIYLVDSGGANL  QA+ F D  HFGRIF+NQA MS++GIPQ+AVV
Sbjct  198  HLRAQEIARENKLPCIYLVDSGGANLPRQADIFADSQHFGRIFYNQATMSSEGIPQLAVV  257

Query  194  LGLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEELGGADLHCRTSGV  253
            +G CTAGGAYVPAMSDQ+IIVK  GT++L GPPLV+AATGE +SAEELGGADLHC  SGV
Sbjct  258  MGSCTAGGAYVPAMSDQAIIVKGTGTVFLGGPPLVKAATGEEISAEELGGADLHCGESGV  317

Query  254  TDHYALNDHHALDLTRDIFKTSLSRNSLSDLCPDFEEPLYPAEELYGIVGTDLKKSFDVK  313
            TD+YA ND HAL L R                P+ +EPLYPAEE+YGIVG++LKK++DV+
Sbjct  318  TDYYAHNDKHALYLARSCIAGLPPVEEHMTFNPNADEPLYPAEEIYGIVGSNLKKTYDVR  377

Query  314  EVIMRIVDGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNGVLFSESALKGSHFIELCC  373
            EVI RIVDGS+F EFK  YGE+LVT FA IYG + GI+ANNGVLF+ESA+KGSHFIELCC
Sbjct  378  EVIARIVDGSRFHEFKERYGETLVTGFATIYGQRVGILANNGVLFAESAMKGSHFIELCC  437

Query  374  QRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAKVPKITLIIGGSYGAGNYGM  433
            QRKIPL+F+QNITGFMVG+DAE GGIAK+GAK+VTAVACAKVPKIT+++GGSYGAGNYGM
Sbjct  438  QRKIPLLFLQNITGFMVGRDAEAGGIAKHGAKLVTAVACAKVPKITVLVGGSYGAGNYGM  497

Query  434  CGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQVTRENRRRVGKPWTEEDETKLKSPIIKK  493
            CGR YSPR++F WPNS+I+VMGG QAA VL+ V +E ++R G  WT++ + +L+ P+ +K
Sbjct  498  CGRGYSPRYVFMWPNSRISVMGGEQAANVLSTVQKEKKKREGADWTDQQDLELRKPVEEK  557

Query  494  FDQESDCYYATARLWDDGIIDPADTRKVLGLSLSVALKSPIEDTKFGVFRM  544
            F++E   Y+A+ARLWDDG+IDP DTRKVLGL+    L+ PI +TKFGVFRM
Sbjct  558  FEKEGHPYFASARLWDDGVIDPKDTRKVLGLAFQSTLQKPIPETKFGVFRM  608


>Q385A6_TRYB2 unnamed protein product
Length=612

 Score = 644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/535 (60%), Positives = 392/535 (73%), Gaps = 19/535 (4%)

Query  20   TKSSQFQQNHDDMVQLVEILKSNVRKIVQGDA----RSQEKHLKKGKMLVRDRIDALIDP  75
            + + +F+ N + M  L   L+  V+ IV GD+    R++++H+ +GK+LV  RI+ L+DP
Sbjct  87   STNPEFKANTERMKALTAELRRRVQVIVDGDSEADKRARDRHISRGKLLVHQRIEKLVDP  146

Query  76   GSPFLELSQLAAHQMYENQS-PSAGIITGIGTIHGTECMIVANDATVKGGTYYPMTAKKH  134
             SPFLELSQLA   +Y  ++    GI+TGIG +HG   MIVANDATVKGGTYYP+T KKH
Sbjct  147  MSPFLELSQLAGGDLYPGEACHRGGILTGIGVVHGMRVMIVANDATVKGGTYYPITVKKH  206

Query  135  LRAQEIANENHLPCIYLVDSGGANLQYQAETFPDKNHFGRIFFNQANMSAKGIPQIAVVL  194
            LRAQ IA EN LPCIYLVDSGGANL  Q + FPD+ HFGRIFFNQANMSAKGI QIA V+
Sbjct  207  LRAQRIAEENRLPCIYLVDSGGANLGMQGDVFPDEQHFGRIFFNQANMSAKGIAQIATVM  266

Query  195  GLCTAGGAYVPAMSDQSIIVKNQGTIYLAGPPLVQAATGEVVSAEELGGADLHCRTSGVT  254
            G CTAGGAYVPAMSD+SIIVK  GTI+L GPPLV AATGE V+ EELGGAD+HCR SGVT
Sbjct  267  GSCTAGGAYVPAMSDESIIVKGNGTIFLGGPPLVFAATGEEVTPEELGGADVHCRASGVT  326

Query  255  DHYALNDHHALDLTRDIFKTSLSRNSLSDLC--PDFEEPLYPAEELYGIV---GTDLKKS  309
            D++A +D HAL LTR I   +L+RN     C   +F  PLY   E+ G +   G D+ K 
Sbjct  327  DYFATDDLHALYLTRRIV-ANLNRNDCERPCRGREFTPPLYDPSEIGGFIPDMGADVVKG  385

Query  310  FDVKEVIMRIVDGSKFSEFKPLYGESLVTAFANIYGIKCGIVANNGVLFSESALKGSHFI  369
            FDV+ VI R+VDGS+F EFK LYG++LV  FA   G+  GIVANNG+L+SESALKG+HF+
Sbjct  386  FDVRAVIARLVDGSEFDEFKKLYGDTLVCGFARFEGMLVGIVANNGILYSESALKGAHFV  445

Query  370  ELCCQRKIPLIFIQNITGFMVGKDAEMGGIAKNGAKMVTAVACAKVPKITLIIGGSYGAG  429
            ELC  R IPL+F+QNITGFMVGK  E GGIAKNGAK+VTAV+   VPKIT+IIGGSYGAG
Sbjct  446  ELCSHRNIPLLFLQNITGFMVGKTYEEGGIAKNGAKLVTAVSTTHVPKITIIIGGSYGAG  505

Query  430  NYGMCGRPYSPRFLFTWPNSKIAVMGGAQAAGVLAQVTRENRRRVGKPWTEEDETKLKSP  489
            NYGMCGR + PRFLF WPN++I+VMGG QAA VLA    + R        E +    K+ 
Sbjct  506  NYGMCGRAFGPRFLFMWPNARISVMGGNQAATVLALTNSKLR--------ENEVQDFKAK  557

Query  490  IIKKFDQESDCYYATARLWDDGIIDPADTRKVLGLSLSVALKSPIEDTKFGVFRM  544
            +  K++ E  CYY+TARLWDDG+I P DTR V+  +L   L +P  +TKFGVFRM
Sbjct  558  VRSKYEYEGSCYYSTARLWDDGVIAPEDTRAVVVQALLSTLSAPCGETKFGVFRM  612



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= Dcitr00g03070.1.1 Methyl-accepting

Length=91
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLB26_CAEEL  unnamed protein product                                  38.1    2e-04
Q4Q8R1_LEIMA  unnamed protein product                                 33.9    0.010
FHBA_DICDI  unnamed protein product                                   29.3    0.36 


>GLB26_CAEEL unnamed protein product
Length=183

 Score = 38.1 bits (87),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  1    MAFVQKAIARLHEPDKLDTLLRDLGKKHYTY----GAKAKYVDLIGPQFISAIQ  50
            + F+QK +  L EPDK+  L +++G+KH  Y    G K  Y D +G      I+
Sbjct  82   VEFLQKVMQSLDEPDKISKLCQEIGQKHAKYRRSKGMKIDYWDKLGEAITETIR  135


>Q4Q8R1_LEIMA unnamed protein product
Length=616

 Score = 33.9 bits (76),  Expect = 0.010, Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 0/76 (0%)

Query  8    IARLH